5DBBA

Structure of human dna polymerase beta host-guest complex with the dg base paired with a da
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
329
structure length
327
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title N7 Methylation Alters Hydrogen-Bonding Patterns of Guanine in Duplex DNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
molecule keywords DNA polymerase beta
total genus 99
structure length 327
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2015-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 5dbbA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 5dbbA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 5dbbA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5dbbA03
4KLJA 2W8LA 5HREA 3M9OB 2MUTB 3BQ0A 3C1ZA 3AU6A 2JZBB 2AGQA 1RXVA 2FLLA 4NLZA 1UEVA 8ICHA 4K4HA 2M2UA 4AT7A 3IM1A 3GV8B 4RQ6A 1NJYA 1XWLA 1ZQFA 4YCXA 2PI4A 2DR5A 3GIJA 2XCPA 1ZQDA 4M9NA 4O3PA 1BPBA 1S76D 1JQRA 5J2CA 5KT6A 5BOLA 3JZ0A 5J2FA 4F5OA 4FS1A 1TKDA 5HHIA 2AU0A 3BDPA 5HRBA 3H8WA 4XQ8A 4RPYA 2WTFA 5L1JA 1TV9A 1NJZA 5IIOA 3C2LA 4ED8A 3THVA 4NKTA 4MF8A 4QWBA 1HUOA 1RXWA 1DK3A 3C5GA 4KLHA 4UB1A 4DQPA 3PV8A 8ICOA 3AQLA 3ZD9A 2ZH7A 3GIIA 1TFWA 1A77A 4DQSA 2NRZA 2ZUBA 3C2MA 8ICPA 4JV2A 4G3IA 4R8UB 2ZUDA 2JEJA 3JPTA 3V6JA 4ELUA 4ECTA 3UPSA 4IG8A 1AROP 5KFKA 2KZ3A 3RR8A 1ZQGA 2AGOA 5HRDA 4CCHA 5HRGA 1ZQZA 3BQTA 5CHGA 2FMQA 1KDHA 3GIKA 9ICCA 3RRHA 4KN4A 1T3NA 1XC9A 3RTVA 3T5LA 5DG7A 1WOTA 4YP3A 1D8YA 4PHDA 2JEGA 1KFDA 4F5PA 1ZETA 4EEYA 3HW8A 5EWFA 3RJGA 7ICHA 4DL7A 4KLIA 2AGPA 3UPQA 3H37A 5J2GA 5J2IA 5DBAA 3RBDA 4Z6DA 1BPZA 4DLGA 7ICOA 4KN7A 3NGDA 4DF4A 4I2AA 4Q45A 5F9LA 4ECXA 3ZDCA 4F3OA 3K4GA 8ICZA 1UT8A 4DSFA 1NKCA 2B21A 2F1JA 3Q8QB 3L9DA 4WC7A 1PZNA 2ISOA 4I2DA 3PR4A 3ZDAA 4RWQA 5J2JA 1T4GA 3KHGA 8ICQA 4MEXA 5KFPA 2R8IA 3V6KA 4F4KA 4NXZA 3H3AA 8ICKA 1UA0A 1NJXA 1NKEA 4KLGA 2HHTA 4RWOA 4YMOA 5HRHA 5DQGA 4QZFA 2J6UA 1SKRA 5KFVA 3PW5A 4KLMA 4GXIA 8ICCA 3C23A 2R8HA 3PO4A 4I2GA 1ZQOA 5KG3A 2ATLA 2W9MA 2NRKA 1TK8A 1DOQA 3OHAA 4F50A 3JPPA 3ISDA 3TFRA 3BQ1A 4GXKA 2ZH3A 4ED1A 4I2HA 1TFRA 4UBCA 3M8SA 4ECUA 4ED3A 2IA6A 4EBKA 4KLUA 4DS4A 4FHWA 9ICNA 1QSSA 4YFKA 4I28A 9ICHA 1BNOA 4RT2A 1ZQUA 3V6HA 4QWCA 2BQ3A 2P66A 4O9MA 9ICVA 2ZUCA 3QZ7A 2AQ4A 5KFWA 2MUTA 4RQ7A 3NTUA 4Q43A 4QWEA 1U49A 2KFNA 2R8GA 1R89A 5C5JA 4QZEA 3TAQA 1ZQXA 3ZD8A 5DLFA 3K75D 4MEYA 1MSWD 3T3FA 4F91B 3RR7A 1XO1A 5CJ7A 5J0WA 4PGYA 5KFNA 3HP6A 1X9MA 3RRGA 4E0DA 7ICNA 1MIYA 5DKWA 2ASLA 2DFLA 4KTQA 2BCRA 3PVXA 2HVHA 2HW3A 8ICFA 3WFOA 1SL1A 1S0OA 2BR0A 8ICJA 5DGBA 4DFPA 5EWGA 3GILA 4FBUA 4M9JA 1ZQTA 1BGXT 4JK1A 3ORYA 3RH4A 4FHVA 5KG7A 4WC4A 4M5DA 3PR5B 4R63A 3SYZA 4F4YA 1RYRA 5IIIA 3C66A 5CP2A 4RT3A 2VANA 2FLNA 5L1LA 1SL2A 4B9NA 4O3OA 1L3UA 2ISPA 3RJJA 4PH5A 1V9PA 2M2WA 4FHYA 3SZ2A 1ZQVA 5J2KA 3OGUA 2XC9A 4B9VA 4O5CA 4QW8A 3H39A 4BWMA 5KFIA 5KFHA 4ECRA 1V4AA 1TAUA 3V7LA 5KFAA 4MFAA 4EBDA 2V9WA 4B9UA 4I2CA 4TUPA 1DK2A 3HIYA 1Q78A 3GDXA 2AJQA 4R65A 2XY7A 4M47A 3OSPA 1VJ7A 4IQTA 2V4QA 5HRFA 2BCQA 2HHPA 3JPNA 4NLGA 2A1JB 3RAQA 2ZTDA 2MAXA 3Q8MA 1ZQIA 2FMSA 4E8FA 1ZJMA 4C8KA 3H38A 5J2HA 3WFQE 3AUOA 3LWMA 2KZZA 4WC6A 5J0XA 3OV7A 4O3NA 1L3VA 4QZIA 5DLGA 3GIMA 1BPYA 3SV3A 3H4DA 2ZH1A 5KTQA 5KT3A 3MR2A 3B0YA 1EXNA 2FPKA 2J6SA 4FO6A 1S97A 2PFOA 7ICUA 2HHVA 5KFTA 2FLPA 4EZ6A 4C8OA 3N97B 4UD4A 1ZQYA 3MABA 4LZDA 4F4WA 2ASDA 1PX5A 4ECYA 4RZRA 2DRAA 2NRVA 4DL2A 2NRWA 4UB4A 4NM2A 9ICWA 4P4PA 2DRBA 4EP7A 5BOMA 2HHUA 4XQ7A 3B0XA 3RB4A 3MGHA 1WCNA 9ICTA 2BCSA 5CB1A 1Q79A 5DQIA 4ZH4A 4KLQA 2BCVA 3RH6A 2IMWP 2HHWA 4DQIA 1BNPA 5IIKA 4PHPA 4QZAA 4UAYA 5IILA 4X4PA 4DFMA 5KFOA 3MDCA 3LWLA 3LQCB 4X0BA 3KHHA 3EPGA 4ED6A 3AQMA 4FBTA 2KFZA 1K1QA 4PGQA 4UQGA 2M9NA 4QZ8A 4UBBA 3GQCA 1X9SA 4KLEA 2PXIA 3UXPA 1XS9D 4IRDA 2O1PA 1NK4A 2R8JA 5DB6A 4DS5A 9ICGA 8ICIA 4YXJA 1UT5A 4ED7A 3ETLA 4QZ9A 2V4RA 4F5NA 4RUCA 4RNOA 2BGWA 1KLNA 1NK0A 3T5HA 1TVAA 2PFPA 5HRIA 3UXNA 5HC9A 1R8CA 3H40A 4RNNA 2IHMA 8ICEA 5HMLA 4EYHB 4LVSA 8ICUA 7ICQA 1R8AA 3OUYB 5KG0A 4DOCA 2KP7A 4RQ1A 4DSEA 1A76A 2ZH9A 3QEBZ 4IR1A 4DEZA 5J0OA 1U47A 2PFQA 4K4IA 4NY8A 4AT7B 7ICIA 2NRXA 5D4BA 3RB3A 4K4GA 1SKWA 2W9BA 3SV4A 3GFKB 1S9FA 9ICUA 2BPGA 2ZTCA 3OUYA 4DL5A 4O3SA 3HWTA 2VA3A 2ZJAA 5EOZA 5KG5A 7ICSA 4ECQA 4UAWA 1KRPA 5KFJA 3BJYA 3PO5A 4QZBA 7ICVA 5IIJA 3H4BA 4EBCA 3RBEA 1ZQPA 2IHNA 4JV1A 4M9HA 4QZHA 4I29A 1NK9A 2VA8A 5KFXA 9ICLA 3HX0A 8ICMA 4DWIA 7ICEA 4DFKA 3GV5B 1D9DA 4QZGA 2C2DA 1X9WA 2ZTEA 1JAJA 4WC2A 5F2VO 4GC7A 1LB2B 4P2HA 4E80A 3QZ8A 4J9LA 5CA7A 2XY6A 5JUMA 3RAXA 1KSPA 2HHQA 9ICBA 4KLSA 4YR3A 1K1SA 2XGQA 1S10A 1ZQLA 4M2YA 1MC8A 1XSPA 5DB8A 3C21A 1HUZA 1T7PA 3HPOA 4YD2A 4ELVA 4UB5A 4GXJA 2BQRA 4WC1A 3PX6A 2PFNA 4IQUA 9ICSA 3TI0A 1ZQRA 2BPCA 4EYIB 5D46A 4DOBA 5KFBA 4I2EA 8ICTA 4KMUA 4O3RA 4DQQA 1ZQCA 1VFGA 2ZJ8A 3N4MB 3JPQA 4DF8A 7ICFA 3PMNA 5HRLA 2DR7A 1D9FA 5L1KA 3FYHA 1JXLA 1XU4A 1NK7A 1T8EA 1NKBA 5KFCA 1ZQQA 4MF2A 4MFCA 4F2RA 8ICNA 9ICRA 4F4XA 1KNYA 3WFPA 4I2JA 5KFMA 4UB2A 4X4TA 1KEJA 2RFFA 9ICOA 4NLNA 5J0QA 3TARA 5KFDA 2I1QA 2Q0ZX 5J0YA 5KG2A 2ALZA 4KLFA 2ZH6A 4UD5A 4Z6CA 4I27A 4F4ZA 3V7KA 1U48A 2DR8A 3V7JA 3H8SA 4TURA 2RDIA 4RU9A 1L3TA 3ISBA 2W9CA 1NOMA 4ECZA 4O5KA 4F5RA 3WFRE 4AT8B 9ICIA 3PW7A 4KLDA 2Q66A 4M04A 3C2KA 5HP4A 4DSLA 4J9QA 1NK8A 1OU5A 2BDPA 2LYHA 5J0TA 3RJFA 4KLLA 1CEZA 7ICKA 3C18A 5DG9A 4E7XA 3M9MB 2C2EA 4X4OA 4C8LA 4YN4A 8ICXA 2IBKA 3MBYA 3TAPA 3V72A 4DSIA 8ICBA 1NO5A 4WBYA 4IR9A 3OJSA 4DO9A 2Y1JA 2RDJA 9ICQA 1L3SA 4IQWA 2W9BB 4AT9A 3PW2A 3OVBA 2W9CB 2HHSA 4J9OA 1U4BA 2GWSA 1ZQNA 5KG1A 3MR6A 4DQRA 7ICGA 1RPLA 5KFYA 3GV7B 4M6WB 5HR9A 4DLEA 4ATBA 4YG2A 3SI8A 3ISCA 3IHQB 3JPOA 9ICXA 4C8NA 4R8UA 4Z6EA 3KTQA 1HJPA 1YLQA 1ZQWA 3M8RA 4BGDA 1ZJNA 4M0AA 3EYZA 1MQ2A 4WCWA 2BPFA 9ICMA 3G6YA 1TK0A 5KFRA 5L9XA 3ZDDA 4XA5A 1QSYA 4B9SA 4TQRA 4WC5A 5KFQA 4RQ2A 2I9GA 3KHLA 5EWEA 4GLXA 3HJ1A 4X4NA 5F9NA 4RQ3A 3C5FA 1ZYQA 7ICTA 3PNCA 4RWNA 1BVSA 5KG4A 2KN7A 4RQ8A 3RJEA 4ATBB 3WFSC 1JMSA 5J2EA 1QSLA 4BXOA 4WC0A 1UA1A 1MIVA 3T5JA 1N48A 1UEUA 4TUQA 1ZQMA 4KITB 1X2IA 1S0VA 4DSKA 1NJWA 4M9GA 9ICEA 9ICPA 5HRKA 4F93B 5KT7A 3LK9A 4Q8EA 4ECWA 1DGSA 9ICKA 4PHEA 3MGIA 2O5AA 4S3NA 2J6TA 4RQ0A 3PMLA 2A1JA 3H7IA 3Q8SB 1R8BA 1JXEA 2VA2A 3RJHA 5J2BA 4BXOB 2ZH5A 3AU2A 4BWJA 4DL4A 4XRHA 7ICPA 2HVIA 5J0UA 1BPDA 1B43A 4YR0A 3PY8A 1KTQA 4FH5A 5TZVA 3MFIA 5KT4A 4DFJA 2C22A 2H5XA 4B9LA 4RPZA 4JWMA 4NM1A 4I2FA 3RJIA 2F1IA 4UAZA 1Z3EB 5CWRA 1TFYA 1ZQAA 7ICMA 4YR2A 3TANA 1CUKA 4QZDA 1SKSA 4YVZA 3UQ2A 2JEIA 3KHRA 3Q8LA 1XSLA 4IRCA 2P6UA 2W8KA 4NLKA 7ICJA 3PX4A 1ZQKA 4YD1A 4X4SA 1U9LA 5J29A 4X4QA 4P4OA 3MR3A 1L5UA 1COOA 1NZPA 4IQVA 4QWDA 3NYBA 2ZH2A 4DL6A 3TFSA 4J9NA 2BE3A 4DOAA 4BDPA 3EPIA 5KT5A 4O0IA 4RUAA 1C7YA 2FPLA 4YXMA 3ZDEA 4MFFA 3OVAA 5DBCA 3JPSA 4PPXA 2UVWA 4YMNA 1S0NA 5DEDA 3MFHA 3Q8PB 3HJ4A 4DSJA 5KFGA 2F1HA 2HHXA 4JV0A 1N56A 5J0SA 2PBEA 3QEAZ 2NRTA 1JX4A 3AQKA 4PHAA 4YQWA 4ELTA 4M6WA 3JYYA 4J9MA 3Q8RB 2ZHAA 4X4VA 1QLNA 1FA0A 3AQNA 5KT2A 2FPMA 3OSNA 4ECSA 8ICSA 2M2TA 8ICLA 2ZJ5A 1ZQHA 1U45A 2UVRA 4KLOA 2ZHBA 3RJKA 4X5VA 4QWAA 2JZBA 1JN3A 3PW0A 4O5EA 4I2BA 9ICFA 4RQ5A 8ICVA 7ICRA 2OWOA 3BQ2A 4F2SA 4LZGA 1XSNA 3RB0A 1BPXA 9ICJA 4WC3A 4Z6FA 4XUSA 1S0MA 5J2DA 1LV5A 4FHPA 2DR9A 4I2IA 4J9KA 3T5KA 4J9PA 1NK6A 5HNKA 4AT9B 3MDAA 5KFFA 2BKEA 4RWPA 2UVVA 1ZQJA 3PW4A 3ZDBA 4X4UA 4FHXA 5J2AA 3QE9Y 4Q8FA 1S77D 4NKUA 1MIWA 1KFSA 4JUZA 4Q44A 4UB3A 5DB9A 3MR5A 5J0PA 1D8LA 1JIHA 5KFUA 5D49A 5DGAA 4B9TA 4M9LA 1TAQA 2JEFA 1ZQBA 4F92B 2XGPA 2DPIA 2M2VA 3RB6A 8ICWA 3JPRA 3PX0A 2ZH8A 2DVIA 3G6XA 1RYSA 3EW9A 2KZMA 4HYKA 4ECVA 1QTMA 2BQUA 1RZTA 4B9MA 1ZQSA 5IIMA 1F5AA 4F8RA 1WCLA 1TK5A 3HT3A 5KFZA 5CR0A 2XO7A 1MQ3A 4J9SA 3EWAA 2C2RA 1H38A 4RNMA 5DG8A 3M9NB 3E2EA 4J9RA 1KFTA 4X0AA 2ID1A 4X4RA 4F5QA 4RQ4A 4RPXA 4AT8A 5KG6A 1Y88A 2DPJA 5DDMA 3EZ5A 2PI5A 4P4MA 1Z00B 4ED0A 8ICGA 1B22A 3OVSA 4QW9A 4QZCA 3OHBA 2KTQA 4EZ9A 9ICAA 8ICRA 4C8MA 4TUSA 2P6RA 5KFSA 4R64A 4LT6A 2UVUA 3H8JA 4ED2A 3FDSA 3LDAA 2FMPA 3C1YA 3RH5A 5DDYA 4O3QA 1IXRA 2R8KA 4EBEA 1SL0A 2W9AA 8ICAA 3OJUA 4FS2A 4KLTA 3TQ1A 5J0RA 5HHHA 5DECA 4PGXA 4FH3A 4DL3A 5DB7A 1Z00A 2BHNA 5BPCA 4GC6A 4JWNA 2XY5A 2AQ0A 2ASJA 5DBBA 5HMMA 5DQHA 2C28A 5KFEA 1SZPA 1NK5A 7ICLA 1UETA 4WBZA 3UXOA 2Y1IA 1ZQEA 2BCUA 4R66A 4YMMA 1IM4A 2ZH4A 5L1IA 5KFLA 3G6VA 4IRKA 8ICYA 3UQ0A 5IINA 4EBJA 3Q8KA 2XCAA 1BPEA 4TQSA
chains in the Genus database with same CATH superfamily
