5DBBA

Structure of human dna polymerase beta host-guest complex with the dg base paired with a da
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
329
structure length
327
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA polymerase beta
publication title N7 Methylation Alters Hydrogen-Bonding Patterns of Guanine in Duplex DNA.
pubmed doi rcsb
source organism Homo sapiens
total genus 99
structure length 327
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2015-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 5dbbA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 5dbbA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 5dbbA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5dbbA03
4I2FA 4AT9B 5CB1A 3M9MB 4AT9A 4AT8A 5EWFA 4EZ6A 3PO4A 2JEIA 4XA5A 2BPGA 4QWBA 3QEBZ 2XY7A 1S77D 7ICHA 1IM4A 4QZEA 1K1QA 2VA3A 4BDPA 5KFLA 5KFCA 4UB4A 3PMNA 4EYIB 3N4MB 4F91B 2VANA 4TUSA 2BCQA 3TAQA 1R89A 4EBKA 5DG7A 1HUZA 1ZJNA 5DB8A 4X4UA 1LV5A 4NXZA 4GXKA 3JPQA 3QE9Y 3Q8RB 1ZJMA 2PBEA 3WFOA 9ICGA 3MFIA 3E2EA 8ICFA 9ICFA 4XQ7A 2DR7A 1ZQPA 1TV9A 1RYRA 4DSFA 4F93B 1U9LA 4I2JA 4ECZA 4DOBA 1S0OA 4ED8A 4O5KA 1BPYA 4DSKA 4F3OA 7ICNA 3RR8A 5DDYA 2VA2A 2PI4A 3MFHA 1MIWA 4RWOA 1XS9D 1N56A 2RDJA 5CA7A 5DKWA 1TK5A 3TFRA 4R66A 4NKUA 2PFPA 2P66A 4YR0A 4PGQA 1KDHA 5HRDA 2C22A 4WC3A 3ORYA 2HHVA 3GDXA 4NM1A 5J2HA 2DVIA 4YCXA 4KLMA 4YP3A 4G3IA 4MEXA 1MSWD 2HHWA 5J2DA 4FS1A 3RBEA 4X4SA 4AT8B 4F4YA 4RPZA 1NZPA 4WBZA 2ZH4A 3QZ8A 2DRBA 2ZJ8A 4I2DA 3JZ0A 4DF8A 3GV5B 1MIVA 4YQWA 3H8JA 5C5JA 5KT7A 4YXMA 3PV8A 1T7PA 5KFIA 3T3FA 4F2SA 2BQUA 4F8RA 4QW9A 2ZHAA 4GXIA 4DL7A 1L5UA 2UVVA 4ECWA 3V7KA 3PVXA 2FMSA 2GWSA 4NKTA 1XSLA 4RQ6A 2Y1IA 2MUTB 4DS5A 2MUTA 4UAWA 4CCHA 1OU5A 1S9FA 5KFFA 2NRKA 5CJ7A 5BOLA 1NK9A 4KLTA 4M9GA 3UXOA 5DQHA 1KSPA 3KHHA 2DR8A 2JEJA 2LYHA 4WBYA 4QWAA 4FHVA 4B9NA 5HR9A 5F9NA 3QEAZ 5J2KA 4GC6A 4TUPA 7ICOA 5HNKA 1DK2A 1JAJA 5DECA 1U49A 8ICHA 4EBJA 8ICTA 5HHHA 3UXPA 4QZ9A 3HPOA 1SKSA 2RDIA 1Q79A 5KG0A 4QZHA 4O0IA 2ISOA 4FHXA 4JV2A 1EXNA 3GILA 1QTMA 3ZDCA 2ZTEA 3AU6A 2XO7A 1TVAA 4RQ0A 1KTQA 3GV8B 9ICHA 1S10A 4DQSA 1R8AA 1CUKA 5L1IA 4F4XA 5KFYA 4DLEA 4B9MA 4K4IA 4Z6EA 3KTQA 1BNPA 4YD1A 1F5AA 9ICTA 3G6VA 2ATLA 4Z6CA 3RJHA 8ICCA 1UETA 2A1JB 4F5RA 3RRGA 4WC7A 5IILA 3Q8KA 5KG7A 2UVRA 3PR5B 3PW2A 1TAUA 8ICLA 3AQNA 1ZQWA 1PZNA 1UA0A 2ALZA 3Q8LA 1ZQDA 9ICLA 4X4OA 4MFFA 4M04A 4EBCA 4QZDA 1B22A 5HRIA 3EYZA 4M9NA 4TUQA 2ZUBA 1MQ2A 4WC0A 4IRKA 1S76D 2J6TA 3T5HA 3LQCB 4YG2A 1L3SA 4X4VA 1ZQEA 1D8LA 5KFGA 5CR0A 1DOQA 4RUCA 7ICQA 1XWLA 3BJYA 4JK1A 1K1SA 1ZQYA 4EBDA 3PW0A 3ZD9A 1Q78A 4AT7A 5DDMA 5J29A 2R8GA 4IR9A 4PPXA 4AT7B 2NRXA 1TAQA 4RQ5A 2Y1JA 3C23A 3EPIA 1R8BA 2O5AA 3HJ1A 1A77A 3OGUA 1BNOA 4RQ1A 4X4PA 1SKRA 1KRPA 5KT4A 4RQ3A 1TK0A 1BPZA 8ICEA 1JX4A 3UXNA 1XU4A 4ECSA 4IQVA 5KFOA 3GIJA 3FDSA 9ICSA 9ICRA 4ED1A 2PFNA 4ATBB 4ATBA 3AQMA 2BPFA 4F5OA 5HRBA 1S0NA 1X9WA 3HWTA 5KFRA 4F4WA 2XY5A 1MQ3A 4RNMA 3RJGA 3UPSA 2R8IA 4B9SA 4DL3A 4EYHB 4FH3A 4I2HA 4QZGA 2WTFA 2IHMA 2W9CB 4RT2A 2W9CA 4LT6A 4KLQA 4DL5A 3AQLA 5J0SA 4KLEA 5J0QA 1UT5A 3RB4A 2KFZA 4J9OA 8ICYA 3MGHA 3H38A 4P4PA 4DL4A 4KN7A 3RJIA 1H38A 3TFSA 4X0AA 1X9MA 1S0VA 2M2WA 2ZHBA 4B9TA 4YMMA 2W9MA 3MGIA 8ICQA 3MABA 1A76A 3RBDA 2HW3A 9ICPA 4M5DA 3KHRA 1BPXA 4TQRA 9ICEA 5KFEA 3PO5A 8ICNA 5DLGA 4UAYA 9ICOA 2NRZA 4WCWA 8ICAA 5HRHA 3MBYA 5KFVA 3RB6A 1U4BA 4QZBA 1JXLA 4B9UA 4DSJA 4IR1A 2ZJAA 7ICFA 2ZH8A 5KFUA 1ZQIA 3K75D 1NKEA 2ZUDA 9ICIA 1SKWA 3H4BA 3OV7A 4M9LA 4DFMA 5EWGA 1WCNA 2NRTA 5DB9A 5J2EA 4O9MA 4M9HA 1NJZA 5KFPA 3RJJA 4P2HA 4TURA 1ZQNA 2O1PA 3WFSC 1NK7A 4O3OA 3LWMA 4DOCA 1U48A 4EZ9A 5J0TA 4MF8A 3OSPA 3V6HA 3H3AA 4DOAA 1ZQUA 1X9SA 2BPCA 3OSNA 3RJEA 3AUOA 4E0DA 4BWMA 2XGQA 3RH4A 2XY6A 3ISDA 4NLZA 4QZCA 2KTQA 4UAZA 1NK6A 1JIHA 2ZTDA 4ED3A 2W8KA 2KZMA 8ICXA 3L9DA 1L3VA 1V9PA 2DR5A 4B9VA 3V7LA 4YR2A 3JPPA 3MR6A 3V72A 2BQRA 4J9SA 2BCRA 4ZH4A 3SYZA 1Y88A 3AU2A 3NTUA 5KG1A 7ICRA 4RNOA 1NOMA 4Z6DA 2F1HA 1NK0A 1NK4A 4P4MA 5KTQA 2JEFA 1BGXT 5J2FA 3HX0A 3B0YA 5J2AA 3C1ZA 4UBCA 5IINA 4S3NA 2BKEA 4C8MA 4E8FA 4NLGA 9ICXA 4RQ2A 2FLLA 4HYKA 1D9FA 3JPRA 4YFKA 2ZUCA 5DBAA 1SL2A 4FH5A 4IQTA 4X0BA 4J9NA 8ICIA 5CWRA 5BOMA 8ICKA 1RPLA 1TFRA 1ZQLA 2ISPA 3OHAA 4J9KA 5J0PA 4DO9A 1UEUA 1KFTA 2DPJA 2ZH7A 1ZQCA 4ED7A 2BE3A 3PR4A 2V4QA 4YMOA 4O3RA 3ZD8A 4RWQA 2P6RA 4FO6A 7ICIA 5IIKA 7ICEA 4ECYA 3KHGA 1BPBA 4ECUA 3G6YA 1L3UA 4O5EA 3MDCA 3RH6A 5DGBA 4KLSA 7ICTA 3G6XA 1PX5A 4WC2A 2Q0ZX 3BQ2A 1ZQAA 4BXOB 2AGQA 1X2IA 3EWAA 1XSNA 4GXJA 2BQ3A 2MAXA 3B0XA 1S97A 4IG8A 3LWLA 3K4GA 2NRVA 2AQ4A 1ZQBA 1QSLA 3M8RA 4KLHA 5EWEA 2BDPA 4F4KA 4YN4A 1SZPA 4J9LA 3TANA 4DFKA 5HMLA 3V6JA 4WC6A 1UEVA 4UB2A 1ZQSA 4IRCA 5DBCA 3M9OB 3SZ2A 3TI0A 3BQ1A 3ZDDA 1WCLA 3RAXA 3HP6A 3C2LA 4ECQA 1LB2B 3C66A 3JYYA 4O3SA 4UB1A 1XSPA 2IMWP 3PY8A 2HHXA 2A1JA 9ICCA 4UB5A 2XC9A 4PGXA 1KNYA 4FHYA 4E80A 2FPLA 1U47A 3GFKB 3TQ1A 2W8LA 5KT6A 4J9MA 8ICPA 1Z3EB 4KLJA 4F50A 4RPXA 4MFAA 1U45A 7ICKA 5L1JA 3H4DA 4I2BA 4LVSA 4DL6A 4YR3A 4YMNA 1KFDA 4R63A 3MDAA 4I27A 3PX0A 5D4BA 2H5XA 4QZIA 1KEJA 5KG2A 1FA0A 3C2KA 7ICUA 4ECXA 3HJ4A 3SI8A 1NKCA 2ZH1A 3OVAA 3GIMA 5J2CA 4DFJA 1DGSA 4DSLA 4O3QA 4I2AA 3RH5A 2BCUA 1D8YA 4ED6A 4XQ8A 1RYSA 2XCPA 5KFQA 5KFBA 4RU9A 2PXIA 4J9QA 4KLLA 8ICZA 1QSYA 5J2BA 3H37A 4MEYA 1ZQVA 1IXRA 4QWDA 5KFHA 4O3NA 2PFQA 4NY8A 3ETLA 3PX4A 4C8KA 4Q8EA 2KP7A 1VJ7A 4FBUA 4KLDA 8ICBA 4I2CA 3T5KA 2JEGA 2V9WA 3NYBA 3ZDBA 2ASLA 1NK8A 4XUSA 2BCVA 1HUOA 1ZQMA 1ZQGA 2HHQA 7ICLA 5J0XA 2HHPA 5DG8A 5KFJA 5KT2A 2R8KA 3GIIA 9ICAA 4I2IA 1CEZA 3SV4A 2FMQA 3Q8SB 4RPYA 4DF4A 4UQGA 3JPTA 3RRHA 3C5GA 3Q8QB 4F4ZA 3OJSA 3EPGA 5L9XA 3RR7A 4ECRA 1YLQA 3RB0A 4EP7A 5DB7A 4KITB 1ZQJA 3EW9A 3GIKA 1RXWA 7ICSA 4ELUA 4K4GA 4WC4A 3RAQA 3PW7A 2AGOA 5J0YA 2C2DA 4RUAA 5HC9A 2M2UA 1ZQXA 8ICUA 2I1QA 4NLKA 4FHWA 4RQ4A 2IA6A 3IM1A 4WC5A 2ZH3A 4BWJA 3WFPA 3BDPA 4F5QA 1ZQQA 5KFKA 4R64A 5HP4A 4KMUA 5KFNA 8ICJA 7ICPA 1ZQRA 5CP2A 3LDAA 4DLGA 1NJYA 2C28A 5KFXA 5F9LA 4GC7A 4DQRA 1XO1A 1TK8A 1D9DA 3HW8A 2W9BB 2W9BA 3SV3A 3OVSA 1AROP 4ECVA 3H39A 4DQIA 5KG3A 2ASDA 4DQPA 4YXJA 4LZGA 3PW5A 4UD4A 3KHLA 1TFYA 2FPKA 2BGWA 3JPOA 1S0MA 4R65A 4KLUA 3ISBA 3RJFA 2FPMA 3ZDEA 2AJQA 4F5NA 3EZ5A 4O5CA 5TZVA 3T5JA 4KLFA 2M2VA 8ICVA 3PNCA 5KG5A 3M9NB 1T3NA 1UT8A 7ICMA 2ASJA 5J0WA 1JQRA 2ZH6A 4X4NA 2UVUA 4X5VA 1Z00B 4R8UB 1Z00A 4R8UA 4RQ8A 5DLFA 2J6SA 3Q8PB 3MR2A 4ED2A 3WFRE 4M6WB 4M6WA 3RB3A 4DQQA 5IIJA 4QWEA 3MR3A 1QSSA 1L3TA 4RWPA 4JWMA 5F2VO 5DGAA 4PHAA 4C8OA 4IQUA 8ICMA 4WC1A 5IIMA 4EBEA 8ICWA 4IRDA 5J2GA 2ZTCA 5DB6A 1ZQZA 5KFSA 3T5LA 4KLIA 4KN4A 3PX6A 4MFCA 2KZ3A 2KZZA 1KFSA 5J0OA 2PI5A 4Q8FA 4K4HA 3OUYB 3OUYA 1JMSA 5KT5A 2FLNA 4Q43A 4KLGA 3Q8MA 1BVSA 4UB3A 4FS2A 9ICQA 4TQSA 3AQKA 9ICVA 4BXOA 4C8LA 3H40A 2BCSA 4P4OA 3RTVA 4JV1A 2R8JA 3H8WA 5J2JA 5KG6A 2ZJ5A 2W9AA 5IIIA 5J0UA 3TAPA 1ZYQA 2FMPA 1XC9A 5HMMA 2C2RA 1JN3A 2KN7A 2XCAA 2RFFA 2ZH2A 3H7IA 2IBKA 4ELTA 4X4RA 3RJKA 2NRWA 4I28A 4JWNA 2XGPA 8ICSA 1C7YA 3C21A 5HHIA 4I2GA 4JV0A 3FYHA 9ICUA 5J0RA 1NJXA 5J2IA 3UPQA 4B9LA 2KFNA 2AQ0A 4J9PA 3TARA 7ICJA 9ICMA 1ZQKA 1MC8A 2P6UA 4PH5A 3WFQE 1T8EA 1ZETA 4KLOA 4ELVA 2R8HA 4DSIA 5EOZA 8ICGA 7ICVA 1JXEA 2AGPA 5DBBA 1BPDA 3THVA 3HT3A 3V7JA 4ECTA 1V4AA 4RT3A 2DFLA 4O3PA 4FBTA 4DEZA 4E7XA 2BHNA 3BQTA 4JUZA 4I29A 4GLXA 3ISCA 2OWOA 3MR5A 3JPNA 2PFOA 4M0AA 4NM2A 4F5PA 1NJWA 3HIYA 1R8CA 5HRGA 5D46A 3NGDA 2DR9A 4J9RA 5BPCA 5HREA 1DK3A 5KFDA 5DQIA 4NLNA 1VFGA 1UA1A 4BGDA 3C1YA 5KT3A 1SL0A 1TFWA 4DL2A 1NK5A 1ZQHA 2JZBB 4DWIA 2JZBA 7ICGA 4FHPA 3IHQB 1ZQFA 5KFAA 3M8SA 4RWNA 3UQ2A 4RNNA 1ZQTA 5IIOA 3LK9A 3OHBA 8ICRA 4XRHA 4PHPA 2HHSA 4I2EA 5KFZA 4Q44A 3GQCA 1N48A 4RZRA 4X4TA 2C2EA 1T4GA 2VA8A 1HJPA 4QW8A 4QWCA 1RXVA 4UD5A 1ZQOA 4X4QA 8ICOA 2ZH9A 2HVIA 5CHGA 3PMLA 5D49A 4C8NA 2UVWA 2ID1A 4EEYA 4UBBA 1BPEA 2M9NA 5HRFA 4F92B 2HVHA 4YVZA 1B43A 5L1LA 3N97B 2IHNA 2HHTA 4PHEA 3C18A 2DRAA 1TKDA 1NO5A 5L1KA 4DFPA 3ZDAA 4M9JA 9ICBA 5KG4A 1NKBA 4PGYA 2F1IA 2BR0A 2ZH5A 5DQGA 1RZTA 2DPIA 1KLNA 4KTQA 2HHUA 3PW4A 4RQ7A 3JPSA 9ICJA 2B21A 1MIYA 1WOTA 5DEDA 1QLNA 2F1JA 3V6KA 3UQ0A 2V4RA 3QZ7A 9ICWA 5KFTA 5HRLA 4M2YA 5KFWA 4QZ8A 3H8SA 4DSEA 2AU0A 2I9GA 4M47A 3C5FA 4YD2A 4PHDA 3BQ0A 2Q66A 4QZFA 4QZAA 5KFMA 3OJUA 1SL1A 9ICNA 4DS4A 3C2MA 5JUMA 4LZDA 4ED0A 1COOA 9ICKA 4Q45A 4MF2A 2J6UA 2M2TA 4IQWA 5HRKA 3OVBA 5DG9A 2FLPA 4F2RA 3GV7B 4Z6FA
chains in the Genus database with same CATH superfamily
3KOOA 3PO4A 4QWBA 4NLBA 3BS7A 4U6PA 2XY7A 2IUBA 4QZEA 2VA3A 2YB4A 5KFCA 4UB4A 1PVQA 4EBKA 4TUSA 4X4UA 1LV5A 2F3NA 4NXZA 5KL1B 1ZQPA 4O5KA 3J81j 1UPHA 2VA2A 1V97A 3MFHA 3N28A 1XS9D 2K60A 1N56A 4R66A 2YTUA 1KDHA 3ORYA 5J2HA 4WJ3B 4YP3A 4K98A 4X4SA 2XI9A 1WWUA 3QZ8A 2ZJ8A 4AYBC 1MIVA 2KIWA 3WKAA 3H8JA 4YXMA 4F8RA 3OPXA 2UVVA 1L5UA 1QCKA 4ECWA 2Y1IA 1N5WA 4DS5A 1S9FA 5BOLA 5ALGA 2DR8A 4FZLA 2LYHA 4FHVA 4B9NA 5HR9A 5J2KA 4GC6A 7ICOA 2KOBA 5HNKA 1JAJA 1U49A 5HHHA 4QZ9A 1L8LA 2EAPA 4QZHA 4O0IA 4FHXA 2WAQF 1QTMA 3ZDCA 4EEBA 2ZTEA 4DQSA 4DLEA 1F5AA 3KTQA 3RJHA 2M0NA 5AKJA 4UAVA 4WC7A 5IILA 8ICLA 3AQNA 2LM1A 3PR5B 1ZQWA 3BZCA 1ZQDA 9ICLA 4X4OA 4MFFA 3E58A 5HRIA 1URJA 4IC9A 3SENA 2G5HB 1S76D 3SD7A 1IV8A 4YG2A 1D8LA 5KFGA 1DOQA 7ICQA 5AHXA 1FEZA 4EBDA 3VC8A 2AHOB 4PPXA 2NRXA 2Y1JA 3EPIA 4UB8U 5GTHU 1KL9A 1TK0A 1BPZA 5AKHA 1XU4A 4IL6U 3ZI4A 5HRBA 4F5OA 3HWTA 3UPSA 4CRXA 2XIDA 3KBBA 4I2HA 4QZGA 2W9CB 4LT6A 3TKAA 4KLEA 5J0QA 2KFZA 8ICYA 3MGHA 2BZFA 1H38A 3TFSA 4X0AA 3VCBA 1S0VA 2M2WA 2JMGA 4YMMA 2W9MA 3MGIA 8ICQA 9ICPA 4OD0A 4TQRA 5KFEA 4WCWA 8ICAA 3MBYA 1JXLA 3WU2U 7ICFA 3K75D 4NXTA 1CRXA 3L4PA 4DFMA 4FFDA 5L1MA 2LYBA 2CN1A 3BS5B 4O9MA 2E3TA 4M9HA 2VIXA 2B6GA 2WHEA 1SXEA 2LPEA 3C28A 5ALVA 4E0DA 2RHFA 4QZCA 2KZMA 4NJ8A 8ICXA 1Y88A 2LYAA 2E5SA 2ODGA 5ALQA 4RNOA 3KZXA 1T94A 2E8MA 1NK0A 4P4MA 3HILA 4S3NA 3MCRA 4C4SA 3UMGA 4RQ2A 3JPRA 4HAIA 2ZUCA 4C4TA 4FH5A 4IQTA 5BOMA 4C7YA 1TFRA 2ZH7A 4J9KA 4DO9A 2ZIUB 1ZQCA 2QARA 3SAGA 2V4QA 4YMOA 3AEVA 4RWQA 3I28A 4FO6A 2D3DA 5IIKA 4UARA 7ICTA 4WC2A 1PK3A 4BXOB 1X2IA 5AI0A 3B0XA 4IG8A 2AQ4A 3NVVA 2W11A 2G06A 3H0LB 4KLHA 4F4KA 4YN4A 4DFKA 5HMLA 2W7PA 1MN8A 2YN4A 4UB2A 4IRCA 3F53A 3TI0A 3RAXA 2EAOA 4ECQA 1LB2B 2DKXA 4UB1A 2IMWP 2HHXA 4PGXA 5ALKA 4DCCA 2B56A 2KICA 1U45A 4I2BA 2FDRA 2F8KA 4ECXA 1NKCA 4Y2JA 3F2CA 2BCUA 4KLLA 8ICZA 2XCPA 4O6AA 4OJPA 4NLCA 1NZBA 1IXRA 2B0CA 3ED5A 2K4IA 4O3NA 4NY8A 4Q8EA 4C8KA 2KK0A 4I2CA 3LVVA 5ALPA 3NYBA 7ICLA 1ZQMA 1ZQGA 5J0XA 4EEDA 2R8KA 9ICAA 4I2IA 1CEZA 2H3VA 1SB3C 4RPYA 3QU2A 4FE3A 5L9XA 2JH7A 3EW9A 2WF6A 3RAQA 2AGOA 5J0YA 2C2DA 4RUAA 2Y0SF 8ICUA 2I1QA 1SGGA 4RQ4A 3IM1A 1L7PA 4DFDA 5KFKA 4R64A 4KMUA 4QJFB 7ICPA 2NV3A 5CP2A 2W9BB 3SV3A 4DQIA 3NWIA 2ZG6A 5ALDA 2EH9A 4QNLA 4YXJA 2QKQA 4LZGA 3T79A 4OO1J 2FPKA 4PZOA 2F8LA 1S0MA 4R65A 1B4FA 4Y2YA 2FPMA 5AM1A 3EZ5A 2HI0A 2IOFK 1HEKA 2OXOA 3WK9A 3M9NB 2GAFD 2ZH6A 1Z00A 4R8UA 1SZHA 4ED2A 4KX5A 3SMVA 4NWIA 4M6WB 2DQNB 4RWPA 1LVHA 1YZ7A 4P0QB 8ICMA 2DKZA 5J2GA 2ZTCA 5DB6A 1ZQZA 4KLIA 3PX6A 2KZ3A 1O03A 3KFUF 5J0OA 2PI5A 1HIWA 3OUYB 5KT5A 2FLNA 3SEIA 4UB3A 1MA7A 4JV1A 1DK2A 4OJ6A 5KG6A 9ICKA 3TAPA 2QLTA 1XC9A 2RFFA 2KN7A 3UM9A 2NRWA 3BZKA 5J0RA 1NJXA 5J2IA 4B9LA 3TARA 1ZQKA 1MC8A 4PH5A 3WFQE 3WKBA 8ICGA 3CYMA 4C80A 5DBBA 3HT3A 5AKIA 4OAIZ 4DEZA 3ISCA 4NM2A 4KB6A 3HKZF 1TFWA 1UA1A 2JZBB 3H0RB 2FJ6A 1Z4NA 4Q44A 4O67A 4RZRA 3NVOA 2C2EA 4UD5A 3IV6A 8ICOA 4GIBA 5D49A 4C8NA 2ID1A 