2W8LA 3RFAA 5KL1B 5C0YA 4EX6A 2F8LA 1RXVA 2PMZC 4K4HA 1NJYA 1Q3VA 2JRZA 4O67A 2CRXA 3GIJA 2XCPA 1ZQDA 1S76D 2QB0B 5J2CA 4ICAA 5HHIA 4C4SA 4USAA 4RPYA 1TV9A 1SV0A 3C2LA 4NKTA 2NO4A 4K98A 1HEKA 4UB1A 2ZH7A 3PV8A 3GIIA 3PSTA 2ZUBA 2ZUDA 5GTIU 4ECTA 3UPSA 1UCVA 2BBHA 4CCHA 2RRDA 5HRGA 5CHGA 4S3NA 5EE9A 4F5PA 2A1AA 2GOLA 3PZPA 5J2IA 3RBDA 4WC7A 5J2JA 1T4GA 8ICQA 3H3AA 4F4KA 5AI6A 1UA0A 4KLGA 4RWOA 4YMOA 2KV2A 4HX0A 3PW5A 8ICCA 3TFRA 4GXKA 4ECUA 3M8SA 4EBKA 4YFKA 2EAMA 2AQ4A 3DV9A 3NTUA 4Q43A 1LKYB 5C5JA 3TAQA 2DKZA 1ZQXA 5ALYA 3K75D 4F91B 7ICVA 5J0WA 4P0QB 1N63A 1MIYA 2HVHA 5AIBA 5EWGA 1L8LA 1KN5A 1BGXT 4JK1A 5KG7A 3PR5B 3SYZA 5CP2A 5L1LA 4O3OA 3RJJA 3N28A 4O69A 4NJ8A 4C4RA 2XC9A 3H39A 5KFIA 3V7LA 5AM4A 2GA9D 3GDXA 3N7SC 2AJQA 2CN1A 3JPNA 2K8AA 2A1JB 3BS5A 4E8FA 4C8KA 3MCRA 3WFQE 3CYMA 2IHOA 2KJ5A 4QZIA 5DLGA 3GIMA 1FFUA 2ZH1A 5KT3A 3B0YA 2WHEA 2FLPA 3L4PA 2KG5A 4UD4A 1PX5A 4ECYA 4AP9A 4RZRA 2DRAA 4FZLA 1X42A 3WKAA 2NRVA 2DRBA 2G07A 4EP7A 4JLXA 2HHUA 3B0XA 2XVTA 1WCNA 2HHWA 1BNPA 4UAYA 3KHHA 2KFZA 1J2NA 1V97A 4UQGA 2M9NA 4QZ8A 3GQCA 1XS9D 3UXPA 1SGGA 3ZI4A 3QX7A 4DS5A 8ICIA 1WYGA 4F5NA 3T5HA 1TVAA 2PFPA 2FDRA 5HC9A 1R8CA 4OJ6A 1IIPA 4EYHB 8ICUA 3BZCA 4DSEA 4EELA 4IR1A 1SXDA 1NNLA 2PMZF 2W9BA 4JB3A 1COKA 2EQYA 9ICUA 4LEYA 1M6YA 2KSOB 4Y2XA 4QZBA 3RBEA 2IHNA 4I29A 4JMUA 2VA8A 1KW4A 5JRTA 4OD0A 4DWIA 4DFKA 4QZGA 2C2DA 1JAJA 4E80A 2KICA 5EE1A 3H8MA 3RAXA 2HHQA 4YR3A 4WBYA 1S10A 3IN5A 1T7PA 9ICBA 4YD2A 4GXJA 2K4PA 4DOBA 1J2MA 1ZQCA 3TKAA 2ZJ8A 3N4MB 5AKIA 5HRLA 5GTHU 2HBMA 3CW2C 1RM6C 1VDVA 1XU4A 4MF2A 4MFCA 5KFCA 1ZQQA 5CHEA 5KFMA 2ZIVB 2Q0ZX 2NYVA 2ZH6A 2I6XA 4C0ZA 1U48A 2W55A 2DR8A 3TADC 2RDIA 5AM0A 4RU9A 3ALRA 3WFRE 5F3XB 4M04A 4DSLA 4PZNA 4J9QA 1NK8A 5AK4A 2LYHA 1Q8KA 7ICKA 2WF7A 5DG9A 4E7XA 4X4OA 2C2EA 8ICXA 1NO5A 3MBYA 8ICBA 1L3SA 3OVBA 2W9CB 3GU3A 4J9OA 3J81j 1ZQNA 5ALKA 2LM4A 5CFSA 4M6WB 1JI7A 2JR5A 3JPOA 9ICXA 4Z6EA 1VLBA 1YLQA 1ZJNA 4M0AA 4OO1J 4WCWA 3KOOA 1TK0A 5L9XA 3ZDDA 4Y2RA 5KFQA 5EWEA 4X4NA 3C5FA 3PNCA 3AM9A 1BVSA 2KN7A 3RJEA 1JMSA 1QSLA 3NVZA 4KITB 3M6KA 9ICEA 4M9GA 2OXOA 4Q8EA 2O5AA 2HMXA 3MGIA 1R8BA 3RJHA 4BXOB 2ZH5A 4BWJA 7ICPA 1UHUA 1KKXA 4FH5A 3SMVA 1KQQA 5KT4A 2H5XA 3BQ7A 5AKEA 2WF6A 1MA7A 5CFTA 3NRZA 3TANA 1CUKA 3KHRA 1XSLA 4IRCA 4NLKA 2W8KA 2W43A 2KHQA 3WK7A 4YD1A 4KM5A 2EZXA 2W54A 4IQVA 3QUBA 1D8BA 2ZH2A 4P0QA 4DOAA 4IS7A 5AI5A 4U6PA 4RUAA 3OVAA 5ALMA 3JPSA 2UVWA 4YMNA 1S0NA 5DEDA 3Q8PB 5ALLA 2F1HA 4WQKA 2FI1A 1L6NA 5J0SA 2PBEA 3HRDD 3QEAZ 2ZIUA 3K1RB 2NRTA 1JX4A 2E1EA 3SENA 2ZG6A 3NWIA 1MN8A 4X4VA 2FPMA 4ECSA 2UVRA 3RJKA 4X5VA 4O5EA 1JN3A 1KBUA 4LEVA 4F2SA 4Z6FA 5J2DA 1X6JA 4I2IA 1F0MA 3MDAA 3QU7A 1N5XA 4Q8FA 4NKUA 5HR7A 4M9LA 1D8LA 5D49A 2G0AA 4OAIZ 1TAQA 2DPIA 3RB6A 3PX0A 1RYSA 2KZMA 1IV8A 4HYKA 4ECVA 1QTMA 2G06A 3D6JA 2XO7A 1UPHA 3MC1A 2XICA 1SWVA 3E2EA 3WKEA 4X0AA 2ID1A 3N7RC 4F5QA 3OWGA 3EZ5A 2PI5A 1B22A 2WFAA 2JGAA 2KTQA 9ICAA 4LT6A 4R64A 3FDSA 2FMPA 4UASA 3RH5A 5DDYA 4EBEA 4FS2A 3NASA 3TQ1A 2WF5A 1Z00A 5BPCA 4JWNA 1AQ6A 3L5KA 5DQHA 3MGVA 2C28A 2LYBA 3UXOA 5TISU 2XIDA 8ICYA 3G6VA 2QARB 5IINA 4EBJA 1D9FA 3D2NA 3M9OB 2MUTB 1KL9A 3IM1A 1XWLA 2DF4B 2DR5A 2G09A 4M9NA 3IV6A 3R9KA 1TKDA 3QUCA 3H8WA 4XQ8A 2H3QA 5L1JA 3H0LB 4MF8A 1CRXA 4QWBA 1DK3A 4DQPA 3AQFA 3UMCA 4UATA 1L7PA 2JEJA 2KZ3A 2IOHA 5ALXA 1ZQZA 2FMQA 1KDHA 1WOTA 1T3NA 3RTVA 1D8YA 4PHDA 2JEGA 1KFDA 3HW8A 2LMRA 3RJGA 4DL7A 3UPQA 5J2GA 5DBAA 4Z6DA 1BPZA 7ICOA 4DF4A 3M6ZA 3NGDA 4I2AA 5F9LA 4ECXA 8ICZA 1NKCA 2B21A 2F1JA 1PZNA 3PR4A 3ZDAA 4RWQA 3KHGA 4MEXA 2B0CA 4OJOA 4WC4A 8ICKA 2HHTA 5HRHA 4QZFA 2J6UA 1SKRA 5KFVA 2EH9A 1S5LU 5ALWA 2R8HA 1ZQOA 2ATLA 2W9MA 3NVWA 2NRKA 1OXJA 3OHAA 4F50A 3ISDA 2EAOA 1JALA 4UBCA 3VCBA 9ICHA 5AKLA 4I28A 3LQCB 4QWCA 3QUTA 1OW5A 3QZ7A 8ICHA 5KFWA 2MUTA 4RQ7A 3KFUF 4QWEA 3F5AA 1R89A 4QZEA 4MEYA 5CJ7A 7ICNA 3HP6A 2ZH4A 1X9MA 3RRGA 5DKWA 2HW3A 2DFLA 1SL1A 3F53A 4J03A 4FHVA 2KKVA 4CGZA 4GFJA 2CXYA 5EE3A 3C66A 4RT3A 1SXEA 2DKXA 3HILA 3WK6A 2ISPA 3NS1A 3SZ2A 2K4IA 3OGUA 4QIWC 4O5CA 2E1FA 5KFHA 4ECRA 1V4AA 4F71A 1TAUA 4B9UA 5KFAA 1DK2A 4Y2UA 1Q78A 3A0BU 2GH1A 2JH7A 2XY7A 1VJ7A 4IQTA 2V4QA 3UMBA 2LI6A 4EX7A 5J2HA 2JH1A 3KKAA 1L3VA 3SV3A 4FO1A 2MA1A 3MR2A 2ZIXA 2YX8A 2J6SA 4FO6A 2KHVA 2PFOA 7ICUA 3N97B 3MABA 3B9JA 4BUGA 4RQMA 2NRWA 5CEHA 9ICWA 4JLZA 5BOMA 4XQ7A 3WK4A 2VJ4A 2OYYA 3MGHA 5CB1A 1Q79A 2BCVA 2ZIVA 3QU4A 4WJ3B 4ED6A 4UBBA 4KLEA 2DUYA 4O3MA 2O1PA 1NK4A 4FFDA 2YB1A 3N7PD 4YXJA 1UT5A 1PVPA 2YMMA 5KNIA 3D2SA 4RNOA 5HRIA 3H40A 4RNNA 1TAMA 5L1MA 4LVSA 7ICQA 3OUYB 2K8CB 5KG0A 4DOCA 4RQ1A 1A76A 1U47A 4K4IA 2PFQA 3KD3A 5D4BA 3RB3A 3WKCA 1JUDA 1S9FA 1GPJA 5H2FU 5AM5A 4ECQA 1Z19A 2QB0A 5IIJA 4JV1A 3K1ZA 7ICEA 3GZFA 1D9DA 1X9WA 5F2VO 1LB2B 4J9LA 5CA7A 4FZMA 4KLSA 2YN4A 1XSPA 5DB8A 3C21A 3TACB 1HUZA 2KSOA 4ELVA 4UB5A 3TI0A 1ZQRA 5B3PA 4EYIB 2HDOA 4I2EA 4DQQA 2K4HA 1VFGA 3SAGA 2B4VA 2DR7A 4Y2TA 5L1KA 4RQNA 4PL2A 1KNYA 1N60A 2KE7A 1JRPA 1KEJA 2AH5A 1JROA 9ICOA 2I1QA 2HN1A 3CP8A 4KLFA 4I27A 4F4ZA 4K9AA 2XI9A 3H8SA 3ISBA 1NOMA 1RQNA 3C2KA 5HP4A 4KMOB 2BDPA 4KLLA 3IRUA 5AK3A 3TAPA 4DSIA 1ZD4A 2KKPA 3NKUA 2W9BB 5KG1A 3MR6A 4DQRA 5HR9A 3C28A 4DLEA 3SI8A 4C8NA 3KTQA 1Z4OA 3M8RA 2BPFA 3IDWA 9ICMA 3PSIA 4OAGA 4XA5A 4B9SA 2YMPA 5AIAA 3WKBA 4RQ2A 2Y0SC 2KNJA 4GLXA 5KG4A 3WFSC 5J2EA 4BXOA 1UA1A 3T5JA 1UEUA 1ZQMA 1NJWA 9ICPA 5KT7A 3LK9A 4ECWA 1DGSA 2YB4A 2ESEA 3HKZC 3H7IA 2WF8A 5J0UA 1KTQA 2C22A 5TZVA 4DFJA 4B9LA 4NM1A 5G5HA 4CRXA 2VKQA 2WAQC 7ICMA 4YR2A 4UW9A 1VJ5A 5AI9A 3WK5A 3UQ2A 2JEIA 2FCLA 3Q8LA 7ICJA 3LYSA 4X4SA 4OCZA 4C7YA 2K8BB 2G5IB 4QWDA 4QJFB 4DL6A 2D8CA 2BE3A 4BDPA 3EPIA 4O0IA 1C7YA 2FPLA 3AQEA 1X40A 3HJ4A 1ZRNA 3WK8A 1DXSA 2LM1A 3QU2A 1N56A 4NL9C 2YMQA 3ETRA 3WK9A 4YQWA 4J9MA 1QLNA 5KT2A 1FIQA 1PVQA 8ICLA 2DQNB 2KJ9A 3PW0A 2JZBA 4CF5A 4I2BA 9ICFA 1L7NA 2OWOA 3BQ2A 5AM2A 9ICJA 3RB0A 2HBLA 1B0XA 4FHPA 4J9KA 1NK6A 4AT9B 5KFFA 3ZDBA 4FHXA 4F72A 4FE3A 2ODGA 1KFSA 4JUZA 1ZD5A 1BNOA 5KFUA 3KZIU 1ZQBA 2XGPA 5ALQA 3G6XA 4PL1A 4KX5A 5IIMA 4F8RA 2HOIA 1H38A 4X4RA 4RPXA 3CRXA 4LEZA 1Y88A 5AI0A 4NV0A 2KEYA 3H8JA 3C1YA 2KMDA 1IXRA 3FC4A 1SL0A 2Y9TA 3OJUA 1SIJA 1SZHA 2AXTU 5DECA 4NXWA 4O68A 4DL3A 2YMLA 5DB7A 2BHNA 2XY5A 2ASJA 1QCKA 1YZ6A 2BCUA 4R66A 5J8YC 4IRKA 5ALGA 3UQ0A 1BPEA 4TQSA 4MHVA 4KLJA 5AK6A 5AKKA 3BQ0A 3C1ZA 2AGQA 4NLZA 1UEVA 2M2UA 4YCXA 2PI4A 5AKHA 4O3PA 1JQRA 3EF2A 5KT6A 3JZ0A 4P0PA 4FS1A 2AU0A 3BDPA 2WTFA 4ED8A 1HUOA 2VJ5A 3C5GA 4GIBA 1YZ7A 3AQLA 3ZD9A 4K99A 1QQ7A 8ICPA 3C2MA 2HI0A 3JPTA 3V6JA 4ELUA 3NVOA 4EEDA 2AGOA 4OJPA 5HRDA 4EGWA 5HR6A 1RYUA 4KN4A 1ECWA 1XC9A 4YP3A 5EWFA 4KLIA 1FO4A 2KVSA 2BBJA 3H37A 1PK1A 4UAVA 4DLGA 4ZOHC 2JXJA 2H3ZA 4F3OA 1UT8A 3Q8QB 1SB3C 2ISOA 4NXVA 5KFPA 2HBKA 2R8IA 3H0RB 1NJXA 1NKEA 3F2BA 1T94A 4EEKA 2ZIWA 2PKEA 2O6KA 4KLMA 4GXIA 3C23A 3PO4A 2G5HB 1TK8A 2ZH3A 2WB1C 4I2HA 4ED3A 2KOBA 4KB6A 4KLUA 9ICNA 1QSSA 1ZQUA 9ICVA 2ZUCA 2KFNA 1C20A 2BDUA 4HAIA 4Y2SA 2OEHA 3ZD8A 3T3FA 1XO1A 3NVYA 3NYBA 4E0DA 2ASLA 4KTQA 1TE2A 2RHFA 3GILA 4M9JA 4R63A 5IIIA 4B9NA 1SL2A 1L3UA 1V9PA 2M2WA 2NV3A 2OCEA 4FHYA 1ZQVA 5J2KA 4EEBA 4B9VA 4QW8A 3HKZF 3AMZA 1X6IA 4MFAA 3HIYA 4TUPA 5J8YA 3PSFA 4R65A 1N61A 4M47A 3OSPA 5HRFA 2BCQA 4NLGA 2DGZA 5ALZA 3Q8MA 1ZQIA 1ZJMA 3SQIA 2IOFA 3H38A 4DCCA 1BPYA 3H4DA 1EXNA 1PK3A 2H3VA 2HHVA 5KFTA 1F44A 2ASDA 4O6AA 4DL2A 4UB4A 3OPXA 4P4PA 3LVWA 2ZIWB 3RB4A 4NXUA 2BCSA 2HBJA 5DQIA 4ZH4A 4KLQA 1Q3UA 2EZZA 1ZRMA 5IIKA 4PHPA 4QZAA 5KFOA 3MDCA 2W3RA 3EPGA 4FBTA 2NO5A 1K1QA 4PGQA 1X9SA 4IRDA 2R8JA 5DB6A 9ICGA 4ED7A 4QZ9A 3SEIA 2V4RA 2BGWA 4C4TA 1NK0A 1A6SA 5A0LA 8ICEA 4K96A 2KP7A 4DEZA 5J0OA 3F2DA 1FEZA 4G9BA 7ICIA 4K4GA 1SKWA 5ALSA 3SV4A 2BPGA 5ALEA 4DL5A 4O3SA 3HWTA 2VA3A 2QLTA 2ZJAA 5EOZA 7ICSA 1KRPA 5KFJA 3PO5A 3H4BA 4EBCA 1ZQPA 4K97A 4QZHA 2KIWA 4DFDA 5KFXA 9ICLA 4N7RA 3HX0A 2D3DA 2Z7JA 3GV5B 2W03A 2ZTEA 5D61A 4WC2A 2LPEA 1Z1BA 4P2HA 3QZ8A 1S8OA 4OJLA 1KSPA 2XGQA 1K1SA 4M2YA 1MC8A 4WC1A 3HPOA 2BQRA 2OH2A 3PX6A 2PFNA 4IQUA 9ICSA 2BPCA 4C7ZA 5D46A 5ALNA 5KFBA 1WG8A 3TADA 4O3RA 3JPQA 7ICFA 4LEWA 2A3VA 2KD1A 3FYHA 4CF4A 1JXLA 1NKBA 2HSZA 8ICNA 9ICRA 4F2RA 4OJ5A 4I2JA 4OAHA 2JMGA 4X4TA 2RFFA 1PK1B 4NLNA 5B66U 5KG2A 3V7KA 3V7JA 2W9CA 4ECZA 4O5KA 4AT8B 3PW7A 2Q66A 1DRGA 2FJ6A 3UM9A 5T14A 1OU5A 3RJFA 3C18A 5B3QA 3M9MB 4NXXA 4YN4A 3V72A 3OJSA 2W7OA 2Y1JA 9ICQA 3PW2A 2GWSA 7ICGA 1RPLA 5KFYA 4ATBA 2CPRA 4YG2A 3CNHA 3ISCA 3IHQB 3QNMA 4R8UA 1ZQWA 4BGDA 5KL8B 3EYZA 3F5EA 1MQ2A 2I5HA 2P35A 4A8EA 1QH9A 5KFRA 3SR6A 2I9GA 1K5OA 3KHLA 3ICXA 4RQ3A 2MSNA 4RWNA 4ATBB 2EZYA 3LVVA 4F93B 5AKXA 2JHDA 9ICKA 4UB6U 4PHEA 2ZXHA 1LVHA 2J6TA 2B56A 3PMLA 2A1JA 3BS5B 1JXEA 2VA2A 5J2BA 3SAFA 2QARA 3AU2A 4IC9A 4DL4A 4XRHA 4B6JA 2E8OA 3PY8A 5EE0A 2WF9A 3DEEA 3VC8A 3RJIA 4UAZA 1Z3EB 1UQVA 1TFYA 3E0FA 5ALUA 4AYBF 1ZQAA 1SKSA 1Z1VA 2P6UA 3PHZA 1ZQKA 4P4OA 1O08A 3MR3A 3IG5A 2E8NA 1L5UA 1N62A 1COOA 2YTUA 3TFSA 3KKAC 4MFFA 4PPXA 1LKYA 3MFHA 4DSJA 5KFGA 2Y9UA 4JV0A 2QB1A 1J97A 3FM9A 4PHAA 4ELTA 1B4FA 4M6WA 3JYYA 4CF3A 3C29A 2K60A 3AQNA 3OSNA 2M2TA 1ZQHA 1U45A 1F5SA 2E8MA 3JCFA 4RQ5A 8ICVA 7ICRA 3KBBA 3UMGA 1XSNA 1BPXA 4XUSA 1S0MA 1NI3A 1RDFA 3T5KA 4J9PA 5HNKA 2BKEA 2N1RA 2UVVA 1ZQJA 4X4UA 1WWVA 3PSPA 5J2AA 3QE9Y 4MKPA 1S77D 2ES6A 4UB3A 3MR5A 5DB9A 4B9TA 5D62A 5DGAA 1JIHA 2JEFA 2HN2A 8ICWA 3JPRA 2HOFA 2ZH8A 2DVIA 3EW9A 2B51A 2MU2A 1RZTA 4B9MA 1Z4NA 1F5AA 1TK5A 