4EEYA 5HRFA 4F92B 2HVHA 3C18A 3IN5A 1XO0A 4O3MA 5DQGA 1MIYA 2B21A 1QLNA 3V6KA 2V4RA 5KAIU 3QZ7A 4YD2A 3WK6A 1D8BA 4PL1A 4QZAA 3I1YA 2YX8A 4LZDA 4ED0A 4IQWA 4WQKA 2FLPA 3V72A 2BCQA 4I2FA 4AT9B 1N62A 4AT8A 3QEBZ 4N7RA 1RM6C 2CXYA 2LI6A 2GLEA 2VKQA 2HDOA 1OW5A 5DG7A 3N7PD 2PBEA 3Q8RB 2ZIVB 9ICGA 3MFIA 1TV9A 4DSFA 2N1RA 1J2NA 2YY6A 4DOBA 5F3XB 1BPYA 4DSKA 4F3OA 1MIWA 2PI4A 1TK5A 5DKWA 5AI9A 1RYUA 1Q46A 4YR0A 5HRDA 4WC3A 1NNLA 3SAHA 2HHVA 4YCXA 4KLMA 1MSWD 3RBEA 3N7RC 1NZPA 2ZH4A 1V85A 4AP9A 2DRBA 3NVYA 4I2DA 3GV5B 4F2SA 1RG6A 2BQUA 1F0MA 4QW9A 3SQIA 2DL0A 2ZIXB 3AMZA 1X9XA 2GWSA 3NVWA 4RQ6A 2MUTA 4UAWA 2DWQA 1OU5A 4ZOHC 3NASA 3UXOA 1SV0C 5DQHA 1KSPA 1ED1A 2GOLA 4WBYA 1P7DA 2H3FA 4TUPA 8ICHA 8ICTA 3HPOA 1SKSA 5D62A 2RDIA 1Q79A 5AICA 2QB0B 3AU6A 2XO7A 3QUQA 1KTQA 3GV8B 2Y9TA 5L1IA 4F4XA 5KFYA 4EP7A 5ALEA 1N60A 1BNPA 2KHVA 3SAFA 4F5RA 2UVRA 1ZRNA 3PW2A 5AK5A 1PZNA 2ALZA 2HOQA 4M04A 4QZDA 2O6KA 1SWVA 1DXSA 3T5HA 2W3SA 4X4VA 1XWLA 3BJYA 1K1SA 1ZQYA 2K4PA 4AT7B 4IR9A 4RQ5A 1R8BA 2O5AA 1BNOA 2KKVA 5EE9A 5KT4A 1L7NA 2B51A 2W43A 1JX4A 4ECSA 4IQVA 5KFOA 3OTQA 4ATBB 2ZXHA 1MQ3A 1X9WA 2HN2A 5KFRA 2XY5A 3RJGA 2R8IA 3TACB 2WTFA 2IHMA 4RT2A 4KLQA 4DL5A 4Y2VA 4J9OA 1FIQA 3EF2A 1TE2A 2ZHBA 4B9TA 1A76A 2HW3A 3KHRA 9ICEA 3PO5A 9ICOA 5DLGA 4UAYA 2GA9D 4IR1A 4B9UA 2ZH8A 1U4BA 2ZJAA 5KFUA 2G0AA 1WG8A 3F2DA 4LEVA 2ZUDA 5J2EA 4UB6U 3H0MB 5KFPA 4O3OA 3OSPA 5EE0A 3WKDA 3RJEA 1X9SA 2XGQA 2FCLA 3K1ZA 4NLZA 5JTGA 3QUBA 4C4RA 1JIHA 2ZTDA 2W8KA 1L3VA 4EGWA 4B9VA 2BQRA 3JPPA 4J9SA 2BCRA 2K8CB 3AU2A 2MU2A 4Z6DA 3U26A 3HX0A 2BKEA 2KG5A 1X66A 4E8FA 4NLGA 1VDVA 4PL2A 4YFKA 3HRDD 5DBAA 1PK1A 3KD3A 4J9NA 2ZXIA 1RPLA 1ZQLA 2ESEA 3PR4A 3ZD8A 2PMZF 7ICIA 2EANA 4QIWC 1BPBA 4O5EA 4KLSA 3RH6A 2Q0ZX 3QU9A 2VJ5A 2EZYA 1XSNA 4GXJA 3TADC 3M8RA 5EWEA 1SZPA 4J9LA 3TANA 4UW9A 3SZ2A 2EDUA 3BQ1A 1WCLA 3HP6A 3PY8A 1KNYA 2A1JA 4FHYA 4LJXA 3WK7A 3TQ1A 2KKPA 4MFAA 3H4DA 3QUCA 4YR3A 1K5OA 4YMNA 1KFDA 5AKYA 1Z4OA 4LEZA 3PX0A 4QZIA 1FA0A 7ICUA 3AQFA 2ZH1A 3QNMA 3OVAA 5J2CA 1DGSA 4I2AA 1RYSA 4RU9A 2PXIA 1ZXIA 3LYSA 5J2BA 4NL9C 4RQMA 4QWDA 2A3VA 3ETLA 3PX4A 1GPJA 8ICBA 3ZDBA 1NK8A 2HHPA 2XVTA 3SV4A 3JPTA 3Q8QB 4F4ZA 3RR7A 1YLQA 5C0YA 2KHQA 3WK4A 2W55A 3GIKA 4K4GA 2KIVA 3WKEA 5HC9A 2M2UA 3FM9A 2OH2A 5ALFA 3NUQA 2OHFA 5KFNA 1UCVA 1ZQRA 2B4VA 3LDAA 2C28A 1S5LU 4EELA 1XO1A 4ICAA 3HW8A 2JR5A 2IHOA 3M6KA 4EENA 2RRDA 3H39A 1XNSA 2OYYA 1SIJA 5KG3A 4HX0A 3PW5A 2BGWA 3JPOA 1ZOLA 4KLUA 3ISBA 2AJQA 4F5NA 4KLFA 1FFUA 2UVUA 3Q8PB 5AKGA 3RB3A 3IDWA 1QSSA 1PVPA 2F77X 4IS7A 5G5HA 2OCEA 2KZZA 3GU3A 3F5AA 1KFSA 4F72A 3L3FX 3I76A 1JMSA 4Y2QA 3UMBA 4EX7A 4KLGA 2GO7A 1BVSA 4LEYA 4C8LA 3H40A 2BCSA 4P4OA 3RTVA 2W9AA 1ZYQA 2ZIWB 2ZH2A 2EZZA 4NV0A 1ZD4A 4ELTA 2HSZA 3RJKA 4I28A 4CDGA 4Y2RA 1LKYB 4I2GA 4JV0A 9ICUA 3ER9B 2P6UA 4WOYA 2HMXA 4AYBF 4DSIA 5JU5A 2AGPA 1BPDA 5HR7A 2AXTU 3V7JA 4ECTA 1V4AA 3E0FA 1JI7A 1NI3A 2BHNA 3BQTA 2KSOA 4GLXA 3MR5A 4F5PA 5HRGA 2DR9A 4J9RA 2YMLA 4UASA 2K8BB 5KFDA 5DQIA 4NLNA 1SL0A 2F44A 4BGDA 2IOFA 2K4EA 4DL2A 4QIWF 4FHPA 5ALLA 5KFAA 4RWNA 3UQ2A 4RNNA 8ICRA 4XRHA 4PHPA 1T4GA 4QW8A 1RXVA 2BBHA 1ZQOA 4X4QA 1QQ7A 5CHGA 3B9JA 2UVWA 1PUZA 4UBBA 2M9NA 2K8AA 2HHTA 5H2FU 4PHEA 2DRAA 1NO5A 5L1KA 5AI4A 5KG4A 4PGYA 5J8YC 4OJ5A 1KLNA 2JXJA 1L7OA 5AM3A 2F1JA 2EAMA 3UQ0A 5HRLA 4M2YA 5KFWA 3ETRA 5CHEA 2AU0A 4PHDA 2Q66A 5ALSA 1SL1A 4DS4A 5ALRA 4MF2A 2GH1A 1ZRMA 4U7CA 4RQNA 5KNIA 5HRKA 4Z6FA 4OJLA 5CB1A 2DBYA 4EZ6A 2JEIA 4UAUA 4USAA 1S77D 4Y2PA 7ICHA 1IM4A 4BDPA 3D2SA 4J03A 5KL8B 3N4MB 1R89A 2VANA 1YZ6A 3TAQA 1HUZA 1QH9A 1ZJNA 5ALNA 5A0LA 4GXKA 3QE9Y 1ZJMA 3E2EA 8ICFA 4XQ7A 5ALZA 1U9LA 2G07A 3QUTA 4ECZA 1S0OA 4ED8A 7ICNA 5DDYA 2KVSA 3CNHA 5K4LA 4RWOA 2RDJA 4GFJA 4PGQA 3WK8A 2IOHA 2DVIA 3GDXA 4NM1A 1CI4A 4G3IA 5ALIA 2HHWA 3CRXA 2G08A 3ER8C 2WB1C 3AN1A 4YQWA 5C5JA 3PV8A 2ZHAA 4GXIA 4DL7A 2FMSA 2DGZA 4NKTA 2Z7JA 1NK9A 4KLTA 2WF9A 4QWAA 3DV9A 5F9NA 4MKPA 5DECA 4EBJA 5AK3A 3UXPA 4JV2A 5ALXA 5ALUA 1EXNA 3GILA 1VJ5A 1TVAA 4RQ0A 9ICHA 1S10A 2LKYA 4CF4A 4K4IA 3G6VA 4Z6CA 1UETA 2A1JB 1F44A 2F2AB 2KV2A 5AKLA 4A8EA 3Q8LA 4EBCA 4M9NA 3IG5A 4TUQA 4WC0A 5AKKA 3LQCB 1L3SA 5CR0A 4RUCA 4JK1A 3PW0A 3ZD9A 2R8GA 1TAQA 2RQ5A 3HJ1A 1S8OA 5AM2A 4RQ1A 4X4PA 2LBOA 2KJ8A 8ICEA 1A0PA 2EZXA 9ICSA 1C20A 4BUGA 5ALMA 3AQMA 4F4WA 4RNMA 4B9SA 1ZD2P 4DL3A 2KJ9A 1J2MA 2W9CA 3C29A 5J0SA 3H38A 1UT5A 4P4PA 4DL4A 2D8CA 2HBLA 2OM6A 3MABA 4M5DA 2E8NA 3PSTA 5AI6A 8ICNA 2NRZA 4OAGA 1ZQIA 9ICIA 2HBJA 4KM5A 2LMRA 3IG8A 5AIAA 1SKWA 3DDHA 3R9KA 4OAHA 4NXVA 4JLXA 1OXJA 2NRTA 5DB9A 2HOIA 3RJJA 4P2HA 4TURA 3WFSC 2MRLA 4DOCA 1U48A 4EZ9A 2HN1A 4DOAA 4G9BA 1ZQUA 2BPCA 4WQLA 4BWMA 5AM5A 2XY6A 3A0HU 5AK6A 4PJ0U 1ZD3A 1UQVA 3MR6A 2FE9A 4ZH4A 5AI5A 7ICRA 4BJQA 2F1HA 1B0XA 5KTQA 1BGXT 1T3QA 5J2FA 3B0YA 5J2AA 4P0PA 4CF5A 4I0UA 3O0FA 1SL2A 2WAQC 2D6FC 5CWRA 8ICKA 2E8OA 3RF9A 4US9A 1UEUA 5J0PA 1KFTA 2DPJA 2ZIUA 2QARB 2MSNA 4O3RA 1ZQ1C 5AKEA 2KEYA 4ECUA 5DGBA 1KKXA 1PX5A 3BQ2A 3EWAA 2BQ3A 5HR6A 3LWLA 3K4GA 3IP4B 2KMDA 5DBCA 3M9OB 1IG6A 3ZDDA 1YT3A 1DRGA 3C2LA 5CFUA 3C66A 1JALA 1XSPA 9ICCA 4OAFA 4E80A 2WB1F 1RQNA 1U47A 3GFKB 3ICXA 2W8LA 5KT6A 8ICPA 4KLJA 4F50A 5L1JA 3SR6A 3QU7A 4LVSA 4EEKA 4DL6A 1PVRA 3MDAA 5D4BA 2H5XA 1KEJA 2I5HA 3FAHA 3C2KA 2JV3A 4K9AA 3HJ4A 3SI8A 1JRPA 5AI8A 3M1YA 3GIMA 4DFJA 4DSLA 4O3QA 3RH5A 5KFBA 4J9QA 2KE7A 4MEYA 1ZQVA 5KFHA 2KP7A 3IRUA 2EQYA 2JEGA 3CP8A 2JH1A 4XUSA 2HHQA 1F5SA 5DG8A 5KFJA 5KT2A 3OWGA 1ECWA 3K1RB 3Q8SB 4DF4A 3AL0B 3RRHA 3OJSA 3EPGA 4ECRA 3RB0A 4KITB 5AKZA 1RXWA 7ICSA 3PW7A 5ALYA 1ZQXA 4NLKA 5AKXA 3UMCA 1KW4A 4EX6A 2AH5A 3BDPA 2A1AA 2MA1A 8ICJA 2YQEA 2YMPA 5KFXA 3CW2C 5D61A 4DQRA 1D9DA 1TK8A 2W9BA 4F71A 4K99A 1Q8KA 