1QQ5A 4EENA 4J9SA 3EWAA 2C2RA 3M9NB 1SV4A 5KG6A 5DDMA 2EAPA 1Z00B 4ED0A 3OVSA 4QW9A 4QZCA 8ICRA 5KFSA 2UVUA 4ED2A 3AN1A 8ICAA 1L8OA 2AHOB 2DWQA 4WH5A 5HHHA 4FH3A 2KJ8A 2AQ0A 5HMMA 5AM3A 5KFEA 1SZPA 7ICLA 4WBZA 1UETA 2Y1IA 1ZQEA 3K7DA 5AKZA 4FZNA 1IM4A 2WB1F 5KFLA 3Q8KA 2XCAA 4G3IA 5ALRA 3M7DA 5HREA 3IG8A 3AU6A 2E3TA 4K8VA 1PUZA 2JZBB 2FLLA 4NLCA 1V85A 3GV8B 4RQ6A 5G5GA 1ZQFA 1BPBA 4WOYA 5BOLA 5J2FA 2RP5A 4F5OA 5HRBA 1NJZA 5IIOA 3THVA 1RXWA 4KLHA 2EANA 8ICOA 2MRLA 1TFWA 1A77A 4DQSA 2NRZA 3HJEA 4JV2A 4R8UB 2GLEA 3RF9A 4IG8A 1AROP 5ALIA 5KFKA 3RR8A 1ZQGA 3I28A 3BQTA 9ICCA 3GIKA 3RRHA 3T5LA 5DG7A 2Y0SF 3SD7A 5ALOA 1ZETA 4EEYA 4Y2VA 7ICHA 4Y2PA 1L7MA 2AGPA 4KN7A 2EDUA 4Q45A 3ZDCA 4BJQA 3K4GA 4DSFA 4NXTA 3L9DA 4I2DA 2OHFA 1RG6A 2GAFD 3V6KA 4NXZA 5DQGA 1T3QA 2WAQF 4PJ0U 4I2GA 5KG3A 5K4LA 1DOQA 4Y2JA 3JPPA 3BQ1A 2W04A 1L7OA 4ED1A 3ERCC 1TFRA 2IA6A 4K9BA 4DS4A 4WQLA 4RT2A 4CDGA 3V6HA 2BQ3A 2VIXA 2P66A 4BX9C 4O9MA 3CK6A 1U49A 5ALFA 3SAHA 2R8GA 1XO0A 5DLFA 1MSWD 3RR7A 1SV0C 4PGYA 5KFNA 2KIVA 5CFUA 2BCRA 3PVXA 8ICFA 3WFOA 8ICJA 1S0OA 2BR0A 5DGBA 4DFPA 4PZOA 4FBUA 1ZQTA 3ORYA 3RH4A 4Y2YA 4M5DA 3QU9A 4F4YA 1RYRA 2VANA 2FLNA 1WUDA 4AYBC 4PH5A 2IOFK 4KX3A 5ALDA 4BWMA 4NL9A 3OTQA 2V9WA 4EBDA 2HOQA 4I2CA 3S6JA 4US8A 1SWWA 3M1YA 2HHPA 3RAQA 2ZTDA 2MAXA 4U7CA 2FMSA 5AKJA 4QIWF 3AUOA 3LWMA 2KZZA 2YQEA 4WC6A 5J0XA 1CI4A 3OV7A 4O3NA 5KTQA 2FPKA 1S97A 5KAFU 4XJEA 4EZ6A 4C8OA 3EUB2 1ZQYA 2A19A 4LZDA 4F4WA 1X66A 1A0PA 2FE9A 3NVVA 4NM2A 2ZIXB 9ICTA 2B6GA 3NUQA 4C80A 3RH6A 2IMWP 5FP0A 4DQIA 3ED5A 5IILA 4X4PA 4DFMA 4CE6A 3I1YA 3LWLA 4X0BA 2F77X 3AQMA 3U26A 3ER8C 2PXIA 1FFVA 2K4EA 2YY6A 3ETLA 5ALJA 5E79U 1O03A 4RUCA 1KLNA 5AICA 5D63A 3UXNA 5CRXA 3BZKA 2IHMA 5HMLA 1R8AA 2ZH9A 3QEBZ 4NY8A 4AT7B 5AI4A 2EWRA 2NRXA 1X9XA 4LJXA 1URJA 3GFKB 2W7PA 2K89A 5AKYA 3AEVA 2ZTCA 3OUYA 5KG5A 3QYPA 5ALHA 4UAWA 3BJYA 3D2QA 4M9HA 1GO3F 1NK9A 1HIWA 2IUBA 8ICMA 3ONNA 1XNSA 4GC7A 2XY6A 2QKQA 4QNLA 5JUMA 2M0NA 4NWIA 1ZQLA 4FHWA 1ZXIA 1ZD2P 8ICTA 2W3SA 4KMUA 4DF8A 3PMNA 5ALTA 1T8EA 1NK7A 5AK5A 4F4XA 3WFPA 3KZXA 3F2CA 4UB2A 5J0QA 3TARA 5KFDA 5J0YA 2ALZA 4UD5A 4Z6CA 1ZD3A 4TURA 1L3TA 4F5RA 2L5YA 2W11A 9ICIA 4KLDA 4UARA 5J0TA 1ZQ1C 1CEZA 4NLBA 2F76X 2ZXIA 4C8LA 5JTIA 2IBKA 1V38A 4IR9A 4DO9A 2RDJA 4IQWA 2HHSA 1U4BA 3IP4B 1WWUA 3GV7B 1HJPA 3QUQA 4UB8U 4EV6A 3G6YA 2BZFA 2OM6A 5JU5A 4IL6U 1QSYA 4TQRA 4WC5A 1Q46A 3HJ1A 5AHXA 5F9NA 1ZYQA 7ICTA 2HCFA 4RQ8A 4OAFA 4WC0A 1MIVA 1N48A 4TUQA 1X2IA 1S0VA 4DSKA 5HRKA 1PVRA 3E58A 4RQ0A 3Q8SB 2LKYA 2F2AB 2D6FC 3T79A 2HVIA 1BPDA 1B43A 4YR0A 3MFIA 2Q4TA 4RPZA 4JWMA 1OUQA 4I2FA 2F1IA 5JTGA 5CWRA 2E5SA 2H3FA 2RQ5A 4QZDA 1IG6A 5ALPA 4YVZA 2F8KA 2JV3A 1ZOLA 3ER9B 3AL0B 1RQLA 3PX4A 1U9LA 5J29A 4X4QA 5B5EU 1N5WA 1NZPA 3I76A 2F44A 4J9NA 2R18A 4UAUA 5KT5A 4YXMA 3ZDEA 2DL0A 5DBCA 4ACOA 3A0HU 1ED1A 2DBYA 2HHXA 3L3FX 3WU2U 3AQKA 5AM1A 2ZHAA 3Q8RB 3DDHA 1FA0A 8ICSA 2ZJ5A 2ZHBA 4KLOA 3FAHA 4QWAA 2LHTA 2F3NA 4LZGA 4WC3A 2KVCA 3H0MB 5AI8A 1LV5A 2DR9A 4CNQA 2LYAA 4RWPA 3PW4A 2KK0A 1NZBA 1MIWA 4Q44A 5J0PA 4US9A 2M2VA 4F92B 3BS7A 3QU5A 2BQUA 4AT9A 1ZQSA 1WCLA 1QQ6A 5KAIU 5KFZA 5CR0A 3HT3A 1MQ3A 1P7DA 4RNMA 5DG8A 4J9RA 1KFTA 4RQ4A 4AT8A 2DPJA 2GO7A 4P4MA 8ICGA 3OHBA 4EZ9A 2H3IA 4C8MA 4TUSA 2P6RA 5ALVA 3LDAA 2RLTA 2E8PA 4O3QA 2R8KA 2W9AA 4Y2QA 4KLTA 5J0RA 3QXGA 4PGXA 2LBOA 2G08A 4GC6A 3O0FA 5DBBA 1NK5A 3NRWA 4AT7A 1YT3A 4YMMA 5L1IA 2ZIUB 1DGJA 1N2XA 4I0UA 4P0PB 5AKGA 3WKDA
chains in the Genus database with same CATH topology
4KLJA 2W8LA 5HREA 3M9OB 2MUTB 3BQ0A 3C1ZA 3AU6A 2JZBB 2AGQA 1RXVA 2FLLA 4NLZA 1UEVA 8ICHA 4K4HA 2M2UA 4AT7A 3IM1A 3GV8B 4RQ6A 1NJYA 1XWLA 1ZQFA 4YCXA 2PI4A 2DR5A 3GIJA 2XCPA 1ZQDA 4M9NA 4O3PA 1BPBA 1S76D 1JQRA 5J2CA 5KT6A 5BOLA 3JZ0A 5J2FA 4F5OA 4FS1A 1TKDA 5HHIA 2AU0A 3BDPA 5HRBA 3H8WA 4XQ8A 4RPYA 2WTFA 5L1JA 1TV9A 1NJZA 5IIOA 3C2LA 4ED8A 3THVA 4NKTA 4MF8A 4QWBA 1HUOA 1RXWA 1DK3A 3C5GA 4KLHA 4UB1A 4DQPA 3PV8A 8ICOA 3AQLA 3ZD9A 2ZH7A 3GIIA 1TFWA 1A77A 4DQSA 2NRZA 2ZUBA 3C2MA 8ICPA 4JV2A 4G3IA 4R8UB 2ZUDA 2JEJA 3JPTA 3V6JA 4ELUA 4ECTA 3UPSA 4IG8A 1AROP 5KFKA 2KZ3A 3RR8A 1ZQGA 2AGOA 5HRDA 4CCHA 5HRGA 1ZQZA 3BQTA 5CHGA 2FMQA 1KDHA 3GIKA 9ICCA 3RRHA 4KN4A 1T3NA 1XC9A 3RTVA 3T5LA 5DG7A 1WOTA 4YP3A 1D8YA 4PHDA 2JEGA 1KFDA 4F5PA 1ZETA 4EEYA 3HW8A 5EWFA 3RJGA 7ICHA 4DL7A 4KLIA 2AGPA 3UPQA 3H37A 5J2GA 5J2IA 5DBAA 3RBDA 4Z6DA 1BPZA 4DLGA 7ICOA 4KN7A 3NGDA 4DF4A 4I2AA 4Q45A 5F9LA 4ECXA 3ZDCA 4F3OA 3K4GA 8ICZA 1UT8A 4DSFA 1NKCA 2B21A 2F1JA 3Q8QB 3L9DA 4WC7A 1PZNA 2ISOA 4I2DA 3PR4A 3ZDAA 4RWQA 5J2JA 1T4GA 3KHGA 8ICQA 4MEXA 5KFPA 2R8IA 3V6KA 4F4KA 4NXZA 3H3AA 8ICKA 1UA0A 1NJXA 1NKEA 4KLGA 2HHTA 4RWOA 4YMOA 5HRHA 5DQGA 4QZFA 2J6UA 1SKRA 5KFVA 3PW5A 4KLMA 4GXIA 8ICCA 3C23A 2R8HA 3PO4A 4I2GA 1ZQOA 5KG3A 2ATLA 2W9MA 2NRKA 1TK8A 1DOQA 3OHAA 4F50A 3JPPA 3ISDA 3TFRA 3BQ1A 4GXKA 2ZH3A 4ED1A 4I2HA 1TFRA 4UBCA 3M8SA 4ECUA 4ED3A 2IA6A 4EBKA 4KLUA 4DS4A 4FHWA 9ICNA 1QSSA 4YFKA 4I28A 9ICHA 1BNOA 4RT2A 1ZQUA 3V6HA 4QWCA 2BQ3A 2P66A 4O9MA 9ICVA 2ZUCA 3QZ7A 2AQ4A 5KFWA 2MUTA 4RQ7A 3NTUA 4Q43A 4QWEA 1U49A 2KFNA 2R8GA 1R89A 5C5JA 4QZEA 3TAQA 1ZQXA 3ZD8A 5DLFA 3K75D 4MEYA 1MSWD 3T3FA 4F91B 3RR7A 1XO1A 5CJ7A 5J0WA 4PGYA 5KFNA 3HP6A 1X9MA 3RRGA 4E0DA 7ICNA 1MIYA 5DKWA 2ASLA 2DFLA 4KTQA 2BCRA 3PVXA 2HVHA 2HW3A 8ICFA 3WFOA 1SL1A 1S0OA 2BR0A 8ICJA 5DGBA 4DFPA 5EWGA 3GILA 4FBUA 4M9JA 1ZQTA 1BGXT 4JK1A 3ORYA 3RH4A 4FHVA 5KG7A 4WC4A 4M5DA 3PR5B 4R63A 3SYZA 4F4YA 1RYRA 5IIIA 3C66A 5CP2A 4RT3A 2VANA 2FLNA 5L1LA 1SL2A 4B9NA 4O3OA 1L3UA 2ISPA 3RJJA 4PH5A 1V9PA 2M2WA 4FHYA 3SZ2A 1ZQVA 5J2KA 3OGUA 2XC9A 4B9VA 4O5CA 4QW8A 3H39A 4BWMA 5KFIA 5KFHA 4ECRA 1V4AA 1TAUA 3V7LA 5KFAA 4MFAA 4EBDA 2V9WA 4B9UA 4I2CA 4TUPA 1DK2A 3HIYA 1Q78A 3GDXA 2AJQA 4R65A 2XY7A 4M47A 3OSPA 1VJ7A 4IQTA 2V4QA 5HRFA 2BCQA 2HHPA 3JPNA 4NLGA 2A1JB 3RAQA 2ZTDA 2MAXA 3Q8MA 1ZQIA 2FMSA 4E8FA 1ZJMA 4C8KA 3H38A 5J2HA 3WFQE 3AUOA 3LWMA 2KZZA 4WC6A 5J0XA 3OV7A 4O3NA 1L3VA 4QZIA 5DLGA 3GIMA 1BPYA 3SV3A 3H4DA 2ZH1A 5KTQA 5KT3A 3MR2A 3B0YA 1EXNA 2FPKA 2J6SA 4FO6A 1S97A 2PFOA 7ICUA 2HHVA 5KFTA 2FLPA 4EZ6A 4C8OA 3N97B 4UD4A 1ZQYA 3MABA 4LZDA 4F4WA 2ASDA 1PX5A 4ECYA 4RZRA 2DRAA 2NRVA 4DL2A 2NRWA 4UB4A 4NM2A 9ICWA 4P4PA 2DRBA 4EP7A 5BOMA 2HHUA 4XQ7A 3B0XA 3RB4A 3MGHA 1WCNA 9ICTA 2BCSA 5CB1A 1Q79A 5DQIA 4ZH4A 4KLQA 2BCVA 3RH6A 2IMWP 2HHWA 4DQIA 1BNPA 5IIKA 4PHPA 4QZAA 4UAYA 5IILA 4X4PA 4DFMA 5KFOA 3MDCA 3LWLA 3LQCB 4X0BA 3KHHA 3EPGA 4ED6A 3AQMA 4FBTA 2KFZA 1K1QA 4PGQA 4UQGA 2M9NA 4QZ8A 4UBBA 3GQCA 1X9SA 4KLEA 2PXIA 3UXPA 1XS9D 4IRDA 2O1PA 1NK4A 2R8JA 5DB6A 4DS5A 9ICGA 8ICIA 4YXJA 1UT5A 4ED7A 3ETLA 4QZ9A 2V4RA 4F5NA 4RUCA 4RNOA 2BGWA 1KLNA 1NK0A 3T5HA 1TVAA 2PFPA 5HRIA 3UXNA 5HC9A 1R8CA 3H40A 4RNNA 2IHMA 8ICEA 5HMLA 4EYHB 4LVSA 8ICUA 7ICQA 1R8AA 3OUYB 5KG0A 4DOCA 2KP7A 4RQ1A 4DSEA 1A76A 2ZH9A 3QEBZ 4IR1A 4DEZA 5J0OA 1U47A 2PFQA 4K4IA 4NY8A 4AT7B 7ICIA 2NRXA 5D4BA 3RB3A 4K4GA 1SKWA 2W9BA 3SV4A 3GFKB 1S9FA 9ICUA 2BPGA 2ZTCA 3OUYA 4DL5A 4O3SA 3HWTA 2VA3A 2ZJAA 5EOZA 5KG5A 7ICSA 4ECQA 4UAWA 1KRPA 5KFJA 3BJYA 3PO5A 4QZBA 7ICVA 5IIJA 3H4BA 4EBCA 3RBEA 1ZQPA 2IHNA 4JV1A 4M9HA 4QZHA 4I29A 1NK9A 2VA8A 5KFXA 9ICLA 3HX0A 8ICMA 4DWIA 7ICEA 4DFKA 3GV5B 1D9DA 4QZGA 2C2DA 1X9WA 2ZTEA 1JAJA 4WC2A 5F2VO 4GC7A 1LB2B 4P2HA 4E80A 3QZ8A 4J9LA 5CA7A 2XY6A 5JUMA 3RAXA 1KSPA 2HHQA 9ICBA 4KLSA 4YR3A 1K1SA 2XGQA 1S10A 1ZQLA 4M2YA 1MC8A 1XSPA 5DB8A 3C21A 1HUZA 1T7PA 3HPOA 4YD2A 4ELVA 4UB5A 4GXJA 2BQRA 4WC1A 3PX6A 2PFNA 4IQUA 9ICSA 3TI0A 1ZQRA 2BPCA 4EYIB 5D46A 4DOBA 5KFBA 4I2EA 8ICTA 4KMUA 4O3RA 4DQQA 1ZQCA 1VFGA 2ZJ8A 3N4MB 3JPQA 4DF8A 7ICFA 3PMNA 5HRLA 2DR7A 1D9FA 5L1KA 3FYHA 1JXLA 1XU4A 1NK7A 1T8EA 1NKBA 5KFCA 1ZQQA 4MF2A 4MFCA 4F2RA 8ICNA 9ICRA 4F4XA 1KNYA 3WFPA 4I2JA 5KFMA 4UB2A 4X4TA 1KEJA 2RFFA 9ICOA 4NLNA 5J0QA 3TARA 5KFDA 2I1QA 2Q0ZX 5J0YA 5KG2A 2ALZA 4KLFA 2ZH6A 4UD5A 4Z6CA 4I27A 4F4ZA 3V7KA 1U48A 2DR8A 3V7JA 3H8SA 4TURA 2RDIA 4RU9A 1L3TA 3ISBA 2W9CA 1NOMA 4ECZA 4O5KA 4F5RA 3WFRE 4AT8B 9ICIA 3PW7A 4KLDA 2Q66A 4M04A 3C2KA 5HP4A 4DSLA 4J9QA 1NK8A 1OU5A 2BDPA 2LYHA 5J0TA 3RJFA 4KLLA 1CEZA 7ICKA 3C18A 5DG9A 4E7XA 3M9MB 2C2EA 4X4OA 4C8LA 4YN4A 8ICXA 2IBKA 3MBYA 3TAPA 3V72A 4DSIA 8ICBA 1NO5A 4WBYA 4IR9A 3OJSA 4DO9A 2Y1JA 2RDJA 9ICQA 1L3SA 4IQWA 2W9BB 4AT9A 3PW2A 3OVBA 2W9CB 2HHSA 4J9OA 1U4BA 2GWSA 1ZQNA 5KG1A 3MR6A 4DQRA 7ICGA 1RPLA 5KFYA 3GV7B 4M6WB 5HR9A 4DLEA 4ATBA 4YG2A 3SI8A 3ISCA 3IHQB 3JPOA 9ICXA 4C8NA 4R8UA 4Z6EA 3KTQA 1HJPA 1YLQA 1ZQWA 3M8RA 4BGDA 1ZJNA 4M0AA 3EYZA 1MQ2A 4WCWA 2BPFA 9ICMA 3G6YA 1TK0A 5KFRA 5L9XA 3ZDDA 4XA5A 1QSYA 4B9SA 4TQRA 4WC5A 5KFQA 4RQ2A 2I9GA 3KHLA 5EWEA 4GLXA 3HJ1A 4X4NA 5F9NA 4RQ3A 3C5FA 1ZYQA 7ICTA 3PNCA 4RWNA 1BVSA 5KG4A 2KN7A 4RQ8A 3RJEA 4ATBB 3WFSC 1JMSA 5J2EA 1QSLA 4BXOA 4WC0A 1UA1A 1MIVA 3T5JA 1N48A 1UEUA 4TUQA 1ZQMA 4KITB 1X2IA 1S0VA 4DSKA 1NJWA 4M9GA 9ICEA 9ICPA 5HRKA 4F93B 5KT7A 3LK9A 4Q8EA 4ECWA 1DGSA 9ICKA 4PHEA 3MGIA 2O5AA 4S3NA 2J6TA 4RQ0A 3PMLA 2A1JA 3H7IA 3Q8SB 1R8BA 1JXEA 2VA2A 3RJHA 5J2BA 4BXOB 2ZH5A 3AU2A 4BWJA 4DL4A 4XRHA 7ICPA 2HVIA 5J0UA 1BPDA 1B43A 4YR0A 3PY8A 1KTQA 4FH5A 5TZVA 3MFIA 5KT4A 4DFJA 2C22A 2H5XA 4B9LA 4RPZA 4JWMA 4NM1A 4I2FA 3RJIA 2F1IA 4UAZA 1Z3EB 5CWRA 1TFYA 1ZQAA 7ICMA 4YR2A 3TANA 1CUKA 4QZDA 1SKSA 4YVZA 3UQ2A 2JEIA 3KHRA 3Q8LA 1XSLA 4IRCA 2P6UA 2W8KA 4NLKA 7ICJA 3PX4A 1ZQKA 4YD1A 4X4SA 1U9LA 5J29A 4X4QA 4P4OA 3MR3A 1L5UA 1COOA 1NZPA 4IQVA 4QWDA 3NYBA 2ZH2A 4DL6A 3TFSA 4J9NA 2BE3A 4DOAA 4BDPA 3EPIA 5KT5A 4O0IA 4RUAA 1C7YA 2FPLA 4YXMA 3ZDEA 4MFFA 3OVAA 5DBCA 3JPSA 4PPXA 2UVWA 4YMNA 1S0NA 5DEDA 3MFHA 3Q8PB 3HJ4A 4DSJA 5KFGA 2F1HA 2HHXA 4JV0A 1N56A 5J0SA 2PBEA 3QEAZ 2NRTA 1JX4A 3AQKA 4PHAA 4YQWA 4ELTA 4M6WA 3JYYA 4J9MA 3Q8RB 2ZHAA 4X4VA 1QLNA 1FA0A 3AQNA 5KT2A 2FPMA 3OSNA 4ECSA 8ICSA 2M2TA 8ICLA 2ZJ5A 1ZQHA 1U45A 2UVRA 4KLOA 2ZHBA 3RJKA 4X5VA 4QWAA 2JZBA 1JN3A 3PW0A 4O5EA 4I2BA 9ICFA 4RQ5A 8ICVA 7ICRA 2OWOA 3BQ2A 4F2SA 4LZGA 1XSNA 3RB0A 1BPXA 9ICJA 4WC3A 4Z6FA 4XUSA 1S0MA 5J2DA 1LV5A 4FHPA 2DR9A 4I2IA 4J9KA 3T5KA 4J9PA 1NK6A 5HNKA 4AT9B 3MDAA 5KFFA 2BKEA 4RWPA 2UVVA 1ZQJA 3PW4A 3ZDBA 4X4UA 4FHXA 5J2AA 3QE9Y 4Q8FA 1S77D 4NKUA 1MIWA 1KFSA 4JUZA 4Q44A 4UB3A 5DB9A 3MR5A 5J0PA 1D8LA 1JIHA 5KFUA 5D49A 5DGAA 4B9TA 4M9LA 1TAQA 2JEFA 1ZQBA 4F92B 2XGPA 2DPIA 2M2VA 3RB6A 8ICWA 3JPRA 3PX0A 2ZH8A 2DVIA 3G6XA 1RYSA 3EW9A 2KZMA 4HYKA 4ECVA 1QTMA 2BQUA 1RZTA 4B9MA 1ZQSA 5IIMA 1F5AA 4F8RA 1WCLA 1TK5A 3HT3A 5KFZA 5CR0A 2XO7A 1MQ3A 4J9SA 3EWAA 2C2RA 1H38A 4RNMA 5DG8A 3M9NB 3E2EA 4J9RA 1KFTA 4X0AA 2ID1A 4X4RA 4F5QA 4RQ4A 4RPXA 4AT8A 5KG6A 1Y88A 2DPJA 5DDMA 3EZ5A 2PI5A 4P4MA 1Z00B 4ED0A 8ICGA 1B22A 3OVSA 4QW9A 4QZCA 3OHBA 2KTQA 4EZ9A 9ICAA 8ICRA 4C8MA 4TUSA 2P6RA 5KFSA 4R64A 4LT6A 2UVUA 3H8JA 4ED2A 3FDSA 3LDAA 2FMPA 3C1YA 3RH5A 5DDYA 4O3QA 1IXRA 2R8KA 4EBEA 1SL0A 2W9AA 8ICAA 3OJUA 4FS2A 4KLTA 3TQ1A 5J0RA 5HHHA 5DECA 4PGXA 4FH3A 4DL3A 5DB7A 1Z00A 2BHNA 5BPCA 4GC6A 4JWNA 2XY5A 2AQ0A 2ASJA 5DBBA 5HMMA 5DQHA 2C28A 5KFEA 1SZPA 1NK5A 7ICLA 1UETA 4WBZA 3UXOA 2Y1IA 1ZQEA 2BCUA 4R66A 4YMMA 1IM4A 2ZH4A 5L1IA 5KFLA 3G6VA 4IRKA 8ICYA 3UQ0A 5IINA 4EBJA 3Q8KA 2XCAA 1BPEA 4TQSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KLJ A;  2W8L A;  5HRE A;  3M9O B;  2MUT B;  3BQ0 A;  3C1Z A;  3AU6 A;  2JZB B;  2AGQ A;  1RXV A;  2FLL A;  4NLZ A;  1UEV A;  8ICH A;  4K4H A;  2M2U A;  4AT7 A;  3IM1 A;  3GV8 B;  4RQ6 A;  1NJY A;  1XWL A;  1ZQF A;  4YCX A;  2PI4 A;  2DR5 A;  3GIJ A;  2XCP A;  1ZQD A;  4M9N A;  4O3P A;  1BPB A;  1S76 D;  1JQR A;  5J2C A;  5KT6 A;  5BOL A;  3JZ0 A;  5J2F A;  4F5O A;  4FS1 A;  1TKD A;  5HHI A;  2AU0 A;  3BDP A;  5HRB A;  3H8W A;  4XQ8 A;  4RPY A;  2WTF A;  5L1J A;  1TV9 A;  1NJZ A;  5IIO A;  3C2L A;  4ED8 A;  3THV A;  4NKT A;  4MF8 A;  4QWB A;  1HUO A;  1RXW A;  1DK3 A;  3C5G A;  4KLH A;  4UB1 A;  4DQP A;  3PV8 A;  8ICO A;  3AQL A;  3ZD9 A;  2ZH7 A;  3GII A;  1TFW A;  1A77 A;  4DQS A;  2NRZ A;  2ZUB A;  3C2M A;  8ICP A;  4JV2 A;  4G3I A;  4R8U B;  2ZUD A;  2JEJ A;  3JPT A;  3V6J A;  4ELU A;  4ECT A;  3UPS A;  4IG8 A;  1ARO P;  5KFK A;  2KZ3 A;  3RR8 A;  1ZQG A;  2AGO A;  5HRD A;  4CCH A;  5HRG A;  1ZQZ A;  3BQT A;  5CHG A;  2FMQ A;  1KDH A;  3GIK A;  9ICC A;  3RRH A;  4KN4 A;  1T3N A;  1XC9 A;  3RTV A;  3T5L A;  5DG7 A;  1WOT A;  4YP3 A;  1D8Y A;  4PHD A;  2JEG A;  1KFD A;  4F5P A;  1ZET A;  4EEY A;  3HW8 A;  5EWF A;  3RJG A;  7ICH A;  4DL7 A;  4KLI A;  2AGP A;  3UPQ A;  3H37 A;  5J2G A;  5J2I A;  5DBA A;  3RBD A;  4Z6D A;  1BPZ A;  4DLG A;  7ICO A;  4KN7 A;  3NGD A;  4DF4 A;  4I2A A;  4Q45 A;  5F9L A;  4ECX A;  3ZDC A;  4F3O A;  3K4G A;  8ICZ A;  1UT8 A;  4DSF A;  1NKC A;  2B21 A;  2F1J A;  3Q8Q B;  3L9D A;  4WC7 A;  1PZN A;  2ISO A;  4I2D A;  3PR4 A;  3ZDA A;  4RWQ A;  5J2J A;  1T4G A;  3KHG A;  8ICQ A;  4MEX A;  5KFP A;  2R8I A;  3V6K A;  4F4K A;  4NXZ A;  3H3A A;  8ICK A;  1UA0 A;  1NJX A;  1NKE A;  4KLG A;  2HHT A;  4RWO A;  4YMO A;  5HRH A;  5DQG A;  4QZF A;  2J6U A;  1SKR A;  5KFV A;  3PW5 A;  4KLM A;  4GXI A;  8ICC A;  3C23 A;  2R8H A;  3PO4 A;  4I2G A;  1ZQO A;  5KG3 A;  2ATL A;  2W9M A;  2NRK A;  1TK8 A;  1DOQ A;  3OHA A;  4F50 A;  3JPP A;  3ISD A;  3TFR A;  3BQ1 A;  4GXK A;  2ZH3 A;  4ED1 A;  4I2H A;  1TFR A;  4UBC A;  3M8S A;  4ECU A;  4ED3 A;  2IA6 A;  4EBK A;  4KLU A;  4DS4 A;  4FHW A;  9ICN A;  1QSS A;  4YFK A;  4I28 A;  9ICH A;  1BNO A;  4RT2 A;  1ZQU A;  3V6H A;  4QWC A;  2BQ3 A;  2P66 A;  4O9M A;  9ICV A;  2ZUC A;  3QZ7 A;  2AQ4 A;  5KFW A;  2MUT A;  4RQ7 A;  3NTU A;  4Q43 A;  4QWE A;  1U49 A;  2KFN A;  2R8G A;  1R89 A;  5C5J A;  4QZE A;  3TAQ A;  1ZQX A;  3ZD8 A;  5DLF A;  3K75 D;  4MEY A;  1MSW D;  3T3F A;  4F91 B;  3RR7 A;  1XO1 A;  5CJ7 A;  5J0W A;  4PGY A;  5KFN A;  3HP6 A;  1X9M A;  3RRG A;  4E0D A;  7ICN A;  1MIY A;  5DKW A;  2ASL A;  2DFL A;  4KTQ A;  2BCR A;  3PVX A;  2HVH A;  2HW3 A;  8ICF A;  3WFO A;  1SL1 A;  1S0O A;  2BR0 A;  8ICJ A;  5DGB A;  4DFP A;  5EWG A;  3GIL A;  4FBU A;  4M9J A;  1ZQT A;  1BGX T;  4JK1 A;  3ORY A;  3RH4 A;  4FHV A;  5KG7 A;  4WC4 A;  4M5D A;  3PR5 B;  4R63 A;  3SYZ A;  4F4Y A;  1RYR A;  5III A;  3C66 A;  5CP2 A;  4RT3 A;  2VAN A;  2FLN A;  5L1L A;  1SL2 A;  4B9N A;  4O3O A;  1L3U A;  2ISP A;  3RJJ A;  4PH5 A;  1V9P A;  2M2W A;  4FHY A;  3SZ2 A;  1ZQV A;  5J2K A;  3OGU A;  2XC9 A;  4B9V A;  4O5C A;  4QW8 A;  3H39 A;  4BWM A;  5KFI A;  5KFH A;  4ECR A;  1V4A A;  1TAU A;  3V7L A;  5KFA A;  4MFA A;  4EBD A;  2V9W A;  4B9U A;  4I2C A;  4TUP A;  1DK2 A;  3HIY A;  1Q78 A;  3GDX A;  2AJQ A;  4R65 A;  2XY7 A;  4M47 A;  3OSP A;  1VJ7 A;  4IQT A;  2V4Q A;  5HRF A;  2BCQ A;  2HHP A;  3JPN A;  4NLG A;  2A1J B;  3RAQ A;  2ZTD A;  2MAX A;  3Q8M A;  1ZQI A;  2FMS A;  4E8F A;  1ZJM A;  4C8K A;  3H38 A;  5J2H A;  3WFQ E;  3AUO A;  3LWM A;  2KZZ A;  4WC6 A;  5J0X A;  3OV7 A;  4O3N A;  1L3V A;  4QZI A;  5DLG A;  3GIM A;  1BPY A;  3SV3 A;  3H4D A;  2ZH1 A;  5KTQ A;  5KT3 A;  3MR2 A;  3B0Y A;  1EXN A;  2FPK A;  2J6S A;  4FO6 A;  1S97 A;  2PFO A;  7ICU A;  2HHV A;  5KFT A;  2FLP A;  4EZ6 A;  4C8O A;  3N97 B;  4UD4 A;  1ZQY A;  3MAB A;  4LZD A;  4F4W A;  2ASD A;  1PX5 A;  4ECY A;  4RZR A;  2DRA A;  2NRV A;  4DL2 A;  2NRW A;  4UB4 A;  4NM2 A;  9ICW A;  4P4P A;  2DRB A;  4EP7 A;  5BOM A;  2HHU A;  4XQ7 A;  3B0X A;  3RB4 A;  3MGH A;  1WCN A;  9ICT A;  2BCS A;  5CB1 A;  1Q79 A;  5DQI A;  4ZH4 A;  4KLQ A;  2BCV A;  3RH6 A;  2IMW P;  2HHW A;  4DQI A;  1BNP A;  5IIK A;  4PHP A;  4QZA A;  4UAY A;  5IIL A;  4X4P A;  4DFM A;  5KFO A;  3MDC A;  3LWL A;  3LQC B;  4X0B A;  3KHH A;  3EPG A;  4ED6 A;  3AQM A;  4FBT A;  2KFZ A;  1K1Q A;  4PGQ A;  4UQG A;  2M9N A;  4QZ8 A;  4UBB A;  3GQC A;  1X9S A;  4KLE A;  2PXI A;  3UXP A;  1XS9 D;  4IRD A;  2O1P A;  1NK4 A;  2R8J A;  5DB6 A;  4DS5 A;  9ICG A;  8ICI A;  4YXJ A;  1UT5 A;  4ED7 A;  3ETL A;  4QZ9 A;  2V4R A;  4F5N A;  4RUC A;  4RNO A;  2BGW A;  1KLN A;  1NK0 A;  3T5H A;  1TVA A;  2PFP A;  5HRI A;  3UXN A;  5HC9 A;  1R8C A;  3H40 A;  4RNN A;  2IHM A;  8ICE A;  5HML A;  4EYH B;  4LVS A;  8ICU A;  7ICQ A;  1R8A A;  3OUY B;  5KG0 A;  4DOC A;  2KP7 A;  4RQ1 A;  4DSE A;  1A76 A;  2ZH9 A;  3QEB Z;  4IR1 A;  4DEZ A;  5J0O A;  1U47 A;  2PFQ A;  4K4I A;  4NY8 A;  4AT7 B;  7ICI A;  2NRX A;  5D4B A;  3RB3 A;  4K4G A;  1SKW A;  2W9B A;  3SV4 A;  3GFK B;  1S9F A;  9ICU A;  2BPG A;  2ZTC A;  3OUY A;  4DL5 A;  4O3S A;  3HWT A;  2VA3 A;  2ZJA A;  5EOZ A;  5KG5 A;  7ICS A;  4ECQ A;  4UAW A;  1KRP A;  5KFJ A;  3BJY A;  3PO5 A;  4QZB A;  7ICV A;  5IIJ A;  3H4B A;  4EBC A;  3RBE A;  1ZQP A;  2IHN A;  4JV1 A;  4M9H A;  4QZH A;  4I29 A;  1NK9 A;  2VA8 A;  5KFX A;  9ICL A;  3HX0 A;  8ICM A;  4DWI A;  7ICE A;  4DFK A;  3GV5 B;  1D9D A;  4QZG A;  2C2D A;  1X9W A;  2ZTE A;  1JAJ A;  4WC2 A;  5F2V O;  4GC7 A;  1LB2 B;  4P2H A;  4E80 A;  3QZ8 A;  4J9L A;  5CA7 A;  2XY6 A;  5JUM A;  3RAX A;  1KSP A;  2HHQ A;  9ICB A;  4KLS A;  4YR3 A;  1K1S A;  2XGQ A;  1S10 A;  1ZQL A;  4M2Y A;  1MC8 A;  1XSP A;  5DB8 A;  3C21 A;  1HUZ A;  1T7P A;  3HPO A;  4YD2 A;  4ELV A;  4UB5 A;  4GXJ A;  2BQR A;  4WC1 A;  3PX6 A;  2PFN A;  4IQU A;  9ICS A;  3TI0 A;  1ZQR A;  2BPC A;  4EYI B;  5D46 A;  4DOB A;  5KFB A;  4I2E A;  8ICT A;  4KMU A;  4O3R A;  4DQQ A;  1ZQC A;  1VFG A;  2ZJ8 A;  3N4M B;  3JPQ A;  4DF8 A;  7ICF A;  3PMN A;  5HRL A;  2DR7 A;  1D9F A;  5L1K A;  3FYH A;  1JXL A;  1XU4 A;  1NK7 A;  1T8E A;  1NKB A;  5KFC A;  1ZQQ A;  4MF2 A;  4MFC A;  4F2R A;  8ICN A;  9ICR A;  4F4X A;  1KNY A;  3WFP A;  4I2J A;  5KFM A;  4UB2 A;  4X4T A;  1KEJ A;  2RFF A;  9ICO A;  4NLN A;  5J0Q A;  3TAR A;  5KFD A;  2I1Q A;  2Q0Z X;  5J0Y A;  5KG2 A;  2ALZ A;  4KLF A;  2ZH6 A;  4UD5 A;  4Z6C A;  4I27 A;  4F4Z A;  3V7K A;  1U48 A;  2DR8 A;  3V7J A;  3H8S A;  4TUR A;  2RDI A;  4RU9 