2H3ZA 1TFYA 1L7MA 5TZVA 3T5JA 2HBKA 1SV0A 5B3QA 8ICVA 5KG5A 1T3NA 7ICMA 2ASJA 5J0WA 1JQRA 2EWRA 1Z00B 4R8UB 2KVCA 4RQ8A 5DLFA 3MR2A 4M6WA 4ACOA 2JHDA 4QWEA 1L3TA 1KN5A 4JWMA 5DGAA 2H3QA 5FP0A 2HOFA 4C8OA 3NVZA 2NYVA 4P0QA 5IIMA 8ICWA 1V38A 3T5LA 1WUDA 1X42A 2A19A 4Q8FA 3OUYA 4Q43A 3M6ZA 4FS2A 3D2QA 9ICQA 4TQSA 9ICVA 2CRXA 2R8JA 3H37A 1B22A 1RQLA 2ZJ5A 2QB1A 5IIIA 5J0UA 2FMPA 5HMMA 2XCAA 3H7IA 3RFAA 2IBKA 2WF5A 8ICSA 2HCFA 4KX3A 5HHIA 1JUDA 1T8EA 1ZETA 4ELVA 5EOZA 3NRWA 7ICVA 1JXEA 3THVA 2CPRA 4Y2TA 3N7SC 4RT3A 2DFLA 4E7XA 4JUZA 4I29A 2OWOA 2PFOA 4FZNA 4M0AA 2K4HA 5D46A 4K8VA 3NGDA 5BPCA 4FZMA 2WFAA 4CF3A 4OCZA 1VFGA 5KT3A 3C1YA 1NK5A 4DWIA 7ICGA 2JZBA 1ZD5A 1ZQFA 5IIOA 4O69A 3L5KA 5KFZA 4X4TA 1N48A 2VA8A 3NKUA 2ZH9A 2HVIA 2Y0SC 4YVZA 1B43A 5L1LA 2IHNA 1TKDA 4DFPA 2BR0A 1RZTA 1Z1VA 2DPIA 9ICJA 3PW4A 1WOTA 5ALOA 9ICWA 5KFTA 4QZ8A 1WWVA 4DSEA 3BQ0A 4QZFA 5KFMA 9ICNA 3QU5A 3C2MA 5JUMA 4CGZA 2J6UA 4NXWA 2YMMA 2BE3A 4F2RA 3GV7B 4AT8B 4AT9A 3M9MB 5EWFA 4XA5A 3M7DA 2BPGA 3D6JA 5ALHA 1K1QA 5KFLA 3PMNA 4EYIB 4F91B 1Q3VA 5DB8A 3JPQA 3WFOA 2ZIVA 9ICFA 4C7ZA 3PHZA 2DR7A 1RYRA 4F93B 4I2JA 3RR8A 3AM9A 5CA7A 3A0BU 3TFRA 3TADA 4OJOA 2PFPA 4NKUA 2P66A 2KNJA 2C22A 1OUQA 3KKAC 5B66U 2FI1A 4MEXA 5J2DA 4FS1A 4F4YA 4RPZA 4WBZA 1SV4A 4US8A 2K89A 3JZ0A 4DF8A 5KT7A 1T7PA 4P0PB 5KFIA 3T3FA 2ZIXA 3V7KA 3PVXA 4JMUA 4EV6A 1XSLA 2NO4A 2MUTB 4CCHA 5KFFA 1X6JA 5CJ7A 1Z1BA 2NRKA 4M9GA 1N63A 3KHHA 2JEJA 3HKZC 4Y2SA 4MHVA 3FC4A 3QEAZ 4JB3A 5KG0A 2YMQA 2ISOA 1JROA 4KMOB 4B6JA 2E8PA 4NL9A 2QB0A 5EE3A 1R8AA 1CUKA 4Y2UA 4B9MA 4Z6EA 1N61A 4YD1A 9ICTA 4Y2XA 2ATLA 8ICCA 5CFTA 3RRGA 3S6JA 3Q8KA 5KG7A 2LM4A 1TAUA 1UA0A 5TISU 2W7OA 3AQEA 3EYZA 1TAMA 2Q4TA 2ZUBA 1MQ2A 4IRKA 2J6TA 3QXGA 3WK5A 1ZQEA 1IIPA 1Q78A 4AT7A 5DDMA 5J29A 3C23A 1A77A 2H3IA 3OGUA 1SKRA 1KRPA 4RQ3A 1RDFA 5JTIA 3UXNA 3GIJA 3FDSA 9ICRA 2NO5A 5D63A 4ED1A 2PFNA 4ATBA 4FO1A 2BPFA 1S0NA 4EYHB 4FH3A 2E1EA 3AQLA 5ALTA 3RB4A 4KN7A 3RJIA 1X9MA 5GTIU 4K97A 3RBDA 1BPXA 3NS1A 5HRHA 3RB6A 5KFVA 4DSJA 4QZBA 3EUB2 2KJ5A 1M6YA 2W04A 3KKAA 2JRZA 1NKEA 3H4BA 3OV7A 4M9LA 4NXUA 5EWGA 1WCNA 2E1FA 5EE1A 1NJZA 1KBUA 1ZQNA 2O1PA 1NK7A 3LWMA 4BX9C 5J0TA 4MF8A 3V6HA 3H3AA 3OSNA 3AUOA 3RH4A 3ISDA 2KTQA 5ALWA 4UAZA 2WF8A 5CRXA 1NK6A 4ED3A 1QQ5A 3L9DA 2DR5A 1V9PA 3F2BA 3V7LA 4YR2A 4C0ZA 3SYZA 3NTUA 5KG1A 4NXXA 2YB1A 4CE6A 1NOMA 2BBJA 1NK4A 2HBMA 2JEFA 3C1ZA 4UBCA 5IINA 4C8MA 2BDUA 9ICXA 2FLLA 4HYKA 1D9FA 3H8MA 1A6SA 1PK1B 4X0BA 8ICIA 3QU4A 1Z19A 1VJ7A 2ISPA 3OHAA 4ED7A 3CK6A 2P6RA 3QX7A 5KAFU 7ICEA 4ECYA 3KHGA 4CNQA 3G6YA 3DEEA 1L3UA 3MDCA 3MC1A 3G6XA 2RLTA 1ZQAA 5AM4A 2JGAA 2AGQA 2MAXA 1S97A 3PZPA 2NRVA 1ZQBA 1QSLA 2BDPA 2DUYA 4WC6A 3V6JA 1UEVA 1ZQSA 3JYYA 4O3SA 2Y9UA 4JLZA 4UB5A 2XC9A 2VJ4A 4K96A 1O08A 2FPLA 5J8YA 4J9MA 1Z3EB 1UHUA 4RPXA 7ICKA 2DF4B 4R63A 4I27A 2R18A 3NRZA 5KG2A 2ES6A 1D8YA 4ED6A 4XQ8A 5KFQA 4PZNA 1QSYA 1X40A 2PFQA 1X6IA 3JCFA 2WF7A 4FBUA 4KLDA 3T5KA 2V9WA 2ASLA 2BCVA 1HUOA 2RP5A 4WH5A 2F76X 3GIIA 2FMQA 4UQGA 3C5GA 5DB7A 1ZQJA 3D2NA 3HJEA 4ELUA 4WC4A 5CFSA 1N2XA 4UATA 5AIBA 4FHWA 2IA6A 5E79U 4WC5A 2ZH3A 4BWJA 3WFPA 3BS5A 4F5QA 1ZQQA 1GO3F 5HP4A 1VLBA 2LHTA 3WKCA 4DLGA 1NJYA 5CEHA 1COKA 5F9LA 4GC7A 3OVSA 1AROP 4ECVA 2KD1A 1J97A 4UD4A 2ASDA 4DQPA 3KHLA 2G5IB 3RJFA 3ZDEA 4O5CA 1L6NA 2XICA 2M2VA 3PNCA 2PMZC 3ERCC 1UT8A 4K9BA 2P35A 4X4NA 2I6XA 4X5VA 3K7DA 2J6SA 3WFRE 4DQQA 5IIJA 3MR3A 5F2VO 5AM0A 4PHAA 4IQUA 4WC1A 5T14A 4EBEA 3QYPA 4IRDA 5KFSA 4KN4A 4MFCA 1Q3UA 4K4HA 3Q8MA 2OEHA 3AQKA 1DGJA 4BXOA 3ALRA 5J2JA 3H8WA 3PSIA 2C2RA 1JN3A 2ZIWA 4O68A 4X4RA 1QQ6A 4JWNA 2XGPA 1C7YA 1N5XA 3C21A 1LKYA 2L5YA 2W3RA 3FYHA 5G5GA 1SXDA 2PKEA 3UPQA 5B3PA 2KFNA 2AQ0A 4J9PA 7ICJA 9ICMA 3PSPA 3PSFA 4KLOA 2R8HA 4O3PA 4FBTA 2KSOB 3MGVA 3JPNA 1NJWA 3HIYA 1R8CA 5AK4A 5HREA 1DK3A 1AQ6A 5JRTA 1FO4A 1ZQHA 3IHQB 3M8SA 5ALJA 3LK9A 1ZQTA 3OHBA 3KZIU 1WYGA 2HHSA 4I2EA 1SWWA 3GQCA 1HJPA 4QWCA 5B5EU 3PMLA 2W03A 1BPEA 3N97B 3F5EA 2G09A 1L8OA 3ZDAA 1FFVA 4M9JA 9ICBA 1NKBA 2ZH5A 2F1IA 2HHUA 4KTQA 4RQ7A 3JPSA 5DEDA 3H8SA 2I9GA 4M47A 3C5FA 4XJEA 1KQQA 3OJUA 3GZFA 4LEWA 3ONNA 1COOA 3BQ7A 4Q45A 2M2TA 3LVWA 3OVBA 5DG9A 2W54A
chains in the Genus database with same CATH topology
4I2FA 4AT9B 5CB1A 3M9MB 4AT9A 4AT8A 5EWFA 4EZ6A 3PO4A 2JEIA 4XA5A 2BPGA 4QWBA 3QEBZ 2XY7A 1S77D 7ICHA 1IM4A 4QZEA 1K1QA 2VA3A 4BDPA 5KFLA 5KFCA 4UB4A 3PMNA 4EYIB 3N4MB 4F91B 2VANA 4TUSA 2BCQA 3TAQA 1R89A 4EBKA 5DG7A 1HUZA 1ZJNA 5DB8A 4X4UA 1LV5A 4NXZA 4GXKA 3JPQA 3QE9Y 3Q8RB 1ZJMA 2PBEA 3WFOA 9ICGA 3MFIA 3E2EA 8ICFA 9ICFA 4XQ7A 2DR7A 1ZQPA 1TV9A 1RYRA 4DSFA 4F93B 1U9LA 4I2JA 4ECZA 4DOBA 1S0OA 4ED8A 4O5KA 1BPYA 4DSKA 4F3OA 7ICNA 3RR8A 5DDYA 2VA2A 2PI4A 3MFHA 1MIWA 4RWOA 1XS9D 1N56A 2RDJA 5CA7A 5DKWA 1TK5A 3TFRA 4R66A 4NKUA 2PFPA 2P66A 4YR0A 4PGQA 1KDHA 5HRDA 2C22A 4WC3A 3ORYA 2HHVA 3GDXA 4NM1A 5J2HA 2DVIA 4YCXA 4KLMA 4YP3A 4G3IA 4MEXA 1MSWD 2HHWA 5J2DA 4FS1A 3RBEA 4X4SA 4AT8B 4F4YA 4RPZA 1NZPA 4WBZA 2ZH4A 3QZ8A 2DRBA 2ZJ8A 4I2DA 3JZ0A 4DF8A 3GV5B 1MIVA 4YQWA 3H8JA 5C5JA 5KT7A 4YXMA 3PV8A 1T7PA 5KFIA 3T3FA 4F2SA 2BQUA 4F8RA 4QW9A 2ZHAA 4GXIA 4DL7A 1L5UA 2UVVA 4ECWA 3V7KA 3PVXA 2FMSA 2GWSA 4NKTA 1XSLA 4RQ6A 2Y1IA 2MUTB 4DS5A 2MUTA 4UAWA 4CCHA 1OU5A 1S9FA 5KFFA 2NRKA 5CJ7A 5BOLA 1NK9A 4KLTA 4M9GA 3UXOA 5DQHA 1KSPA 3KHHA 2DR8A 2JEJA 2LYHA 4WBYA 4QWAA 4FHVA 4B9NA 5HR9A 5F9NA 3QEAZ 5J2KA 4GC6A 4TUPA 7ICOA 5HNKA 1DK2A 1JAJA 5DECA 1U49A 8ICHA 4EBJA 8ICTA 5HHHA 3UXPA 4QZ9A 3HPOA 1SKSA 2RDIA 1Q79A 5KG0A 4QZHA 4O0IA 2ISOA 4FHXA 4JV2A 1EXNA 3GILA 1QTMA 3ZDCA 2ZTEA 3AU6A 2XO7A 1TVAA 4RQ0A 1KTQA 3GV8B 9ICHA 1S10A 4DQSA 1R8AA 1CUKA 5L1IA 4F4XA 5KFYA 4DLEA 4B9MA 4K4IA 4Z6EA 3KTQA 1BNPA 