A;  1L3T A;  3ISB A;  2W9C A;  1NOM A;  4ECZ A;  4O5K A;  4F5R A;  3WFR E;  4AT8 B;  9ICI A;  3PW7 A;  4KLD A;  2Q66 A;  4M04 A;  3C2K A;  5HP4 A;  4DSL A;  4J9Q A;  1NK8 A;  1OU5 A;  2BDP A;  2LYH A;  5J0T A;  3RJF A;  4KLL A;  1CEZ A;  7ICK A;  3C18 A;  5DG9 A;  4E7X A;  3M9M B;  2C2E A;  4X4O A;  4C8L A;  4YN4 A;  8ICX A;  2IBK A;  3MBY A;  3TAP A;  3V72 A;  4DSI A;  8ICB A;  1NO5 A;  4WBY A;  4IR9 A;  3OJS A;  4DO9 A;  2Y1J A;  2RDJ A;  9ICQ A;  1L3S A;  4IQW A;  2W9B B;  4AT9 A;  3PW2 A;  3OVB A;  2W9C B;  2HHS A;  4J9O A;  1U4B A;  2GWS A;  1ZQN A;  5KG1 A;  3MR6 A;  4DQR A;  7ICG A;  1RPL A;  5KFY A;  3GV7 B;  4M6W B;  5HR9 A;  4DLE A;  4ATB A;  4YG2 A;  3SI8 A;  3ISC A;  3IHQ B;  3JPO A;  9ICX A;  4C8N A;  4R8U A;  4Z6E A;  3KTQ A;  1HJP A;  1YLQ A;  1ZQW A;  3M8R A;  4BGD A;  1ZJN A;  4M0A A;  3EYZ A;  1MQ2 A;  4WCW A;  2BPF A;  9ICM A;  3G6Y A;  1TK0 A;  5KFR A;  5L9X A;  3ZDD A;  4XA5 A;  1QSY A;  4B9S A;  4TQR A;  4WC5 A;  5KFQ A;  4RQ2 A;  2I9G A;  3KHL A;  5EWE A;  4GLX A;  3HJ1 A;  4X4N A;  5F9N A;  4RQ3 A;  3C5F A;  1ZYQ A;  7ICT A;  3PNC A;  4RWN A;  1BVS A;  5KG4 A;  2KN7 A;  4RQ8 A;  3RJE A;  4ATB B;  3WFS C;  1JMS A;  5J2E A;  1QSL A;  4BXO A;  4WC0 A;  1UA1 A;  1MIV A;  3T5J A;  1N48 A;  1UEU A;  4TUQ A;  1ZQM A;  4KIT B;  1X2I A;  1S0V A;  4DSK A;  1NJW A;  4M9G A;  9ICE A;  9ICP A;  5HRK A;  4F93 B;  5KT7 A;  3LK9 A;  4Q8E A;  4ECW A;  1DGS A;  9ICK A;  4PHE A;  3MGI A;  2O5A A;  4S3N A;  2J6T A;  4RQ0 A;  3PML A;  2A1J A;  3H7I A;  3Q8S B;  1R8B A;  1JXE A;  2VA2 A;  3RJH A;  5J2B A;  4BXO B;  2ZH5 A;  3AU2 A;  4BWJ A;  4DL4 A;  4XRH A;  7ICP A;  2HVI A;  5J0U A;  1BPD A;  1B43 A;  4YR0 A;  3PY8 A;  1KTQ A;  4FH5 A;  5TZV A;  3MFI A;  5KT4 A;  4DFJ A;  2C22 A;  2H5X A;  4B9L A;  4RPZ A;  4JWM A;  4NM1 A;  4I2F A;  3RJI A;  2F1I A;  4UAZ A;  1Z3E B;  5CWR A;  1TFY A;  1ZQA A;  7ICM A;  4YR2 A;  3TAN A;  1CUK A;  4QZD A;  1SKS A;  4YVZ A;  3UQ2 A;  2JEI A;  3KHR A;  3Q8L A;  1XSL A;  4IRC A;  2P6U A;  2W8K A;  4NLK A;  7ICJ A;  3PX4 A;  1ZQK A;  4YD1 A;  4X4S A;  1U9L A;  5J29 A;  4X4Q A;  4P4O A;  3MR3 A;  1L5U A;  1COO A;  1NZP A;  4IQV A;  4QWD A;  3NYB A;  2ZH2 A;  4DL6 A;  3TFS A;  4J9N A;  2BE3 A;  4DOA A;  4BDP A;  3EPI A;  5KT5 A;  4O0I A;  4RUA A;  1C7Y A;  2FPL A;  4YXM A;  3ZDE A;  4MFF A;  3OVA A;  5DBC A;  3JPS A;  4PPX A;  2UVW A;  4YMN A;  1S0N A;  5DED A;  3MFH A;  3Q8P B;  3HJ4 A;  4DSJ A;  5KFG A;  2F1H A;  2HHX A;  4JV0 A;  1N56 A;  5J0S A;  2PBE A;  3QEA Z;  2NRT A;  1JX4 A;  3AQK A;  4PHA A;  4YQW A;  4ELT A;  4M6W A;  3JYY A;  4J9M A;  3Q8R B;  2ZHA A;  4X4V A;  1QLN A;  1FA0 A;  3AQN A;  5KT2 A;  2FPM A;  3OSN A;  4ECS A;  8ICS A;  2M2T A;  8ICL A;  2ZJ5 A;  1ZQH A;  1U45 A;  2UVR A;  4KLO A;  2ZHB A;  3RJK A;  4X5V A;  4QWA A;  2JZB A;  1JN3 A;  3PW0 A;  4O5E A;  4I2B A;  9ICF A;  4RQ5 A;  8ICV A;  7ICR A;  2OWO A;  3BQ2 A;  4F2S A;  4LZG A;  1XSN A;  3RB0 A;  1BPX A;  9ICJ A;  4WC3 A;  4Z6F A;  4XUS A;  1S0M A;  5J2D A;  1LV5 A;  4FHP A;  2DR9 A;  4I2I A;  4J9K A;  3T5K A;  4J9P A;  1NK6 A;  5HNK A;  4AT9 B;  3MDA A;  5KFF A;  2BKE A;  4RWP A;  2UVV A;  1ZQJ A;  3PW4 A;  3ZDB A;  4X4U A;  4FHX A;  5J2A A;  3QE9 Y;  4Q8F A;  1S77 D;  4NKU A;  1MIW A;  1KFS A;  4JUZ A;  4Q44 A;  4UB3 A;  5DB9 A;  3MR5 A;  5J0P A;  1D8L A;  1JIH A;  5KFU A;  5D49 A;  5DGA A;  4B9T A;  4M9L A;  1TAQ A;  2JEF A;  1ZQB A;  4F92 B;  2XGP A;  2DPI A;  2M2V A;  3RB6 A;  8ICW A;  3JPR A;  3PX0 A;  2ZH8 A;  2DVI A;  3G6X A;  1RYS A;  3EW9 A;  2KZM A;  4HYK A;  4ECV A;  1QTM A;  2BQU A;  1RZT A;  4B9M A;  1ZQS A;  5IIM A;  1F5A A;  4F8R A;  1WCL A;  1TK5 A;  3HT3 A;  5KFZ A;  5CR0 A;  2XO7 A;  1MQ3 A;  4J9S A;  3EWA A;  2C2R A;  1H38 A;  4RNM A;  5DG8 A;  3M9N B;  3E2E A;  4J9R A;  1KFT A;  4X0A A;  2ID1 A;  4X4R A;  4F5Q A;  4RQ4 A;  4RPX A;  4AT8 A;  5KG6 A;  1Y88 A;  2DPJ A;  5DDM A;  3EZ5 A;  2PI5 A;  4P4M A;  1Z00 B;  4ED0 A;  8ICG A;  1B22 A;  3OVS A;  4QW9 A;  4QZC A;  3OHB A;  2KTQ A;  4EZ9 A;  9ICA A;  8ICR A;  4C8M A;  4TUS A;  2P6R A;  5KFS A;  4R64 A;  4LT6 A;  2UVU A;  3H8J A;  4ED2 A;  3FDS A;  3LDA A;  2FMP A;  3C1Y A;  3RH5 A;  5DDY A;  4O3Q A;  1IXR A;  2R8K A;  4EBE A;  1SL0 A;  2W9A A;  8ICA A;  3OJU A;  4FS2 A;  4KLT A;  3TQ1 A;  5J0R A;  5HHH A;  5DEC A;  4PGX A;  4FH3 A;  4DL3 A;  5DB7 A;  1Z00 A;  2BHN A;  5BPC A;  4GC6 A;  4JWN A;  2XY5 A;  2AQ0 A;  2ASJ A;  5DBB A;  5HMM A;  5DQH A;  2C28 A;  5KFE A;  1SZP A;  1NK5 A;  7ICL A;  1UET A;  4WBZ A;  3UXO A;  2Y1I A;  1ZQE A;  2BCU A;  4R66 A;  4YMM A;  1IM4 A;  2ZH4 A;  5L1I A;  5KFL A;  3G6V A;  4IRK A;  8ICY A;  3UQ0 A;  5IIN A;  4EBJ A;  3Q8K A;  2XCA A;  1BPE A;  4TQS A; 
#chains in the Genus database with same CATH topology
 2W8L A;  3RFA A;  5KL1 B;  5C0Y A;  4EX6 A;  2F8L A;  1RXV A;  2PMZ C;  4K4H A;  1NJY A;  1Q3V A;  2JRZ A;  4O67 A;  2CRX A;  3GIJ A;  2XCP A;  1ZQD A;  1S76 D;  2QB0 B;  5J2C A;  4ICA A;  5HHI A;  4C4S A;  4USA A;  4RPY A;  1TV9 A;  1SV0 A;  3C2L A;  4NKT A;  2NO4 A;  4K98 A;  1HEK A;  4UB1 A;  2ZH7 A;  3PV8 A;  3GII A;  3PST A;  2ZUB A;  2ZUD A;  5GTI U;  4ECT A;  3UPS A;  1UCV A;  2BBH A;  4CCH A;  2RRD A;  5HRG A;  5CHG A;  4S3N A;  5EE9 A;  4F5P A;  2A1A A;  2GOL A;  3PZP A;  5J2I A;  3RBD A;  4WC7 A;  5J2J A;  1T4G A;  8ICQ A;  3H3A A;  4F4K A;  5AI6 A;  1UA0 A;  4KLG A;  4RWO A;  4YMO A;  2KV2 A;  4HX0 A;  3PW5 A;  8ICC A;  3TFR A;  4GXK A;  4ECU A;  3M8S A;  4EBK A;  4YFK A;  2EAM A;  2AQ4 A;  3DV9 A;  3NTU A;  4Q43 A;  1LKY B;  5C5J A;  3TAQ A;  2DKZ A;  1ZQX A;  5ALY A;  3K75 D;  4F91 B;  7ICV A;  5J0W A;  4P0Q B;  1N63 A;  1MIY A;  2HVH A;  5AIB A;  5EWG A;  1L8L A;  1KN5 A;  1BGX T;  4JK1 A;  5KG7 A;  3PR5 B;  3SYZ A;  5CP2 A;  5L1L A;  4O3O A;  3RJJ A;  3N28 A;  4O69 A;  4NJ8 A;  4C4R A;  2XC9 A;  3H39 A;  5KFI A;  3V7L A;  5AM4 A;  2GA9 D;  3GDX A;  3N7S C;  2AJQ A;  2CN1 A;  3JPN A;  2K8A A;  2A1J B;  3BS5 A;  4E8F A;  4C8K A;  3MCR A;  3WFQ E;  3CYM A;  2IHO A;  2KJ5 A;  4QZI A;  5DLG A;  3GIM A;  1FFU A;  2ZH1 A;  5KT3 A;  3B0Y A;  2WHE A;  2FLP A;  3L4P A;  2KG5 A;  4UD4 A;  1PX5 A;  4ECY A;  4AP9 A;  4RZR A;  2DRA A;  4FZL A;  1X42 A;  3WKA A;  2NRV A;  2DRB A;  2G07 A;  4EP7 A;  4JLX A;  2HHU A;  3B0X A;  2XVT A;  1WCN A;  2HHW A;  1BNP A;  4UAY A;  3KHH A;  2KFZ A;  1J2N A;  1V97 A;  4UQG A;  2M9N A;  4QZ8 A;  3GQC A;  1XS9 D;  3UXP A;  1SGG A;  3ZI4 A;  3QX7 A;  4DS5 A;  8ICI A;  1WYG A;  4F5N A;  3T5H A;  1TVA A;  2PFP A;  2FDR A;  5HC9 A;  1R8C A;  4OJ6 A;  1IIP A;  4EYH B;  8ICU A;  3BZC A;  4DSE A;  4EEL A;  4IR1 A;  1SXD A;  1NNL A;  2PMZ F;  2W9B A;  4JB3 A;  1COK A;  2EQY A;  9ICU A;  4LEY A;  1M6Y A;  2KSO B;  4Y2X A;  4QZB A;  3RBE A;  2IHN A;  4I29 A;  4JMU A;  2VA8 A;  1KW4 A;  5JRT A;  4OD0 A;  4DWI A;  4DFK A;  4QZG A;  2C2D A;  1JAJ A;  4E80 A;  2KIC A;  5EE1 A;  3H8M A;  3RAX A;  2HHQ A;  4YR3 A;  4WBY A;  1S10 A;  3IN5 A;  1T7P A;  9ICB A;  4YD2 A;  4GXJ A;  2K4P A;  4DOB A;  1J2M A;  1ZQC A;  3TKA A;  2ZJ8 A;  3N4M B;  5AKI A;  5HRL A;  5GTH U;  2HBM A;  3CW2 C;  1RM6 C;  1VDV A;  1XU4 A;  4MF2 A;  4MFC A;  5KFC A;  1ZQQ A;  5CHE A;  5KFM A;  2ZIV B;  2Q0Z X;  2NYV A;  2ZH6 A;  2I6X A;  4C0Z A;  1U48 A;  2W55 A;  2DR8 A;  3TAD C;  2RDI A;  5AM0 A;  4RU9 A;  3ALR A;  3WFR E;  5F3X B;  4M04 A;  4DSL A;  4PZN A;  4J9Q A;  1NK8 A;  5AK4 A;  2LYH A;  1Q8K A;  7ICK A;  2WF7 A;  5DG9 A;  4E7X A;  4X4O A;  2C2E A;  8ICX A;  1NO5 A;  3MBY A;  8ICB A;  1L3S A;  3OVB A;  2W9C B;  3GU3 A;  4J9O A;  3J81 j;  1ZQN A;  5ALK A;  2LM4 A;  5CFS A;  4M6W B;  1JI7 A;  2JR5 A;  3JPO A;  9ICX A;  4Z6E A;  1VLB A;  1YLQ A;  1ZJN A;  4M0A A;  4OO1 J;  4WCW A;  3KOO A;  1TK0 A;  5L9X A;  3ZDD A;  4Y2R A;  5KFQ A;  5EWE A;  4X4N A;  3C5F A;  3PNC A;  3AM9 A;  1BVS A;  2KN7 A;  3RJE A;  1JMS A;  1QSL A;  3NVZ A;  4KIT B;  3M6K A;  9ICE A;  4M9G A;  2OXO A;  4Q8E A;  2O5A A;  2HMX A;  3MGI A;  1R8B A;  3RJH A;  4BXO B;  2ZH5 A;  4BWJ A;  7ICP A;  1UHU A;  1KKX A;  4FH5 A;  3SMV A;  1KQQ A;  5KT4 A;  2H5X A;  3BQ7 A;  5AKE A;  2WF6 A;  1MA7 A;  5CFT A;  3NRZ A;  3TAN A;  1CUK A;  3KHR A;  1XSL A;  4IRC A;  4NLK A;  2W8K A;  2W43 A;  2KHQ A;  3WK7 A;  4YD1 A;  4KM5 A;  2EZX A;  2W54 A;  4IQV A;  3QUB A;  1D8B A;  2ZH2 A;  4P0Q A;  4DOA A;  4IS7 A;  5AI5 A;  4U6P A;  4RUA A;  3OVA A;  5ALM A;  3JPS A;  2UVW A;  4YMN A;  1S0N A;  5DED A;  3Q8P B;  5ALL A;  2F1H A;  4WQK A;  2FI1 A;  1L6N A;  5J0S A;  2PBE A;  3HRD D;  3QEA Z;  2ZIU A;  3K1R B;  2NRT A;  1JX4 A;  2E1E A;  3SEN A;  2ZG6 A;  3NWI A;  1MN8 A;  4X4V A;  2FPM A;  4ECS A;  2UVR A;  3RJK A;  4X5V A;  4O5E A;  1JN3 A;  1KBU A;  4LEV A;  4F2S A;  4Z6F A;  5J2D A;  1X6J A;  4I2I A;  1F0M A;  3MDA A;  3QU7 A;  1N5X A;  4Q8F