4YD1A 1F5AA 9ICTA 3G6VA 2ATLA 4Z6CA 3RJHA 8ICCA 1UETA 2A1JB 4F5RA 3RRGA 4WC7A 5IILA 3Q8KA 5KG7A 2UVRA 3PR5B 3PW2A 1TAUA 8ICLA 3AQNA 1ZQWA 1PZNA 1UA0A 2ALZA 3Q8LA 1ZQDA 9ICLA 4X4OA 4MFFA 4M04A 4EBCA 4QZDA 1B22A 5HRIA 3EYZA 4M9NA 4TUQA 2ZUBA 1MQ2A 4WC0A 4IRKA 1S76D 2J6TA 3T5HA 3LQCB 4YG2A 1L3SA 4X4VA 1ZQEA 1D8LA 5KFGA 5CR0A 1DOQA 4RUCA 7ICQA 1XWLA 3BJYA 4JK1A 1K1SA 1ZQYA 4EBDA 3PW0A 3ZD9A 1Q78A 4AT7A 5DDMA 5J29A 2R8GA 4IR9A 4PPXA 4AT7B 2NRXA 1TAQA 4RQ5A 2Y1JA 3C23A 3EPIA 1R8BA 2O5AA 3HJ1A 1A77A 3OGUA 1BNOA 4RQ1A 4X4PA 1SKRA 1KRPA 5KT4A 4RQ3A 1TK0A 1BPZA 8ICEA 1JX4A 3UXNA 1XU4A 4ECSA 4IQVA 5KFOA 3GIJA 3FDSA 9ICSA 9ICRA 4ED1A 2PFNA 4ATBB 4ATBA 3AQMA 2BPFA 4F5OA 5HRBA 1S0NA 1X9WA 3HWTA 5KFRA 4F4WA 2XY5A 1MQ3A 4RNMA 3RJGA 3UPSA 2R8IA 4B9SA 4DL3A 4EYHB 4FH3A 4I2HA 4QZGA 2WTFA 2IHMA 2W9CB 4RT2A 2W9CA 4LT6A 4KLQA 4DL5A 3AQLA 5J0SA 4KLEA 5J0QA 1UT5A 3RB4A 2KFZA 4J9OA 8ICYA 3MGHA 3H38A 4P4PA 4DL4A 4KN7A 3RJIA 1H38A 3TFSA 4X0AA 1X9MA 1S0VA 2M2WA 2ZHBA 4B9TA 4YMMA 2W9MA 3MGIA 8ICQA 3MABA 1A76A 3RBDA 2HW3A 9ICPA 4M5DA 3KHRA 1BPXA 4TQRA 9ICEA 5KFEA 3PO5A 8ICNA 5DLGA 4UAYA 9ICOA 2NRZA 4WCWA 8ICAA 5HRHA 3MBYA 5KFVA 3RB6A 1U4BA 4QZBA 1JXLA 4B9UA 4DSJA 4IR1A 2ZJAA 7ICFA 2ZH8A 5KFUA 1ZQIA 3K75D 1NKEA 2ZUDA 9ICIA 1SKWA 3H4BA 3OV7A 4M9LA 4DFMA 5EWGA 1WCNA 2NRTA 5DB9A 5J2EA 4O9MA 4M9HA 1NJZA 5KFPA 3RJJA 4P2HA 4TURA 1ZQNA 2O1PA 3WFSC 1NK7A 4O3OA 3LWMA 4DOCA 1U48A 4EZ9A 5J0TA 4MF8A 3OSPA 3V6HA 3H3AA 4DOAA 1ZQUA 1X9SA 2BPCA 3OSNA 3RJEA 3AUOA 4E0DA 4BWMA 2XGQA 3RH4A 2XY6A 3ISDA 4NLZA 4QZCA 2KTQA 4UAZA 1NK6A 1JIHA 2ZTDA 4ED3A 2W8KA 2KZMA 8ICXA 3L9DA 1L3VA 1V9PA 2DR5A 4B9VA 3V7LA 4YR2A 3JPPA 3MR6A 3V72A 2BQRA 4J9SA 2BCRA 4ZH4A 3SYZA 1Y88A 3AU2A 3NTUA 5KG1A 7ICRA 4RNOA 1NOMA 4Z6DA 2F1HA 1NK0A 1NK4A 4P4MA 5KTQA 2JEFA 1BGXT 5J2FA 3HX0A 3B0YA 5J2AA 3C1ZA 4UBCA 5IINA 4S3NA 2BKEA 4C8MA 4E8FA 4NLGA 9ICXA 4RQ2A 2FLLA 4HYKA 1D9FA 3JPRA 4YFKA 2ZUCA 5DBAA 1SL2A 4FH5A 4IQTA 4X0BA 4J9NA 8ICIA 5CWRA 5BOMA 8ICKA 1RPLA 1TFRA 1ZQLA 2ISPA 3OHAA 4J9KA 5J0PA 4DO9A 1UEUA 1KFTA 2DPJA 2ZH7A 1ZQCA 4ED7A 2BE3A 3PR4A 2V4QA 4YMOA 4O3RA 3ZD8A 4RWQA 2P6RA 4FO6A 7ICIA 5IIKA 7ICEA 4ECYA 3KHGA 1BPBA 4ECUA 3G6YA 1L3UA 4O5EA 3MDCA 3RH6A 5DGBA 4KLSA 7ICTA 3G6XA 1PX5A 4WC2A 2Q0ZX 3BQ2A 1ZQAA 4BXOB 2AGQA 1X2IA 3EWAA 1XSNA 4GXJA 2BQ3A 2MAXA 3B0XA 1S97A 4IG8A 3LWLA 3K4GA 2NRVA 2AQ4A 1ZQBA 1QSLA 3M8RA 4KLHA 5EWEA 2BDPA 4F4KA 4YN4A 1SZPA 4J9LA 3TANA 4DFKA 5HMLA 3V6JA 4WC6A 1UEVA 4UB2A 1ZQSA 4IRCA 5DBCA 3M9OB 3SZ2A 3TI0A 3BQ1A 3ZDDA 1WCLA 3RAXA 3HP6A 3C2LA 4ECQA 1LB2B 3C66A 3JYYA 4O3SA 4UB1A 1XSPA 2IMWP 3PY8A 2HHXA 2A1JA 9ICCA 4UB5A 2XC9A 4PGXA 1KNYA 4FHYA 4E80A 2FPLA 1U47A 3GFKB 3TQ1A 2W8LA 5KT6A 4J9MA 8ICPA 1Z3EB 4KLJA 4F50A 4RPXA 4MFAA 1U45A 7ICKA 5L1JA 3H4DA 4I2BA 4LVSA 4DL6A 4YR3A 4YMNA 1KFDA 4R63A 3MDAA 4I27A 3PX0A 5D4BA 2H5XA 4QZIA 1KEJA 5KG2A 1FA0A 3C2KA 7ICUA 4ECXA 3HJ4A 3SI8A 1NKCA 2ZH1A 3OVAA 3GIMA 5J2CA 4DFJA 1DGSA 4DSLA 4O3QA 4I2AA 3RH5A 2BCUA 1D8YA 4ED6A 4XQ8A 1RYSA 2XCPA 5KFQA 5KFBA 4RU9A 2PXIA 4J9QA 4KLLA 8ICZA 1QSYA 5J2BA 3H37A 4MEYA 1ZQVA 1IXRA 4QWDA 5KFHA 4O3NA 2PFQA 4NY8A 3ETLA 3PX4A 4C8KA 4Q8EA 2KP7A 1VJ7A 4FBUA 4KLDA 8ICBA 4I2CA 3T5KA 2JEGA 2V9WA 3NYBA 3ZDBA 2ASLA 1NK8A 4XUSA 2BCVA 1HUOA 1ZQMA 1ZQGA 2HHQA 7ICLA 5J0XA 2HHPA 5DG8A 5KFJA 5KT2A 2R8KA 3GIIA 9ICAA 4I2IA 1CEZA 3SV4A 2FMQA 3Q8SB 4RPYA 4DF4A 4UQGA 3JPTA 3RRHA 3C5GA 3Q8QB 4F4ZA 3OJSA 3EPGA 5L9XA 3RR7A 4ECRA 1YLQA 3RB0A 4EP7A 5DB7A 4KITB 1ZQJA 3EW9A 3GIKA 1RXWA 7ICSA 4ELUA 4K4GA 4WC4A 3RAQA 3PW7A 2AGOA 5J0YA 2C2DA 4RUAA 5HC9A 2M2UA 1ZQXA 8ICUA 2I1QA 4NLKA 4FHWA 4RQ4A 2IA6A 3IM1A 4WC5A 2ZH3A 4BWJA 3WFPA 3BDPA 4F5QA 1ZQQA 5KFKA 4R64A 5HP4A 4KMUA 5KFNA 8ICJA 7ICPA 1ZQRA 5CP2A 3LDAA 4DLGA 1NJYA 2C28A 5KFXA 5F9LA 4GC7A 4DQRA 1XO1A 1TK8A 1D9DA 3HW8A 2W9BB 2W9BA 3SV3A 3OVSA 1AROP 4ECVA 3H39A 4DQIA 5KG3A 2ASDA 4DQPA 4YXJA 4LZGA 3PW5A 4UD4A 3KHLA 1TFYA 2FPKA 2BGWA 3JPOA 1S0MA 4R65A 4KLUA 3ISBA 3RJFA 2FPMA 3ZDEA 2AJQA 4F5NA 3EZ5A 4O5CA 5TZVA 3T5JA 4KLFA 2M2VA 8ICVA 3PNCA 5KG5A 3M9NB 1T3NA 1UT8A 7ICMA 2ASJA 5J0WA 1JQRA 2ZH6A 4X4NA 2UVUA 4X5VA 1Z00B 4R8UB 1Z00A 4R8UA 4RQ8A 5DLFA 2J6SA 3Q8PB 3MR2A 4ED2A 3WFRE 4M6WB 4M6WA 3RB3A 4DQQA 5IIJA 4QWEA 3MR3A 1QSSA 1L3TA 4RWPA 4JWMA 5F2VO 5DGAA 4PHAA 4C8OA 4IQUA 8ICMA 4WC1A 5IIMA 4EBEA 8ICWA 4IRDA 5J2GA 2ZTCA 5DB6A 1ZQZA 5KFSA 3T5LA 4KLIA 4KN4A 3PX6A 4MFCA 2KZ3A 2KZZA 1KFSA 5J0OA 2PI5A 4Q8FA 4K4HA 3OUYB 3OUYA 1JMSA 5KT5A 2FLNA 4Q43A 4KLGA 3Q8MA 1BVSA 4UB3A 4FS2A 9ICQA 4TQSA 3AQKA 9ICVA 4BXOA 4C8LA 3H40A 2BCSA 4P4OA 3RTVA 4JV1A 2R8JA 3H8WA 5J2JA 5KG6A 2ZJ5A 2W9AA 5IIIA 5J0UA 3TAPA 1ZYQA 2FMPA 1XC9A 5HMMA 2C2RA 1JN3A 2KN7A 2XCAA 2RFFA 2ZH2A 3H7IA 2IBKA 4ELTA 4X4RA 3RJKA 2NRWA 4I28A 4JWNA 2XGPA 8ICSA 1C7YA 3C21A 5HHIA 4I2GA 4JV0A 3FYHA 9ICUA 5J0RA 1NJXA 5J2IA 3UPQA 4B9LA 2KFNA 2AQ0A 4J9PA 3TARA 7ICJA 9ICMA 1ZQKA 1MC8A 2P6UA 4PH5A 3WFQE 1T8EA 1ZETA 4KLOA 4ELVA 2R8HA 4DSIA 5EOZA 8ICGA 7ICVA 1JXEA 2AGPA 5DBBA 1BPDA 3THVA 3HT3A 3V7JA 4ECTA 1V4AA 4RT3A 2DFLA 4O3PA 4FBTA 4DEZA 4E7XA 2BHNA 3BQTA 4JUZA 4I29A 4GLXA 3ISCA 2OWOA 3MR5A 3JPNA 2PFOA 4M0AA 4NM2A 4F5PA 1NJWA 3HIYA 1R8CA 5HRGA 5D46A 3NGDA 2DR9A 4J9RA 5BPCA 5HREA 1DK3A 5KFDA 5DQIA 4NLNA 1VFGA 1UA1A 4BGDA 3C1YA 5KT3A 1SL0A 1TFWA 4DL2A 1NK5A 1ZQHA 2JZBB 4DWIA 2JZBA 7ICGA 4FHPA 3IHQB 1ZQFA 5KFAA 3M8SA 4RWNA 3UQ2A 4RNNA 1ZQTA 5IIOA 3LK9A 3OHBA 8ICRA 4XRHA 4PHPA 2HHSA 4I2EA 5KFZA 4Q44A 3GQCA 1N48A 4RZRA 4X4TA 2C2EA 1T4GA 2VA8A 1HJPA 4QW8A 4QWCA 1RXVA 4UD5A 1ZQOA 4X4QA 8ICOA 2ZH9A 2HVIA 5CHGA 3PMLA 5D49A 4C8NA 2UVWA 2ID1A 4EEYA 4UBBA 1BPEA 2M9NA 5HRFA 4F92B 2HVHA 4YVZA 1B43A 5L1LA 3N97B 2IHNA 2HHTA 4PHEA 3C18A 2DRAA 1TKDA 1NO5A 5L1KA 