A;  4NKU A;  5HR7 A;  4M9L A;  1D8L A;  5D49 A;  2G0A A;  4OAI Z;  1TAQ A;  2DPI A;  3RB6 A;  3PX0 A;  1RYS A;  2KZM A;  1IV8 A;  4HYK A;  4ECV A;  1QTM A;  2G06 A;  3D6J A;  2XO7 A;  1UPH A;  3MC1 A;  2XIC A;  1SWV A;  3E2E A;  3WKE A;  4X0A A;  2ID1 A;  3N7R C;  4F5Q A;  3OWG A;  3EZ5 A;  2PI5 A;  1B22 A;  2WFA A;  2JGA A;  2KTQ A;  9ICA A;  4LT6 A;  4R64 A;  3FDS A;  2FMP A;  4UAS A;  3RH5 A;  5DDY A;  4EBE A;  4FS2 A;  3NAS A;  3TQ1 A;  2WF5 A;  1Z00 A;  5BPC A;  4JWN A;  1AQ6 A;  3L5K A;  5DQH A;  3MGV A;  2C28 A;  2LYB A;  3UXO A;  5TIS U;  2XID A;  8ICY A;  3G6V A;  2QAR B;  5IIN A;  4EBJ A;  1D9F A;  3D2N A;  3M9O B;  2MUT B;  1KL9 A;  3IM1 A;  1XWL A;  2DF4 B;  2DR5 A;  2G09 A;  4M9N A;  3IV6 A;  3R9K A;  1TKD A;  3QUC A;  3H8W A;  4XQ8 A;  2H3Q A;  5L1J A;  3H0L B;  4MF8 A;  1CRX A;  4QWB A;  1DK3 A;  4DQP A;  3AQF A;  3UMC A;  4UAT A;  1L7P A;  2JEJ A;  2KZ3 A;  2IOH A;  5ALX A;  1ZQZ A;  2FMQ A;  1KDH A;  1WOT A;  1T3N A;  3RTV A;  1D8Y A;  4PHD A;  2JEG A;  1KFD A;  3HW8 A;  2LMR A;  3RJG A;  4DL7 A;  3UPQ A;  5J2G A;  5DBA A;  4Z6D A;  1BPZ A;  7ICO A;  4DF4 A;  3M6Z A;  3NGD A;  4I2A A;  5F9L A;  4ECX A;  8ICZ A;  1NKC A;  2B21 A;  2F1J A;  1PZN A;  3PR4 A;  3ZDA A;  4RWQ A;  3KHG A;  4MEX A;  2B0C A;  4OJO A;  4WC4 A;  8ICK A;  2HHT A;  5HRH A;  4QZF A;  2J6U A;  1SKR A;  5KFV A;  2EH9 A;  1S5L U;  5ALW A;  2R8H A;  1ZQO A;  2ATL A;  2W9M A;  3NVW A;  2NRK A;  1OXJ A;  3OHA A;  4F50 A;  3ISD A;  2EAO A;  1JAL A;  4UBC A;  3VCB A;  9ICH A;  5AKL A;  4I28 A;  3LQC B;  4QWC A;  3QUT A;  1OW5 A;  3QZ7 A;  8ICH A;  5KFW A;  2MUT A;  4RQ7 A;  3KFU F;  4QWE A;  3F5A A;  1R89 A;  4QZE A;  4MEY A;  5CJ7 A;  7ICN A;  3HP6 A;  2ZH4 A;  1X9M A;  3RRG A;  5DKW A;  2HW3 A;  2DFL A;  1SL1 A;  3F53 A;  4J03 A;  4FHV A;  2KKV A;  4CGZ A;  4GFJ A;  2CXY A;  5EE3 A;  3C66 A;  4RT3 A;  1SXE A;  2DKX A;  3HIL A;  3WK6 A;  2ISP A;  3NS1 A;  3SZ2 A;  2K4I A;  3OGU A;  4QIW C;  4O5C A;  2E1F A;  5KFH A;  4ECR A;  1V4A A;  4F71 A;  1TAU A;  4B9U A;  5KFA A;  1DK2 A;  4Y2U A;  1Q78 A;  3A0B U;  2GH1 A;  2JH7 A;  2XY7 A;  1VJ7 A;  4IQT A;  2V4Q A;  3UMB A;  2LI6 A;  4EX7 A;  5J2H A;  2JH1 A;  3KKA A;  1L3V A;  3SV3 A;  4FO1 A;  2MA1 A;  3MR2 A;  2ZIX A;  2YX8 A;  2J6S A;  4FO6 A;  2KHV A;  2PFO A;  7ICU A;  3N97 B;  3MAB A;  3B9J A;  4BUG A;  4RQM A;  2NRW A;  5CEH A;  9ICW A;  4JLZ A;  5BOM A;  4XQ7 A;  3WK4 A;  2VJ4 A;  2OYY A;  3MGH A;  5CB1 A;  1Q79 A;  2BCV A;  2ZIV A;  3QU4 A;  4WJ3 B;  4ED6 A;  4UBB A;  4KLE A;  2DUY A;  4O3M A;  2O1P A;  1NK4 A;  4FFD A;  2YB1 A;  3N7P D;  4YXJ A;  1UT5 A;  1PVP A;  2YMM A;  5KNI A;  3D2S A;  4RNO A;  5HRI A;  3H40 A;  4RNN A;  1TAM A;  5L1M A;  4LVS A;  7ICQ A;  3OUY B;  2K8C B;  5KG0 A;  4DOC A;  4RQ1 A;  1A76 A;  1U47 A;  4K4I A;  2PFQ A;  3KD3 A;  5D4B A;  3RB3 A;  3WKC A;  1JUD A;  1S9F A;  1GPJ A;  5H2F U;  5AM5 A;  4ECQ A;  1Z19 A;  2QB0 A;  5IIJ A;  4JV1 A;  3K1Z A;  7ICE A;  3GZF A;  1D9D A;  1X9W A;  5F2V O;  1LB2 B;  4J9L A;  5CA7 A;  4FZM A;  4KLS A;  2YN4 A;  1XSP A;  5DB8 A;  3C21 A;  3TAC B;  1HUZ A;  2KSO A;  4ELV A;  4UB5 A;  3TI0 A;  1ZQR A;  5B3P A;  4EYI B;  2HDO A;  4I2E A;  4DQQ A;  2K4H A;  1VFG A;  3SAG A;  2B4V A;  2DR7 A;  4Y2T A;  5L1K A;  4RQN A;  4PL2 A;  1KNY A;  1N60 A;  2KE7 A;  1JRP A;  1KEJ A;  2AH5 A;  1JRO A;  9ICO A;  2I1Q A;  2HN1 A;  3CP8 A;  4KLF A;  4I27 A;  4F4Z A;  4K9A A;  2XI9 A;  3H8S A;  3ISB A;  1NOM A;  1RQN A;  3C2K A;  5HP4 A;  4KMO B;  2BDP A;  4KLL A;  3IRU A;  5AK3 A;  3TAP A;  4DSI A;  1ZD4 A;  2KKP A;  3NKU A;  2W9B B;  5KG1 A;  3MR6 A;  4DQR A;  5HR9 A;  3C28 A;  4DLE A;  3SI8 A;  4C8N A;  3KTQ A;  1Z4O A;  3M8R A;  2BPF A;  3IDW A;  9ICM A;  3PSI A;  4OAG A;  4XA5 A;  4B9S A;  2YMP A;  5AIA A;  3WKB A;  4RQ2 A;  2Y0S C;  2KNJ A;  4GLX A;  5KG4 A;  3WFS C;  5J2E A;  4BXO A;  1UA1 A;  3T5J A;  1UEU A;  1ZQM A;  1NJW A;  9ICP A;  5KT7 A;  3LK9 A;  4ECW A;  1DGS A;  2YB4 A;  2ESE A;  3HKZ C;  3H7I A;  2WF8 A;  5J0U A;  1KTQ A;  2C22 A;  5TZV A;  4DFJ A;  4B9L A;  4NM1 A;  5G5H A;  4CRX A;  2VKQ A;  2WAQ C;  7ICM A;  4YR2 A;  4UW9 A;  1VJ5 A;  5AI9 A;  3WK5 A;  3UQ2 A;  2JEI A;  2FCL A;  3Q8L A;  7ICJ A;  3LYS A;  4X4S A;  4OCZ A;  4C7Y A;  2K8B B;  2G5I B;  4QWD A;  4QJF B;  4DL6 A;  2D8C A;  2BE3 A;  4BDP A;  3EPI A;  4O0I A;  1C7Y A;  2FPL A;  3AQE A;  1X40 A;  3HJ4 A;  1ZRN A;  3WK8 A;  1DXS A;  2LM1 A;  3QU2 A;  1N56 A;  4NL9 C;  2YMQ A;  3ETR A;  3WK9 A;  4YQW A;  4J9M A;  1QLN A;  5KT2 A;  1FIQ A;  1PVQ A;  8ICL A;  2DQN B;  2KJ9 A;  3PW0 A;  2JZB A;  4CF5 A;  4I2B A;  9ICF A;  1L7N A;  2OWO A;  3BQ2 A;  5AM2 A;  9ICJ A;  3RB0 A;  2HBL A;  1B0X A;  4FHP A;  4J9K A;  1NK6 A;  4AT9 B;  5KFF A;  3ZDB A;  4FHX A;  4F72 A;  4FE3 A;  2ODG A;  1KFS A;  4JUZ A;  1ZD5 A;  1BNO A;  5KFU A;  3KZI U;  1ZQB A;  2XGP A;  5ALQ A;  3G6X A;  4PL1 A;  4KX5 A;  5IIM A;  4F8R A;  2HOI A;  1H38 A;  4X4R A;  4RPX A;  3CRX A;  4LEZ A;  1Y88 A;  5AI0 A;  4NV0 A;  2KEY A;  3H8J A;  3C1Y A;  2KMD A;  1IXR A;  3FC4 A;  1SL0 A;  2Y9T A;  3OJU A;  1SIJ A;  1SZH A;  2AXT U;  5DEC A;  4NXW A;  4O68 A;  4DL3 A;  2YML A;  5DB7 A;  2BHN A;  2XY5 A;  2ASJ A;  1QCK A;  1YZ6 A;  2BCU A;  4R66 A;  5J8Y C;  4IRK A;  5ALG A;  3UQ0 A;  1BPE A;  4TQS A;  4MHV A;  4KLJ A;  5AK6 A;  5AKK A;  3BQ0 A;  3C1Z A;  2AGQ A;  4NLZ A;  1UEV A;  2M2U A;  4YCX A;  2PI4 A;  5AKH A;  4O3P A;  1JQR A;  3EF2 A;  5KT6 A;  3JZ0 A;  4P0P A;  4FS1 A;  2AU0 A;  3BDP A;  2WTF A;  4ED8 A;  1HUO A;  2VJ5 A;  3C5G A;  4GIB A;  1YZ7 A;  3AQL A;  3ZD9 A;  4K99 A;  1QQ7 A;  8ICP A;  3C2M A;  2HI0 A;  3JPT A;  3V6J A;  4ELU A;  3NVO A;  4EED A;  2AGO A;  4OJP A;  5HRD A;  4EGW A;  5HR6 A;  1RYU A;  4KN4 A;  1ECW A;  1XC9 A;  4YP3 A;  5EWF A;  4KLI A;  1FO4 A;  2KVS A;  2BBJ A;  3H37 A;  1PK1 A;  4UAV A;  4DLG A;  4ZOH C;  2JXJ A;  2H3Z A;  4F3O A;  1UT8 A;  3Q8Q B;  1SB3 C;  2ISO A;  4NXV A;  5KFP A;  2HBK A;  2R8I A;  3H0R B;  1NJX A;  1NKE A;  3F2B A;  1T94 A;  4EEK A;  2ZIW A;  2PKE A;  2O6K A;  4KLM A;  4GXI A;  3C23 A;  3PO4 A;  2G5H B;  1TK8 A;  2ZH3 A;  2WB1 C;  4I2H A;  4ED3 A;  2KOB A;  4KB6 A;  4KLU A;  9ICN A;  1QSS A;  1ZQU A;  9ICV A;  2ZUC A;  2KFN A;  1C20 A;  2BDU A;  4HAI A;  4Y2S A;  2OEH A;  3ZD8 A;  3T3F A;  1XO1 A;  3NVY A;  3NYB A;  4E0D A;  2ASL A;  4KTQ A;  1TE2 A;  2RHF A;  3GIL A;  4M9J A;  4R63 A;  5III A;  4B9N A;  1SL2 A;  1L3U A;  1V9P A;  2M2W A;  2NV3 A;  2OCE A;  4FHY A;  1ZQV A;  5J2K A;  4EEB A;  4B9V A;  4QW8 A;  3HKZ F;  3AMZ A;  1X6I A;  4MFA A;  3HIY A;  4TUP A;  5J8Y A;  3PSF A;  4R65 A;  1N61 A;  4M47 A;  3OSP A;  5HRF A;  2BCQ A;  4NLG A;  2DGZ A;  5ALZ A;  3Q8M A;  1ZQI A;  1ZJM A;  3SQI A;  2IOF A;  3H38 A;  4DCC A;  1BPY A;  3H4D A;  1EXN A;  1PK3 A;  2H3V A;  2HHV A;  5KFT A;  1F44 A;  2ASD A;  4O6A A;  4DL2 A;  4UB4 A;  3OPX A;  4P4P A;  3LVW A;  2ZIW B;  3RB4 A;  4NXU A;  2BCS A;  2HBJ A;  5DQI A;  4ZH4 A;  4KLQ A;  1Q3U A;  2EZZ A;  1ZRM A;  5IIK A;  4PHP A;  4QZA A;  5KFO A;  3MDC A;  2W3R A;  3EPG A;  4FBT A;  2NO5 A;  1K1Q A;  4PGQ A;  1X9S A;  4IRD A;  2R8J A;  5DB6 A;  9ICG A;  4ED7 A;  4QZ9 A;  3SEI A;  2V4R A;  2BGW A;  4C4T A;  1NK0 A;  1A6S A;  5A0L A;  8ICE A;  4K96 A;  2KP7 A;  4DEZ A;  5J0O A;  3F2D A;  1FEZ A;  4G9B A;  7ICI A;  4K4G A;  1SKW A;  5ALS A;  3SV4 A;  2BPG A;  5ALE A;  4DL5 A;  4O3S A;  3HWT A;  2VA3 A;  2QLT A;  2ZJA A;  5EOZ A;  7ICS A;  1KRP A;  5KFJ A;  3PO5 A;  3H4B A;  4EBC A;  1ZQP A;  4K97 A;  4QZH A;  2KIW A;  4DFD A;  5KFX A;  9ICL A;  4N7R A;  3HX0 A;  2D3D A;  2Z7J A;  3GV5 B;  2W03 A;  2ZTE A;  5D61 A;  4WC2 A;  2LPE A;  1Z1B A;  4P2H A;  3QZ8 A;  1S8O A;  4OJL A;  1KSP A;  2XGQ A;  1K1S A;  4M2Y A;  1MC8 A;  4WC1 A;  3HPO A;  2BQR A;  2OH2 A;  3PX6 A;  2PFN A;  4IQU A;  9ICS A;  2BPC A;  4C7Z A;  5D46 A;  5ALN A;  5KFB A;  1WG8 A;  3TAD A;  4O3R A;  3JPQ A;  7ICF A;  4LEW A;  2A3V A;  2KD1 A;  3FYH A;  4CF4 A;  1JXL A;  1NKB A;  2HSZ A;  8ICN A;  9ICR A;  4F2R A;  4OJ5 A;  4I2J A;  4OAH A;  2JMG A;  4X4T A;  2RFF A;  1PK1 B;  4NLN A;  5B66 U;  5KG2 A;  3V7K A;  3V7J A;  2W9C A;  4ECZ A;  4O5K A;  4AT8 B;  3PW7 A;  2Q66 A;  1DRG A;  2FJ6 A;  3UM9 A;  5T14 A;  1OU5 A;  3RJF A;  3C18 A;  5B3Q A;  3M9M B;  4NXX A;  4YN4 A;  3V72 A;  3OJS A;  2W7O A;  2Y1J A;  9ICQ A;  3PW2 A;  2GWS A;  7ICG A;  1RPL A;  5KFY A;  4ATB A;  2CPR A;  4YG2 A;  3CNH A;  3ISC A;  3IHQ B;  3QNM A;  4R8U A;  1ZQW A;  4BGD A;  5KL8 B;  3EYZ A;  3F5E A;  1MQ2 A;  2I5H A;  2P35 A;  4A8E A;  1QH9 A;  5KFR A;  3SR6 A;  2I9G A;  1K5O A;  3KHL A;  3ICX A;  4RQ3 A;  2MSN A;  4RWN A;  4ATB B;  2EZY A;  3LVV A;  4F93 B;  5AKX A;  2JHD A;  9ICK A;  4UB6 U;  4PHE A;  2ZXH A;  1LVH A;  2J6T A;  2B56 A;  3PML A;  2A1J A;  3BS5 B;  1JXE