4DFPA 3ZDAA 4M9JA 9ICBA 5KG4A 1NKBA 4PGYA 2F1IA 2BR0A 2ZH5A 5DQGA 1RZTA 2DPIA 1KLNA 4KTQA 2HHUA 3PW4A 4RQ7A 3JPSA 9ICJA 2B21A 1MIYA 1WOTA 5DEDA 1QLNA 2F1JA 3V6KA 3UQ0A 2V4RA 3QZ7A 9ICWA 5KFTA 5HRLA 4M2YA 5KFWA 4QZ8A 3H8SA 4DSEA 2AU0A 2I9GA 4M47A 3C5FA 4YD2A 4PHDA 3BQ0A 2Q66A 4QZFA 4QZAA 5KFMA 3OJUA 1SL1A 9ICNA 4DS4A 3C2MA 5JUMA 4LZDA 4ED0A 1COOA 9ICKA 4Q45A 4MF2A 2J6UA 2M2TA 4IQWA 5HRKA 3OVBA 5DG9A 2FLPA 4F2RA 3GV7B 4Z6FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I2F A;  4AT9 B;  5CB1 A;  3M9M B;  4AT9 A;  4AT8 A;  5EWF A;  4EZ6 A;  3PO4 A;  2JEI A;  4XA5 A;  2BPG A;  4QWB A;  3QEB Z;  2XY7 A;  1S77 D;  7ICH A;  1IM4 A;  4QZE A;  1K1Q A;  2VA3 A;  4BDP A;  5KFL A;  5KFC A;  4UB4 A;  3PMN A;  4EYI B;  3N4M B;  4F91 B;  2VAN A;  4TUS A;  2BCQ A;  3TAQ A;  1R89 A;  4EBK A;  5DG7 A;  1HUZ A;  1ZJN A;  5DB8 A;  4X4U A;  1LV5 A;  4NXZ A;  4GXK A;  3JPQ A;  3QE9 Y;  3Q8R B;  1ZJM A;  2PBE A;  3WFO A;  9ICG A;  3MFI A;  3E2E A;  8ICF A;  9ICF A;  4XQ7 A;  2DR7 A;  1ZQP A;  1TV9 A;  1RYR A;  4DSF A;  4F93 B;  1U9L A;  4I2J A;  4ECZ A;  4DOB A;  1S0O A;  4ED8 A;  4O5K A;  1BPY A;  4DSK A;  4F3O A;  7ICN A;  3RR8 A;  5DDY A;  2VA2 A;  2PI4 A;  3MFH A;  1MIW A;  4RWO A;  1XS9 D;  1N56 A;  2RDJ A;  5CA7 A;  5DKW A;  1TK5 A;  3TFR A;  4R66 A;  4NKU A;  2PFP A;  2P66 A;  4YR0 A;  4PGQ A;  1KDH A;  5HRD A;  2C22 A;  4WC3 A;  3ORY A;  2HHV A;  3GDX A;  4NM1 A;  5J2H A;  2DVI A;  4YCX A;  4KLM A;  4YP3 A;  4G3I A;  4MEX A;  1MSW D;  2HHW A;  5J2D A;  4FS1 A;  3RBE A;  4X4S A;  4AT8 B;  4F4Y A;  4RPZ A;  1NZP A;  4WBZ A;  2ZH4 A;  3QZ8 A;  2DRB A;  2ZJ8 A;  4I2D A;  3JZ0 A;  4DF8 A;  3GV5 B;  1MIV A;  4YQW A;  3H8J A;  5C5J A;  5KT7 A;  4YXM A;  3PV8 A;  1T7P A;  5KFI A;  3T3F A;  4F2S A;  2BQU A;  4F8R A;  4QW9 A;  2ZHA A;  4GXI A;  4DL7 A;  1L5U A;  2UVV A;  4ECW A;  3V7K A;  3PVX A;  2FMS A;  2GWS A;  4NKT A;  1XSL A;  4RQ6 A;  2Y1I A;  2MUT B;  4DS5 A;  2MUT A;  4UAW A;  4CCH A;  1OU5 A;  1S9F A;  5KFF A;  2NRK A;  5CJ7 A;  5BOL A;  1NK9 A;  4KLT A;  4M9G A;  3UXO A;  5DQH A;  1KSP A;  3KHH A;  2DR8 A;  2JEJ A;  2LYH A;  4WBY A;  4QWA A;  4FHV A;  4B9N A;  5HR9 A;  5F9N A;  3QEA Z;  5J2K A;  4GC6 A;  4TUP A;  7ICO A;  5HNK A;  1DK2 A;  1JAJ A;  5DEC A;  1U49 A;  8ICH A;  4EBJ A;  8ICT A;  5HHH A;  3UXP A;  4QZ9 A;  3HPO A;  1SKS A;  2RDI A;  1Q79 A;  5KG0 A;  4QZH A;  4O0I A;  2ISO A;  4FHX A;  4JV2 A;  1EXN A;  3GIL A;  1QTM A;  3ZDC A;  2ZTE A;  3AU6 A;  2XO7 A;  1TVA A;  4RQ0 A;  1KTQ A;  3GV8 B;  9ICH A;  1S10 A;  4DQS A;  1R8A A;  1CUK A;  5L1I A;  4F4X A;  5KFY A;  4DLE A;  4B9M A;  4K4I A;  4Z6E A;  3KTQ A;  1BNP A;  4YD1 A;  1F5A A;  9ICT A;  3G6V A;  2ATL A;  4Z6C A;  3RJH A;  8ICC A;  1UET A;  2A1J B;  4F5R A;  3RRG A;  4WC7 A;  5IIL A;  3Q8K A;  5KG7 A;  2UVR A;  3PR5 B;  3PW2 A;  1TAU A;  8ICL A;  3AQN A;  1ZQW A;  1PZN A;  1UA0 A;  2ALZ A;  3Q8L A;  1ZQD A;  9ICL A;  4X4O A;  4MFF A;  4M04 A;  4EBC A;  4QZD A;  1B22 A;  5HRI A;  3EYZ A;  4M9N A;  4TUQ A;  2ZUB A;  1MQ2 A;  4WC0 A;  4IRK A;  1S76 D;  2J6T A;  3T5H A;  3LQC B;  4YG2 A;  1L3S A;  4X4V A;  1ZQE A;  1D8L A;  5KFG A;  5CR0 A;  1DOQ A;  4RUC A;  7ICQ A;  1XWL A;  3BJY A;  4JK1 A;  1K1S A;  1ZQY A;  4EBD A;  3PW0 A;  3ZD9 A;  1Q78 A;  4AT7 A;  5DDM A;  5J29 A;  2R8G A;  4IR9 A;  4PPX A;  4AT7 B;  2NRX A;  1TAQ A;  4RQ5 A;  2Y1J A;  3C23 A;  3EPI A;  1R8B A;  2O5A A;  3HJ1 A;  1A77 A;  3OGU A;  1BNO A;  4RQ1 A;  4X4P A;  1SKR A;  1KRP A;  5KT4 A;  4RQ3 A;  1TK0 A;  1BPZ A;  8ICE A;  1JX4 A;  3UXN A;  1XU4 A;  4ECS A;  4IQV A;  5KFO A;  3GIJ A;  3FDS A;  9ICS A;  9ICR A;  4ED1 A;  2PFN A;  4ATB B;  4ATB A;  3AQM A;  2BPF A;  4F5O A;  5HRB A;  1S0N A;  1X9W A;  3HWT A;  5KFR A;  4F4W A;  2XY5 A;  1MQ3 A;  4RNM A;  3RJG A;  3UPS A;  2R8I A;  4B9S A;  4DL3 A;  4EYH B;  4FH3 A;  4I2H A;  4QZG A;  2WTF A;  2IHM A;  2W9C B;  4RT2 A;  2W9C A;  4LT6 A;  4KLQ A;  4DL5 A;  3AQL A;  5J0S A;  4KLE A;  5J0Q A;  1UT5 A;  3RB4 A;  2KFZ A;  4J9O A;  8ICY A;  3MGH A;  3H38 A;  4P4P A;  4DL4 A;  4KN7 A;  3RJI A;  1H38 A;  3TFS A;  4X0A A;  1X9M A;  1S0V A;  2M2W A;  2ZHB A;  4B9T A;  4YMM A;  2W9M A;  3MGI A;  8ICQ A;  3MAB A;  1A76 A;  3RBD A;  2HW3 A;  9ICP A;  4M5D A;  3KHR A;  1BPX A;  4TQR A;  9ICE A;  5KFE A;  3PO5 A;  8ICN A;  5DLG A;  4UAY A;  9ICO A;  2NRZ A;  4WCW A;  8ICA A;  5HRH A;  3MBY A;  5KFV A;  3RB6 A;  1U4B A;  4QZB A;  1JXL A;  4B9U A;  4DSJ A;  4IR1 A;  2ZJA A;  7ICF A;  2ZH8 A;  5KFU A;  1ZQI A;  3K75 D;  1NKE A;  2ZUD A;  9ICI A;  1SKW A;  3H4B A;  3OV7 A;  4M9L A;  4DFM A;  5EWG A;  1WCN A;  2NRT A;  5DB9 A;  5J2E A;  4O9M A;  4M9H A;  1NJZ A;  5KFP A;  3RJJ A;  4P2H A;  4TUR A;  1ZQN A;  2O1P A;  3WFS C;  1NK7 A;  4O3O A;  3LWM A;  4DOC A;  1U48 A;  4EZ9 A;  5J0T A;  4MF8 A;  3OSP A;  3V6H A;  3H3A A;  4DOA A;  1ZQU A;  1X9S A;  2BPC A;  3OSN A;  3RJE A;  3AUO A;  4E0D A;  4BWM A;  2XGQ A;  3RH4 A;  2XY6 A;  3ISD A;  4NLZ A;  4QZC A;  2KTQ A;  4UAZ A;  1NK6 A;  1JIH A;  2ZTD A;  4ED3 A;  2W8K A;  2KZM A;  8ICX A;  3L9D A;  1L3V A;  1V9P A;  2DR5 A;  4B9V A;  3V7L A;  4YR2 A;  3JPP A;  3MR6 A;  3V72 A;  2BQR A;  4J9S A;  2BCR A;  4ZH4 A;  3SYZ A;  1Y88 A;  3AU2 A;  3NTU A;  5KG1 A;  7ICR A;  4RNO A;  1NOM A;  4Z6D A;  2F1H A;  1NK0 A;  1NK4 A;  4P4M A;  5KTQ A;  2JEF A;  1BGX T;  5J2F A;  3HX0 A;  3B0Y A;  5J2A A;  3C1Z A;  4UBC A;  5IIN A;  4S3N A;  2BKE A;  4C8M A;  4E8F A;  4NLG A;  9ICX A;  4RQ2 A;  2FLL A;  4HYK A;  1D9F A;  3JPR A;  4YFK A;  2ZUC A;  5DBA A;  1SL2 A;  4FH5 A;  4IQT A;  4X0B A;  4J9N A;  8ICI A;  5CWR A;  5BOM A;  8ICK A;  1RPL A;  1TFR A;  1ZQL A;  2ISP A;  3OHA A;  4J9K A;  5J0P A;  4DO9 A;  1UEU A;  1KFT A;  2DPJ A;  2ZH7 A;  1ZQC A;  4ED7 A;  2BE3 A;  3PR4 A;  2V4Q A;  4YMO A;  4O3R A;  3ZD8 A;  4RWQ A;  2P6R A;  4FO6 A;  7ICI A;  5IIK A;  7ICE A;  4ECY A;  3KHG A;  1BPB A;  4ECU A;  3G6Y A;  1L3U A;  4O5E A;  3MDC A;  3RH6 A;  5DGB A;  4KLS A;  7ICT A;  3G6X A;  1PX5 A;  4WC2 A;  2Q0Z X;  3BQ2 A;  1ZQA A;  4BXO B;  2AGQ A;  1X2I A;  3EWA A;  1XSN A;  4GXJ A;  2BQ3 A;  2MAX A;  3B0X A;  1S97 A;  4IG8 A;  3LWL A;  3K4G A;  2NRV A;  2AQ4 A;  1ZQB A;  1QSL A;  3M8R A;  4KLH A;  5EWE A;  2BDP A;  4F4K A;  4YN4 A;  1SZP A;  4J9L A;  3TAN A;  4DFK A;  5HML A;  3V6J A;  4WC6 A;  1UEV A;  4UB2 A;  1ZQS A;  4IRC A;  5DBC A;  3M9O B;  3SZ2 A;  3TI0 A;  3BQ1 A;  3ZDD A;  1WCL A;  3RAX A;  3HP6 A;  3C2L A;  4ECQ A;  1LB2 B;  3C66 A;  3JYY A;  4O3S A;  4UB1 A;  1XSP A;  2IMW P;  3PY8 A;  2HHX A;  2A1J A;  9ICC A;  4UB5 A;  2XC9 A;  4PGX A;  1KNY A;  4FHY A;  4E80 A;  2FPL A;  1U47 A;  3GFK B;  3TQ1 A;  2W8L A;  5KT6 A;  4J9M A;  8ICP A;  1Z3E B;  4KLJ A;  4F50 A;  4RPX A;  4MFA A;  1U45 A;  7ICK A;  5L1J A;  3H4D A;  4I2B A;  4LVS A;  4DL6 A;  4YR3 A;  4YMN A;  1KFD A;  4R63 A;  3MDA A;  4I27 A;  3PX0 A;  5D4B A;  2H5X A;  4QZI A;  1KEJ A;  5KG2 A;  1FA0 A;  3C2K A;  7ICU A;  4ECX A;  3HJ4 A;  3SI8 A;  1NKC A;  2ZH1 A;  3OVA A;  3GIM A;  5J2C A;  4DFJ A;  1DGS A;  4DSL A;  4O3Q A;  4I2A A;  3RH5 A;  2BCU A;  1D8Y A;  4ED6 A;  4XQ8 A;  1RYS A;  2XCP A;  5KFQ A;  5KFB A;  4RU9 A;  2PXI A;  4J9Q A;  4KLL A;  8ICZ A;  1QSY A;  5J2B A;  3H37 A;  4MEY A;  1ZQV A;  1IXR A;  4QWD A;  5KFH A;  4O3N A;  2PFQ A;  4NY8 A;  3ETL A;  3PX4 A;  4C8K A;  4Q8E A;  2KP7 A;  1VJ7 A;  4FBU A;  4KLD A;  8ICB A;  4I2C A;  3T5K A;  2JEG A;  2V9W A;  3NYB A;  3ZDB A;  2ASL A;  1NK8 A;  4XUS A;  2BCV A;  1HUO A;  1ZQM A;  1ZQG A;  2HHQ A;  7ICL A;  5J0X A;  2HHP A;  5DG8 A;  5KFJ A;  5KT2 A;  2R8K A;  3GII A;  9ICA A;  4I2I A;  1CEZ A;  3SV4 A;  2FMQ A;  3Q8S B;  4RPY A;  4DF4 A;  4UQG A;  3JPT A;  3RRH A;  3C5G A;  3Q8Q B;  4F4Z A;  3OJS A;  3EPG A;  5L9X A;  3RR7 A;  4ECR A;  1YLQ A;  3RB0 A;  4EP7 A;  5DB7 A;  4KIT B;  1ZQJ A;  3EW9 A;  3GIK A;  1RXW A;  7ICS A;  4ELU A;  4K4G A;  4WC4 A;  3RAQ A;  3PW7 A;  2AGO A;  5J0Y A;  2C2D A;  4RUA A;  5HC9 A;  2M2U A;  1ZQX A;  8ICU A;  2I1Q A;  4NLK A;  4FHW A;  4RQ4 A;  2IA6 A;  3IM1 A;  4WC5 A;  2ZH3 A;  4BWJ A;  3WFP A;  3BDP A;  4F5Q A;  1ZQQ A;  5KFK A;  4R64 A;  5HP4 A;  4KMU A;  5KFN A;  8ICJ A;  7ICP A;  1ZQR A;  5CP2 A;  3LDA A;  4DLG A;  1NJY A;  2C28 A;  5KFX A;  5F9L A;  4GC7 A;  4DQR A;  1XO1 A;  1TK8 A;  1D9D A;  3HW8 A;  2W9B B;  2W9B A;  3SV3 A;  3OVS A;  1ARO P;  4ECV A;  3H39 A;  4DQI A;  5KG3 A;  2ASD A;  4DQP A;  4YXJ A;  4LZG A;  3PW5 A;  4UD4 A;  3KHL A;  1TFY A;  2FPK A;  2BGW A;  3JPO A;  1S0M A;  4R65 A;  4KLU A;  3ISB A;  3RJF A;  2FPM A;  3ZDE A;  2AJQ A;  4F5N A;  3EZ5 A;  4O5C A;  5TZV A;  3T5J A;  4KLF A;  2M2V A;  8ICV A;  3PNC A;  5KG5 A;  3M9N B;  1T3N A;  1UT8 A;  7ICM A;  2ASJ A;  5J0W A;  1JQR A;  2ZH6 A;  4X4N A;  2UVU A;  4X5V A;  1Z00 B;  4R8U B;  1Z00 A;  4R8U A;  4RQ8 A;  5DLF A;  2J6S A;  3Q8P B;  3MR2 A;  4ED2 A;  3WFR E;  4M6W B;  4M6W A;  3RB3 A;  4DQQ A;  5IIJ A;  4QWE A;  3MR3 A;  1QSS A;  1L3T A;  4RWP A;  4JWM A;  5F2V O;  5DGA A;  4PHA A;  4C8O A;  4IQU A;  8ICM A;  4WC1 A;  5IIM A;  4EBE A;  8ICW A;  4IRD A;  5J2G A;  2ZTC A;  5DB6 A;  1ZQZ A;  5KFS A;  3T5L A;  4KLI A;  4KN4 A;  3PX6 A;  4MFC A;  2KZ3 A;  2KZZ A;  1KFS A;  5J0O A;  2PI5 A;  4Q8F A;  4K4H A;  3OUY B;  3OUY A;  1JMS A;  5KT5 A;  2FLN A;  4Q43 A;  4KLG A;  3Q8M A;  1BVS A;  4UB3 A;  4FS2 A;  9ICQ A;  4TQS A;  3AQK A;  9ICV A;  4BXO A;  4C8L A;  3H40 A;  2BCS A;  4P4O A;  3RTV A;  4JV1 A;  2R8J A;  3H8W A;  5J2J A;  5KG6 A;  2ZJ5 A;  2W9A A;  5III A;  5J0U A;  3TAP A;  1ZYQ A;  2FMP A;  1XC9 A;  5HMM A;  2C2R A;  1JN3 A;  2KN7 A;  2XCA A;  2RFF A;  2ZH2 A;  3H7I A;  2IBK A;  4ELT A;  4X4R A;  3RJK A;  2NRW A;  4I28 A;  4JWN A;  2XGP A;  8ICS A;  1C7Y A;  3C21 A;  5HHI A;  4I2G A;  4JV0 A;  3FYH A;  9ICU A;  5J0R A;  1NJX A;  5J2I A;  3UPQ A;  4B9L A;  2KFN A;  2AQ0 A;  4J9P A;  3TAR A;  7ICJ A;  9ICM A;  1ZQK A;  1MC8 A;  2P6U A;  4PH5 A;  3WFQ E;  1T8E A;  1ZET A;  4KLO A;  4ELV A;  2R8H A;  4DSI A;  5EOZ A;  8ICG A;  7ICV A;  1JXE A;  2AGP A;  5DBB A;  1BPD A;  3THV A;  3HT3 A;  3V7J A;  4ECT A;  1V4A A;  4RT3 A;  2DFL A;  4O3P A;  4FBT A;  4DEZ A;  4E7X A;  2BHN A;  3BQT A;  4JUZ A;  4I29 A;  4GLX A;  3ISC A;  2OWO A;  3MR5 A;  3JPN A;  2PFO A;  4M0A A;  4NM2 A;  4F5P A;  1NJW A;  3HIY A;  1R8C A;  5HRG A;  5D46 A;  3NGD A;  2DR9 A;  4J9R A;  5BPC A;  5HRE A;  1DK3 A;  5KFD A;  5DQI A;  4NLN A;  1VFG A;  1UA1 A;  4BGD A;  3C1Y A;  5KT3 A;  1SL0 A;  1TFW A;  4DL2 A;  1NK5 A;  1ZQH A;  2JZB B;  4DWI A;  2JZB A;  7ICG A;  4FHP A;  3IHQ B;  1ZQF A;  5KFA A;  3M8S A;  4RWN A;  3UQ2 A;  4RNN A;  1ZQT A;  5IIO A;  3LK9 A;  3OHB A;  8ICR A;  4XRH A;  4PHP A;  2HHS A;  4I2E A;  5KFZ A;  4Q44 A;  3GQC A;  1N48 A;  4RZR A;  4X4T A;  2C2E A;  1T4G A;  2VA8 A;  1HJP A;  4QW8 A;  4QWC A;  1RXV A;  4UD5 A;  1ZQO A;  4X4Q A;  8ICO A;  2ZH9 A;  2HVI A;  5CHG A;  3PML A;  5D49 A;  4C8N A;  2UVW A;  2ID1 A;  4EEY A;  4UBB A;  1BPE A;  2M9N A;  5HRF A;  4F92 B;  2HVH A;  4YVZ A;  1B43 A;  5L1L A;  3N97 B;  2IHN A;  2HHT A;  4PHE A;  3C18 A;  2DRA A;  1TKD A;  1NO5 A;  5L1K A;  4DFP A;  3ZDA A;  4M9J A;  9ICB A;  5KG4 A;  1NKB A;  4PGY A;  2F1I A;  2BR0 A;  2ZH5 A;  5DQG A;  1RZT A;  2DPI A;  1KLN A;  4KTQ A;  2HHU A;  3PW4 A;  4RQ7 A;  3JPS A;  9ICJ A;  2B21 A;  1MIY A;  1WOT A;  5DED A;  1QLN A;  2F1J A;  3V6K A;  3UQ0 A;  2V4R A;  3QZ7 A;  9ICW A;  5KFT A;  5HRL A;  4M2Y A;  5KFW A;  4QZ8 A;  3H8S A;  4DSE A;  2AU0 A;  2I9G A;  4M47 A;  3C5F A;  4YD2 A;  4PHD A;  3BQ0 A;  2Q66 A;  4QZF A;  4QZA A;  5KFM A;  3OJU A;  1SL1 A;  9ICN A;  4DS4 A;  3C2M A;  5JUM A;  4LZD A;  4ED0 A;  1COO A;  9ICK A;  4Q45 A;  4MF2 A;  2J6U A;  2M2T A;  4IQW A;  5HRK A;  3OVB A;  5DG9 A;  2FLP A;  4F2R A;  3GV7 B;  4Z6F A; 