A;  2VA2 A;  5J2B A;  3SAF A;  2QAR A;  3AU2 A;  4IC9 A;  4DL4 A;  4XRH A;  4B6J A;  2E8O A;  3PY8 A;  5EE0 A;  2WF9 A;  3DEE A;  3VC8 A;  3RJI A;  4UAZ A;  1Z3E B;  1UQV A;  1TFY A;  3E0F A;  5ALU A;  4AYB F;  1ZQA A;  1SKS A;  1Z1V A;  2P6U A;  3PHZ A;  1ZQK A;  4P4O A;  1O08 A;  3MR3 A;  3IG5 A;  2E8N A;  1L5U A;  1N62 A;  1COO A;  2YTU A;  3TFS A;  3KKA C;  4MFF A;  4PPX A;  1LKY A;  3MFH A;  4DSJ A;  5KFG A;  2Y9U A;  4JV0 A;  2QB1 A;  1J97 A;  3FM9 A;  4PHA A;  4ELT A;  1B4F A;  4M6W A;  3JYY A;  4CF3 A;  3C29 A;  2K60 A;  3AQN A;  3OSN A;  2M2T A;  1ZQH A;  1U45 A;  1F5S A;  2E8M A;  3JCF A;  4RQ5 A;  8ICV A;  7ICR A;  3KBB A;  3UMG A;  1XSN A;  1BPX A;  4XUS A;  1S0M A;  1NI3 A;  1RDF A;  3T5K A;  4J9P A;  5HNK A;  2BKE A;  2N1R A;  2UVV A;  1ZQJ A;  4X4U A;  1WWV A;  3PSP A;  5J2A A;  3QE9 Y;  4MKP A;  1S77 D;  2ES6 A;  4UB3 A;  3MR5 A;  5DB9 A;  4B9T A;  5D62 A;  5DGA A;  1JIH A;  2JEF A;  2HN2 A;  8ICW A;  3JPR A;  2HOF A;  2ZH8 A;  2DVI A;  3EW9 A;  2B51 A;  2MU2 A;  1RZT A;  4B9M A;  1Z4N A;  1F5A A;  1TK5 A;  1QQ5 A;  4EEN A;  4J9S A;  3EWA A;  2C2R A;  3M9N B;  1SV4 A;  5KG6 A;  5DDM A;  2EAP A;  1Z00 B;  4ED0 A;  3OVS A;  4QW9 A;  4QZC A;  8ICR A;  5KFS A;  2UVU A;  4ED2 A;  3AN1 A;  8ICA A;  1L8O A;  2AHO B;  2DWQ A;  4WH5 A;  5HHH A;  4FH3 A;  2KJ8 A;  2AQ0 A;  5HMM A;  5AM3 A;  5KFE A;  1SZP A;  7ICL A;  4WBZ A;  1UET A;  2Y1I A;  1ZQE A;  3K7D A;  5AKZ A;  4FZN A;  1IM4 A;  2WB1 F;  5KFL A;  3Q8K A;  2XCA A;  4G3I A;  5ALR A;  3M7D A;  5HRE A;  3IG8 A;  3AU6 A;  2E3T A;  4K8V A;  1PUZ A;  2JZB B;  2FLL A;  4NLC A;  1V85 A;  3GV8 B;  4RQ6 A;  5G5G A;  1ZQF A;  1BPB A;  4WOY A;  5BOL A;  5J2F A;  2RP5 A;  4F5O A;  5HRB A;  1NJZ A;  5IIO A;  3THV A;  1RXW A;  4KLH A;  2EAN A;  8ICO A;  2MRL A;  1TFW A;  1A77 A;  4DQS A;  2NRZ A;  3HJE A;  4JV2 A;  4R8U B;  2GLE A;  3RF9 A;  4IG8 A;  1ARO P;  5ALI A;  5KFK A;  3RR8 A;  1ZQG A;  3I28 A;  3BQT A;  9ICC A;  3GIK A;  3RRH A;  3T5L A;  5DG7 A;  2Y0S F;  3SD7 A;  5ALO A;  1ZET A;  4EEY A;  4Y2V A;  7ICH A;  4Y2P A;  1L7M A;  2AGP A;  4KN7 A;  2EDU A;  4Q45 A;  3ZDC A;  4BJQ A;  3K4G A;  4DSF A;  4NXT A;  3L9D A;  4I2D A;  2OHF A;  1RG6 A;  2GAF D;  3V6K A;  4NXZ A;  5DQG A;  1T3Q A;  2WAQ F;  4PJ0 U;  4I2G A;  5KG3 A;  5K4L A;  1DOQ A;  4Y2J A;  3JPP A;  3BQ1 A;  2W04 A;  1L7O A;  4ED1 A;  3ERC C;  1TFR A;  2IA6 A;  4K9B A;  4DS4 A;  4WQL A;  4RT2 A;  4CDG A;  3V6H A;  2BQ3 A;  2VIX A;  2P66 A;  4BX9 C;  4O9M A;  3CK6 A;  1U49 A;  5ALF A;  3SAH A;  2R8G A;  1XO0 A;  5DLF A;  1MSW D;  3RR7 A;  1SV0 C;  4PGY A;  5KFN A;  2KIV A;  5CFU A;  2BCR A;  3PVX A;  8ICF A;  3WFO A;  8ICJ A;  1S0O A;  2BR0 A;  5DGB A;  4DFP A;  4PZO A;  4FBU A;  1ZQT A;  3ORY A;  3RH4 A;  4Y2Y A;  4M5D A;  3QU9 A;  4F4Y A;  1RYR A;  2VAN A;  2FLN A;  1WUD A;  4AYB C;  4PH5 A;  2IOF K;  4KX3 A;  5ALD A;  4BWM A;  4NL9 A;  3OTQ A;  2V9W A;  4EBD A;  2HOQ A;  4I2C A;  3S6J A;  4US8 A;  1SWW A;  3M1Y A;  2HHP A;  3RAQ A;  2ZTD A;  2MAX A;  4U7C A;  2FMS A;  5AKJ A;  4QIW F;  3AUO A;  3LWM A;  2KZZ A;  2YQE A;  4WC6 A;  5J0X A;  1CI4 A;  3OV7 A;  4O3N A;  5KTQ A;  2FPK A;  1S97 A;  5KAF U;  4XJE A;  4EZ6 A;  4C8O A;  3EUB 2;  1ZQY A;  2A19 A;  4LZD A;  4F4W A;  1X66 A;  1A0P A;  2FE9 A;  3NVV A;  4NM2 A;  2ZIX B;  9ICT A;  2B6G A;  3NUQ A;  4C80 A;  3RH6 A;  2IMW P;  5FP0 A;  4DQI A;  3ED5 A;  5IIL A;  4X4P A;  4DFM A;  4CE6 A;  3I1Y A;  3LWL A;  4X0B A;  2F77 X;  3AQM A;  3U26 A;  3ER8 C;  2PXI A;  1FFV A;  2K4E A;  2YY6 A;  3ETL A;  5ALJ A;  5E79 U;  1O03 A;  4RUC A;  1KLN A;  5AIC A;  5D63 A;  3UXN A;  5CRX A;  3BZK A;  2IHM A;  5HML A;  1R8A A;  2ZH9 A;  3QEB Z;  4NY8 A;  4AT7 B;  5AI4 A;  2EWR A;  2NRX A;  1X9X A;  4LJX A;  1URJ A;  3GFK B;  2W7P A;  2K89 A;  5AKY A;  3AEV A;  2ZTC A;  3OUY A;  5KG5 A;  3QYP A;  5ALH A;  4UAW A;  3BJY A;  3D2Q A;  4M9H A;  1GO3 F;  1NK9 A;  1HIW A;  2IUB A;  8ICM A;  3ONN A;  1XNS A;  4GC7 A;  2XY6 A;  2QKQ A;  4QNL A;  5JUM A;  2M0N A;  4NWI A;  1ZQL A;  4FHW A;  1ZXI A;  1ZD2 P;  8ICT A;  2W3S A;  4KMU A;  4DF8 A;  3PMN A;  5ALT A;  1T8E A;  1NK7 A;  5AK5 A;  4F4X A;  3WFP A;  3KZX A;  3F2C A;  4UB2 A;  5J0Q A;  3TAR A;  5KFD A;  5J0Y A;  2ALZ A;  4UD5 A;  4Z6C A;  1ZD3 A;  4TUR A;  1L3T A;  4F5R A;  2L5Y A;  2W11 A;  9ICI A;  4KLD A;  4UAR A;  5J0T A;  1ZQ1 C;  1CEZ A;  4NLB A;  2F76 X;  2ZXI A;  4C8L A;  5JTI A;  2IBK A;  1V38 A;  4IR9 A;  4DO9 A;  2RDJ A;  4IQW A;  2HHS A;  1U4B A;  3IP4 B;  1WWU A;  3GV7 B;  1HJP A;  3QUQ A;  4UB8 U;  4EV6 A;  3G6Y A;  2BZF A;  2OM6 A;  5JU5 A;  4IL6 U;  1QSY A;  4TQR A;  4WC5 A;  1Q46 A;  3HJ1 A;  5AHX A;  5F9N A;  1ZYQ A;  7ICT A;  2HCF A;  4RQ8 A;  4OAF A;  4WC0 A;  1MIV A;  1N48 A;  4TUQ A;  1X2I A;  1S0V A;  4DSK A;  5HRK A;  1PVR A;  3E58 A;  4RQ0 A;  3Q8S B;  2LKY A;  2F2A B;  2D6F C;  3T79 A;  2HVI A;  1BPD A;  1B43 A;  4YR0 A;  3MFI A;  2Q4T A;  4RPZ A;  4JWM A;  1OUQ A;  4I2F A;  2F1I A;  5JTG A;  5CWR A;  2E5S A;  2H3F A;  2RQ5 A;  4QZD A;  1IG6 A;  5ALP A;  4YVZ A;  2F8K A;  2JV3 A;  1ZOL A;  3ER9 B;  3AL0 B;  1RQL A;  3PX4 A;  1U9L A;  5J29 A;  4X4Q A;  5B5E U;  1N5W A;  1NZP A;  3I76 A;  2F44 A;  4J9N A;  2R18 A;  4UAU A;  5KT5 A;  4YXM A;  3ZDE A;  2DL0 A;  5DBC A;  4ACO A;  3A0H U;  1ED1 A;  2DBY A;  2HHX A;  3L3F X;  3WU2 U;  3AQK A;  5AM1 A;  2ZHA A;  3Q8R B;  3DDH A;  1FA0 A;  8ICS A;  2ZJ5 A;  2ZHB A;  4KLO A;  3FAH A;  4QWA A;  2LHT A;  2F3N A;  4LZG A;  4WC3 A;  2KVC A;  3H0M B;  5AI8 A;  1LV5 A;  2DR9 A;  4CNQ A;  2LYA A;  4RWP A;  3PW4 A;  2KK0 A;  1NZB A;  1MIW A;  4Q44 A;  5J0P A;  4US9 A;  2M2V A;  4F92 B;  3BS7 A;  3QU5 A;  2BQU A;  4AT9 A;  1ZQS A;  1WCL A;  1QQ6 A;  5KAI U;  5KFZ A;  5CR0 A;  3HT3 A;  1MQ3 A;  1P7D A;  4RNM A;  5DG8 A;  4J9R A;  1KFT A;  4RQ4 A;  4AT8 A;  2DPJ A;  2GO7 A;  4P4M A;  8ICG A;  3OHB A;  4EZ9 A;  2H3I A;  4C8M A;  4TUS A;  2P6R A;  5ALV A;  3LDA A;  2RLT A;  2E8P A;  4O3Q A;  2R8K A;  2W9A A;  4Y2Q A;  4KLT A;  5J0R A;  3QXG A;  4PGX A;  2LBO A;  2G08 A;  4GC6 A;  3O0F A;  5DBB A;  1NK5 A;  3NRW A;  4AT7 A;  1YT3 A;  4YMM A;  5L1I A;  2ZIU B;  1DGJ A;  1N2X A;  4I0U A;  4P0P B;  5AKG A;  3WKD A; 
#chains in the Genus database with same CATH homology
 4KLJ A;  2W8L A;  5HRE A;  3M9O B;  2MUT B;  3BQ0 A;  3C1Z A;  3AU6 A;  2JZB B;  2AGQ A;  1RXV A;  2FLL A;  4NLZ A;  1UEV A;  8ICH A;  4K4H A;  2M2U A;  4AT7 A;  3IM1 A;  3GV8 B;  4RQ6 A;  1NJY A;  1XWL A;  1ZQF A;  4YCX A;  2PI4 A;  2DR5 A;  3GIJ A;  2XCP A;  1ZQD A;  4M9N A;  4O3P A;  1BPB A;  1S76 D;  1JQR A;  5J2C A;  5KT6 A;  5BOL A;  3JZ0 A;  5J2F A;  4F5O A;  4FS1 A;  1TKD A;  5HHI A;  2AU0 A;  3BDP A;  5HRB A;  3H8W A;  4XQ8 A;  4RPY A;  2WTF A;  5L1J A;  1TV9 A;  1NJZ A;  5IIO A;  3C2L A;  4ED8 A;  3THV A;  4NKT A;  4MF8 A;  4QWB A;  1HUO A;  1RXW A;  1DK3 A;  3C5G A;  4KLH A;  4UB1 A;  4DQP A;  3PV8 A;  8ICO A;  3AQL A;  3ZD9 A;  2ZH7 A;  3GII A;  1TFW A;  1A77 A;  4DQS A;  2NRZ A;  2ZUB A;  3C2M A;  8ICP A;  4JV2 A;  4G3I A;  4R8U B;  2ZUD A;  2JEJ A;  3JPT A;  3V6J A;  4ELU A;  4ECT A;  3UPS A;  4IG8 A;  1ARO P;  5KFK A;  2KZ3 A;  3RR8 A;  1ZQG A;  2AGO A;  5HRD A;  4CCH A;  5HRG A;  1ZQZ A;  3BQT A;  5CHG A;  2FMQ A;  1KDH A;  3GIK A;  9ICC A;  3RRH A;  4KN4 A;  1T3N A;  1XC9 A;  3RTV A;  3T5L A;  5DG7 A;  1WOT A;  4YP3 A;  1D8Y A;  4PHD A;  2JEG A;  1KFD A;  4F5P A;  1ZET A;  4EEY A;  3HW8 A;  5EWF A;  3RJG A;  7ICH A;  4DL7 A;  4KLI A;  2AGP A;  3UPQ A;  3H37 A;  5J2G A;  5J2I A;  5DBA A;  3RBD A;  4Z6D A;  1BPZ A;  4DLG A;  7ICO A;  4KN7 A;  3NGD A;  4DF4 A;  4I2A A;  4Q45 A;  5F9L A;  4ECX A;  3ZDC A;  4F3O A;  3K4G A;  8ICZ A;  1UT8 A;  4DSF A;  1NKC A;  2B21 A;  2F1J A;  3Q8Q B;  3L9D A;  4WC7 A;  1PZN A;  2ISO A;  4I2D A;  3PR4 A;  3ZDA A;  4RWQ A;  5J2J A;  1T4G A;  3KHG A;  8ICQ A;  4MEX A;  5KFP A;  2R8I A;  3V6K A;  4F4K A;  4NXZ A;  3H3A A;  8ICK A;  1UA0 A;  1NJX A;  1NKE A;  4KLG A;  2HHT A;  4RWO A;  4YMO A;  5HRH A;  5DQG A;  4QZF A;  2J6U A;  1SKR A;  5KFV A;  3PW5 A;  4KLM A;  4GXI A;  8ICC A;  3C23 A;  2R8H A;  3PO4 A;  4I2G A;  1ZQO A;  5KG3 A;  2ATL A;  2W9M A;  2NRK A;  1TK8 A;  1DOQ A;  3OHA A;  4F50 A;  3JPP A;  3ISD A;  3TFR A;  3BQ1 A;  4GXK A;  2ZH3 A;  4ED1 A;  4I2H A;  1TFR A;  4UBC A;  3M8S A;  4ECU A;  4ED3 A;  2IA6 A;  4EBK A;  4KLU A;  4DS4 A;  4FHW A;  9ICN A;  1QSS A;  4YFK A;  4I28 A;  9ICH A;  1BNO A;  4RT2 A;  1ZQU A;  3V6H A;  4QWC A;  2BQ3 A;  2P66 A;  4O9M A;  9ICV A;  2ZUC A;  3QZ7 A;  2AQ4 A;  5KFW A;  2MUT A;  4RQ7 A;  3NTU A;  4Q43 A;  4QWE A;  1U49 A;  2KFN A;  2R8G A;  1R89 A;  5C5J A;  4QZE A;  3TAQ A;  1ZQX A;  3ZD8 A;  5DLF A;  3K75 D;  4MEY A;  1MSW D;  3T3F A;  4F91 B;  3RR7 A;  1XO1 A;  5CJ7 A;  5J0W A;  4PGY A;  5KFN A;  3HP6 A;  1X9M A;  3RRG A;  4E0D A;  7ICN A;  1MIY A;  5DKW A;  2ASL A;  2DFL A;  4KTQ A;  2BCR A;  3PVX A;  2HVH A;  2HW3 A;  8ICF A;  3WFO A;  1SL1 A;  1S0O A;  2BR0 A;  8ICJ A;  5DGB A;  4DFP A;  5EWG A;  3GIL A;  4FBU A;  4M9J A;  1ZQT A;  1BGX T;  4JK1 A;  3ORY A;  3RH4 A;  4FHV A;  5KG7 A;  4WC4 A;  4M5D A;  3PR5 B;  4R63 A;  3SYZ A;  4F4Y A;  1RYR A;  5III A;  3C66 A;  5CP2 A;  4RT3 A;  2VAN A;  2FLN A;  5L1L A;  1SL2 A;  4B9N A;  4O3O A;  1L3U A;  2ISP A;  3RJJ A;  4PH5 A;  1V9P A;  2M2W A;  4FHY A;  3SZ2 A;  1ZQV A;  5J2K A;  3OGU A;  2XC9 A;  4B9V A;  4O5C A;  4QW8 A;  3H39 A;  4BWM A;  5KFI A;  5KFH A;  4ECR A;  1V4A A;  1TAU A;  3V7L A;  5KFA A;  4MFA A;  4EBD A;  2V9W A;  4B9U A;  4I2C A;  4TUP A;  1DK2 A;  3HIY A;  1Q78 A;  3GDX A;  2AJQ A;  4R65 A;  2XY7 A;  4M47 A;  3OSP A;  1VJ7 A;  4IQT A;  2V4Q A;  5HRF A;  2BCQ A;  2HHP A;  3JPN A;  4NLG A;  2A1J B;  3RAQ A;  2ZTD A;  2MAX A;  3Q8M A;  1ZQI A;  2FMS A;  4E8F A;  1ZJM A;  4C8K A;  3H38 A;  5J2H A;  3WFQ E;  3AUO A;  3LWM A;  2KZZ A;  4WC6 A;  5J0X A;  3OV7 A;  4O3N A;  1L3V A;  4QZI A;  5DLG A;  3GIM A;  1BPY A;  3SV3 A;  3H4D A;  2ZH1 A;  5KTQ A;  5KT3 A;  3MR2 A;  3B0Y A;  1EXN A;  2FPK A;  2J6S A;  4FO6 A;  1S97 A;  2PFO A;  7ICU A;  2HHV A;  5KFT A;  2FLP A;  4EZ6 A;  4C8O A;  3N97 B;  4UD4 A;  1ZQY A;  3MAB A;  4LZD A;  4F4W A;  2ASD A;  1PX5 A;  4ECY A;  4RZR A;  2DRA A;  2NRV A;  4DL2 A;  2NRW A;  4UB4 A;  4NM2 A;  9ICW A;  4P4P A;  2DRB A;  4EP7 A;  5BOM A;  2HHU A;  4XQ7 A;  3B0X A;  3RB4 A;  3MGH A;  1WCN A;  9ICT A;  2BCS A;  5CB1 A;  1Q79 A;  5DQI A;  4ZH4 A;  4KLQ A;  2BCV A;  3RH6 A;  2IMW P;  2HHW A;  4DQI A;  1BNP A;  5IIK A;  4PHP A;  4QZA A;  4UAY A;  5IIL A;  4X4P A;  4DFM A;  5KFO A;  3MDC A;  3LWL A;  3LQC B;  4X0B A;  3KHH A;  3EPG A;  4ED6 A;  3AQM A;  4FBT A;  2KFZ A;  1K1Q A;  4PGQ A;  4UQG A;  2M9N A;  4QZ8 A;  4UBB A;  3GQC A;  1X9S A;  4KLE A;  2PXI A;  3UXP A;  1XS9 D;  4IRD A;  2O1P A;  1NK4 A;  2R8J A;  5DB6 A;  4DS5 A;  9ICG A;  8ICI A;  4YXJ A;  1UT5 A;  4ED7 A;  3ETL A;  4QZ9 A;  2V4R A;  4F5N A;  4RUC A;  4RNO A;  2BGW A;  1KLN A;  1NK0 A;  3T5H A;  1TVA A;  2PFP A;  5HRI A;  3UXN A;  5HC9 A;  1R8C A;  3H40 A;  4RNN A;  2IHM A;  8ICE A;  5HML A;  4EYH B;  4LVS A;  8ICU A;  7ICQ A;  1R8A A;  3OUY B;  5KG0 A;  4DOC A;  2KP7 A;  4RQ1 A;  4DSE A;  1A76 A;  2ZH9 A;  3QEB Z;  4IR1 A;  4DEZ A;  5J0O A;  1U47 A;  2PFQ A;  4K4I A;  4NY8 A;  4AT7 B;  7ICI A;  2NRX A;  5D4B A;  3RB3 A;  4K4G A;  1SKW A;  2W9B A;  3SV4 A;  3GFK B;  1S9F A;  9ICU A;  2BPG A;  2ZTC A;  3OUY A;  4DL5 A;  4O3S A;  3HWT A;  2VA3 A;  2ZJA A;  5EOZ A;  5KG5 A;  7ICS A;  4ECQ A;  4UAW A;  1KRP A;  5KFJ A;  3BJY A;  3PO5 A;  4QZB A;  7ICV A;  5IIJ A;  3H4B A;  4EBC A;  3RBE A;  1ZQP A;  2IHN A;  4JV1 A;  4M9H A;  4QZH A;  4I29 A;  1NK9 A;  2VA8 A;  5KFX A;  9ICL A;  3HX0 A;  8ICM A;  4DWI A;  7ICE A;  4DFK A;  3GV5 B;  1D9D A;  4QZG A;  2C2D A;  1X9W A;  2ZTE A;  1JAJ A;  4WC2 A;  5F2V O;  4GC7 A;  1LB2 B;  4P2H A;  4E80 A;  3QZ8 A;  4J9L A;  5CA7 A;  2XY6 A;  5JUM A;  3RAX A;  1KSP A;  2HHQ A;  9ICB A;  4KLS A;  4YR3 A;  1K1S A;  2XGQ A;  1S10 A;  1ZQL A;  4M2Y A;  1MC8 A;  1XSP A;  5DB8 A;  3C21 A;  1HUZ A;  1T7P A;  3HPO A;  4YD2 A;  4ELV A;  4UB5 A;  4GXJ A;  2BQR A;  4WC1 A;  3PX6 A;  2PFN A;  4IQU A;  9ICS A;  3TI0 A;  1ZQR A;  2BPC A;  4EYI B;  5D46 A;  4DOB A;  5KFB A;  4I2E A;  8ICT A;  4KMU A;  4O3R A;  4DQQ A;  1ZQC A;  1VFG A;  2ZJ8 A;  3N4M B;  3JPQ A;  4DF8 A;  7ICF A;  3PMN A;  5HRL A;  2DR7 A;  1D9F A;  5L1K A;  3FYH A;  1JXL A;  1XU4 A;  1NK7 A;  1T8E A;  1NKB A;  5KFC A;  1ZQQ A;  4MF2 A;  4MFC A;  4F2R A;  8ICN A;  9ICR A;  4F4X A;  1KNY A;  3WFP A;  4I2J A;  5KFM A;  4UB2 A;  4X4T A;  1KEJ A;  2RFF A;  9ICO A;  4NLN A;  5J0Q A;  3TAR A;  5KFD A;  2I1Q A;  2Q0Z X;  5J0Y A;  5KG2 A;  2ALZ A;  4KLF A;  2ZH6 A;  4UD5 A;  4Z6C A;  4I27 A;  4F4Z A;  3V7K A;  1U48 A;  2DR8 A;  3V7J A;  3H8S A;  4TUR A;  2RDI A;  4RU9 A;  1L3T A;  3ISB A;  2W9C A;  1NOM A;  4ECZ A;  4O5K A;  4F5R A;  3WFR E;  4AT8 B;  9ICI A;  3PW7 A;  4KLD A;  2Q66 A;  4M04 A;  3C2K A;  5HP4 A;  4DSL A;  4J9Q A;  1NK8 A;  1OU5 A;  2BDP A;  2LYH A;  5J0T A;  3RJF A;  4KLL A;  1CEZ A;  7ICK A;  3C18 A;  5DG9 A;  4E7X A;  3M9M B;  2C2E A;  4X4O A;  4C8L A;  4YN4 A;  8ICX A;  2IBK A;  3MBY A;  3TAP A;  3V72 A;  4DSI A;  8ICB A;  1NO5 A;  4WBY A;  4IR9 A;  3OJS A;  4DO9 A;  2Y1J A;  2RDJ A;  9ICQ A;  1L3S A;  4IQW A;  2W9B B;  4AT9 A;  3PW2 A;  3OVB A;  2W9C B;  2HHS A;  4J9O A;  1U4B A;  2GWS A;  1ZQN A;  5KG1 A;  3MR6 A;  4DQR A;  7ICG A;  1RPL A;  5KFY A;  3GV7 B;  4M6W B;  5HR9 A;  4DLE A;  4ATB A;  4YG2 A;  3SI8 A;  3ISC A;  3IHQ B;  3JPO A;  9ICX A;  4C8N A;  4R8U A;  4Z6E A;  3KTQ A;  1HJP A;  1YLQ A;  1ZQW A;  3M8R A;  4BGD A;  1ZJN A;  4M0A A;  3EYZ A;  1MQ2 A;  4WCW A;  2BPF A;  9ICM A;  3G6Y A;  1TK0 A;  5KFR A;  5L9X A;  3ZDD A;  4XA5 A;  1QSY A;  4B9S A;  4TQR A;  4WC5 A;  5KFQ A;  4RQ2 A;  2I9G A;  3KHL A;  5EWE A;  4GLX A;  3HJ1 A;  4X4N A;  5F9N A;  4RQ3 A;  3C5F A;  1ZYQ A;  7ICT A;  3PNC A;  4RWN A;  1BVS A;  5KG4 A;  2KN7 A;  4RQ8 A;  3RJE A;  4ATB B;  3WFS C;  1JMS A;  5J2E A;  1QSL A;  4BXO A;  4WC0 A;  1UA1 A;  1MIV A;  3T5J A;  1N48 A;  1UEU A;  4TUQ A;  1ZQM A;  4KIT B;  1X2I A;  1S0V A;  4DSK A;  1NJW A;  4M9G A;  9ICE A;  9ICP A;  5HRK A;  4F93 B;  5KT7 A;  3LK9 A;  4Q8E A;  4ECW A;  1DGS A;  9ICK A;  4PHE A;  3MGI A;  2O5A A;  4S3N A;  2J6T A;  4RQ0 A;  3PML A;  2A1J A;  3H7I A;  3Q8S B;  1R8B A;  1JXE A;  2VA2 A;  3RJH A;  5J2B A;  4BXO B;  2ZH5 A;  3AU2 A;  4BWJ A;  4DL4 A;  4XRH A;  7ICP A;  2HVI A;  5J0U A;  1BPD A;  1B43 A;  4YR0 A;  3PY8 A;  1KTQ A;  4FH5 A;  5TZV A;  3MFI A;  5KT4 A;  4DFJ A;  2C22 A;  2H5X A;  4B9L A;  4RPZ A;  4JWM A;  4NM1 A;  4I2F A;  3RJI A;  2F1I A;  4UAZ A;  1Z3E B;  5CWR A;  1TFY A;  1ZQA A;  7ICM A;  4YR2 A;  3TAN A;  1CUK A;  4QZD A;  1SKS A;  4YVZ A;  3UQ2 A;  2JEI A;  3KHR A;  3Q8L A;  1XSL A;  4IRC A;  2P6U A;  2W8K A;  4NLK A;  7ICJ A;  3PX4 A;  1ZQK A;  4YD1 A;  4X4S A;  1U9L A;  5J29 A;  4X4Q A;  4P4O A;  3MR3 A;  1L5U A;  1COO A;  1NZP A;  4IQV A;  4QWD A;  3NYB A;  2ZH2 A;  4DL6 A;  3TFS A;  4J9N A;  2BE3 A;  4DOA A;  4BDP A;  3EPI A;  5KT5 A;  4O0I A;  4RUA A;  1C7Y A;  2FPL A;  4YXM A;  3ZDE A;  4MFF A;  3OVA A;  5DBC A;  3JPS A;  4PPX A;  2UVW A;  4YMN A;  1S0N A;  5DED A;  3MFH A;  3Q8P B;  3HJ4 A;  4DSJ A;  5KFG A;  2F1H A;  2HHX A;  4JV0 A;  1N56 A;  5J0S A;  2PBE A;  3QEA Z;  2NRT A;  1JX4 A;  3AQK A;  4PHA A;  4YQW A;  4ELT A;  4M6W A;  3JYY A;  4J9M A;  3Q8R B;  2ZHA A;  4X4V A;  1QLN A;  1FA0 A;  3AQN A;  5KT2 A;  2FPM A;  3OSN A;  4ECS A;  8ICS A;  2M2T A;  8ICL A;  2ZJ5 A;  1ZQH A;  1U45 A;  2UVR A;  4KLO A;  2ZHB A;  3RJK A;  4X5V A;  4QWA A;  2JZB A;  1JN3 A;  3PW0 A;  4O5E A;  4I2B A;  9ICF A;  4RQ5 A;  8ICV A;  7ICR A;  2OWO A;  3BQ2 A;  4F2S A;  4LZG A;  1XSN A;  3RB0 A;  1BPX A;  9ICJ A;  4WC3 A;  4Z6F A;  4XUS A;  1S0M A;  5J2D A;  1LV5 A;  4FHP A;  2DR9 A;  4I2I A;  4J9K A;  3T5K A;  4J9P A;  1NK6 A;  5HNK A;  4AT9 B;  3MDA A;  5KFF A;  2BKE A;  4RWP A;  2UVV A;  1ZQJ A;  3PW4 A;  3ZDB A;  4X4U A;  4FHX A;  5J2A A;  3QE9 Y;  4Q8F A;  1S77 D;  4NKU A;  1MIW A;  1KFS A;  4JUZ A;  4Q44 A;  4UB3 A;  5DB9 A;  3MR5 A;  5J0P A;  1D8L A;  1JIH A;  5KFU A;  5D49 A;  5DGA A;  4B9T A;  4M9L A;  1TAQ A;  2JEF A;  1ZQB A;  4F92 B;  2XGP A;  2DPI A;  2M2V A;  3RB6 A;  8ICW A;  3JPR A;  3PX0 A;  2ZH8 A;  2DVI A;  3G6X A;  1RYS A;  3EW9 A;  2KZM A;  4HYK A;  4ECV A;  1QTM A;  2BQU A;  1RZT A;  4B9M A;  1ZQS A;  5IIM A;  1F5A A;  4F8R A;  1WCL A;  1TK5 A;  3HT3 A;  5KFZ A;  5CR0 A;  2XO7 A;  1MQ3 A;  4J9S A;  3EWA A;  2C2R A;  1H38 A;  4RNM A;  5DG8 A;  3M9N B;  3E2E A;  4J9R A;  1KFT A;  4X0A A;  2ID1 A;  4X4R A;  4F5Q A;  4RQ4 A;  4RPX A;  4AT8 A;  5KG6 A;  1Y88 A;  2DPJ A;  5DDM A;  3EZ5 A;  2PI5 A;  4P4M A;  1Z00 B;  4ED0 A;  8ICG A;  1B22 A;  3OVS A;  4QW9 A;  4QZC A;  3OHB A;  2KTQ A;  4EZ9 A;  9ICA A;  8ICR A;  4C8M A;  4TUS A;  2P6R A;  5KFS A;  4R64 A;  4LT6 A;  2UVU A;  3H8J A;  4ED2 A;  3FDS A;  3LDA A;  2FMP A;  3C1Y A;  3RH5 A;  5DDY A;  4O3Q A;  1IXR A;  2R8K A;  4EBE A;  1SL0 A;  2W9A A;  8ICA A;  3OJU A;  4FS2 A;  4KLT A;  3TQ1 A;  5J0R A;  5HHH A;  5DEC A;  4PGX A;  4FH3 A;  4DL3 A;  5DB7 A;  1Z00 A;  2BHN A;  5BPC A;  4GC6 A;  4JWN A;  2XY5 A;  2AQ0 A;  2ASJ A;  5DBB A;  5HMM A;  5DQH A;  2C28 A;  5KFE A;  1SZP A;  1NK5 A;  7ICL A;  1UET A;  4WBZ A;  3UXO A;  2Y1I A;  1ZQE A;  2BCU A;  4R66 A;  4YMM A;  1IM4 A;  2ZH4 A;  5L1I A;  5KFL A;  3G6V A;  4IRK A;  8ICY A;  3UQ0 A;  5IIN A;  4EBJ A;  3Q8K A;  2XCA A;  1BPE A;  4TQS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...