#chains in the Genus database with same CATH topology
 3KOO A;  3PO4 A;  4QWB A;  4NLB A;  3BS7 A;  4U6P A;  2XY7 A;  2IUB A;  4QZE A;  2VA3 A;  2YB4 A;  5KFC A;  4UB4 A;  1PVQ A;  4EBK A;  4TUS A;  4X4U A;  1LV5 A;  2F3N A;  4NXZ A;  5KL1 B;  1ZQP A;  4O5K A;  3J81 j;  1UPH A;  2VA2 A;  1V97 A;  3MFH A;  3N28 A;  1XS9 D;  2K60 A;  1N56 A;  4R66 A;  2YTU A;  1KDH A;  3ORY A;  5J2H A;  4WJ3 B;  4YP3 A;  4K98 A;  4X4S A;  2XI9 A;  1WWU A;  3QZ8 A;  2ZJ8 A;  4AYB C;  1MIV A;  2KIW A;  3WKA A;  3H8J A;  4YXM A;  4F8R A;  3OPX A;  2UVV A;  1L5U A;  1QCK A;  4ECW A;  2Y1I A;  1N5W A;  4DS5 A;  1S9F A;  5BOL A;  5ALG A;  2DR8 A;  4FZL A;  2LYH A;  4FHV A;  4B9N A;  5HR9 A;  5J2K A;  4GC6 A;  7ICO A;  2KOB A;  5HNK A;  1JAJ A;  1U49 A;  5HHH A;  4QZ9 A;  1L8L A;  2EAP A;  4QZH A;  4O0I A;  4FHX A;  2WAQ F;  1QTM A;  3ZDC A;  4EEB A;  2ZTE A;  4DQS A;  4DLE A;  1F5A A;  3KTQ A;  3RJH A;  2M0N A;  5AKJ A;  4UAV A;  4WC7 A;  5IIL A;  8ICL A;  3AQN A;  2LM1 A;  3PR5 B;  1ZQW A;  3BZC A;  1ZQD A;  9ICL A;  4X4O A;  4MFF A;  3E58 A;  5HRI A;  1URJ A;  4IC9 A;  3SEN A;  2G5H B;  1S76 D;  3SD7 A;  1IV8 A;  4YG2 A;  1D8L A;  5KFG A;  1DOQ A;  7ICQ A;  5AHX A;  1FEZ A;  4EBD A;  3VC8 A;  2AHO B;  4PPX A;  2NRX A;  2Y1J A;  3EPI A;  4UB8 U;  5GTH U;  1KL9 A;  1TK0 A;  1BPZ A;  5AKH A;  1XU4 A;  4IL6 U;  3ZI4 A;  5HRB A;  4F5O A;  3HWT A;  3UPS A;  4CRX A;  2XID A;  3KBB A;  4I2H A;  4QZG A;  2W9C B;  4LT6 A;  3TKA A;  4KLE A;  5J0Q A;  2KFZ A;  8ICY A;  3MGH A;  2BZF A;  1H38 A;  3TFS A;  4X0A A;  3VCB A;  1S0V A;  2M2W A;  2JMG A;  4YMM A;  2W9M A;  3MGI A;  8ICQ A;  9ICP A;  4OD0 A;  4TQR A;  5KFE A;  4WCW A;  8ICA A;  3MBY A;  1JXL A;  3WU2 U;  7ICF A;  3K75 D;  4NXT A;  1CRX A;  3L4P A;  4DFM A;  4FFD A;  5L1M A;  2LYB A;  2CN1 A;  3BS5 B;  4O9M A;  2E3T A;  4M9H A;  2VIX A;  2B6G A;  2WHE A;  1SXE A;  2LPE A;  3C28 A;  5ALV A;  4E0D A;  2RHF A;  4QZC A;  2KZM A;  4NJ8 A;  8ICX A;  1Y88 A;  2LYA A;  2E5S A;  2ODG A;  5ALQ A;  4RNO A;  3KZX A;  1T94 A;  2E8M A;  1NK0 A;  4P4M A;  3HIL A;  4S3N A;  3MCR A;  4C4S A;  3UMG A;  4RQ2 A;  3JPR A;  4HAI A;  2ZUC A;  4C4T A;  4FH5 A;  4IQT A;  5BOM A;  4C7Y A;  1TFR A;  2ZH7 A;  4J9K A;  4DO9 A;  2ZIU B;  1ZQC A;  2QAR A;  3SAG A;  2V4Q A;  4YMO A;  3AEV A;  4RWQ A;  3I28 A;  4FO6 A;  2D3D A;  5IIK A;  4UAR A;  7ICT A;  4WC2 A;  1PK3 A;  4BXO B;  1X2I A;  5AI0 A;  3B0X A;  4IG8 A;  2AQ4 A;  3NVV A;  2W11 A;  2G06 A;  3H0L B;  4KLH A;  4F4K A;  4YN4 A;  4DFK A;  5HML A;  2W7P A;  1MN8 A;  2YN4 A;  4UB2 A;  4IRC A;  3F53 A;  3TI0 A;  3RAX A;  2EAO A;  4ECQ A;  1LB2 B;  2DKX A;  4UB1 A;  2IMW P;  2HHX A;  4PGX A;  5ALK A;  4DCC A;  2B56 A;  2KIC A;  1U45 A;  4I2B A;  2FDR A;  2F8K A;  4ECX A;  1NKC A;  4Y2J A;  3F2C A;  2BCU A;  4KLL A;  8ICZ A;  2XCP A;  4O6A A;  4OJP A;  4NLC A;  1NZB A;  1IXR A;  2B0C A;  3ED5 A;  2K4I A;  4O3N A;  4NY8 A;  4Q8E A;  4C8K A;  2KK0 A;  4I2C A;  3LVV A;  5ALP A;  3NYB A;  7ICL A;  1ZQM A;  1ZQG A;  5J0X A;  4EED A;  2R8K A;  9ICA A;  4I2I A;  1CEZ A;  2H3V A;  1SB3 C;  4RPY A;  3QU2 A;  4FE3 A;  5L9X A;  2JH7 A;  3EW9 A;  2WF6 A;  3RAQ A;  2AGO A;  5J0Y A;  2C2D A;  4RUA A;  2Y0S F;  8ICU A;  2I1Q A;  1SGG A;  4RQ4 A;  3IM1 A;  1L7P A;  4DFD A;  5KFK A;  4R64 A;  4KMU A;  4QJF B;  7ICP A;  2NV3 A;  5CP2 A;  2W9B B;  3SV3 A;  4DQI A;  3NWI A;  2ZG6 A;  5ALD A;  2EH9 A;  4QNL A;  4YXJ A;  2QKQ A;  4LZG A;  3T79 A;  4OO1 J;  2FPK A;  4PZO A;  2F8L A;  1S0M A;  4R65 A;  1B4F A;  4Y2Y A;  2FPM A;  5AM1 A;  3EZ5 A;  2HI0 A;  2IOF K;  1HEK A;  2OXO A;  3WK9 A;  3M9N B;  2GAF D;  2ZH6 A;  1Z00 A;  4R8U A;  1SZH A;  4ED2 A;  4KX5 A;  3SMV A;  4NWI A;  4M6W B;  2DQN B;  4RWP A;  1LVH A;  1YZ7 A;  4P0Q B;  8ICM A;  2DKZ A;  5J2G A;  2ZTC A;  5DB6 A;  1ZQZ A;  4KLI A;  3PX6 A;  2KZ3 A;  1O03 A;  3KFU F;  5J0O A;  2PI5 A;  1HIW A;  3OUY B;  5KT5 A;  2FLN A;  3SEI A;  4UB3 A;  1MA7 A;  4JV1 A;  1DK2 A;  4OJ6 A;  5KG6 A;  9ICK A;  3TAP A;  2QLT A;  1XC9 A;  2RFF A;  2KN7 A;  3UM9 A;  2NRW A;  3BZK A;  5J0R A;  1NJX A;  5J2I A;  4B9L A;  3TAR A;  1ZQK A;  1MC8 A;  4PH5 A;  3WFQ E;  3WKB A;  8ICG A;  3CYM A;  4C80 A;  5DBB A;  3HT3 A;  5AKI A;  4OAI Z;  4DEZ A;  3ISC A;  4NM2 A;  4KB6 A;  3HKZ F;  1TFW A;  1UA1 A;  2JZB B;  3H0R B;  2FJ6 A;  1Z4N A;  4Q44 A;  4O67 A;  4RZR A;  3NVO A;  2C2E A;  4UD5 A;  3IV6 A;  8ICO A;  4GIB A;  5D49 A;  4C8N A;  2ID1 A;  4EEY A;  5HRF A;  4F92 B;  2HVH A;  3C18 A;  3IN5 A;  1XO0 A;  4O3M A;  5DQG A;  1MIY A;  2B21 A;  1QLN A;  3V6K A;  2V4R A;  5KAI U;  3QZ7 A;  4YD2 A;  3WK6 A;  1D8B A;  4PL1 A;  4QZA A;  3I1Y A;  2YX8 A;  4LZD A;  4ED0 A;  4IQW A;  4WQK A;  2FLP A;  3V72 A;  2BCQ A;  4I2F A;  4AT9 B;  1N62 A;  4AT8 A;  3QEB Z;  4N7R A;  1RM6 C;  2CXY A;  2LI6 A;  2GLE A;  2VKQ A;  2HDO A;  1OW5 A;  5DG7 A;  3N7P D;  2PBE A;  3Q8R B;  2ZIV B;  9ICG A;  3MFI A;  1TV9 A;  4DSF A;  2N1R A;  1J2N A;  2YY6 A;  4DOB A;  5F3X B;  1BPY A;  4DSK A;  4F3O A;  1MIW A;  2PI4 A;  1TK5 A;  5DKW A;  5AI9 A;  1RYU A;  1Q46 A;  4YR0 A;  5HRD A;  4WC3 A;  1NNL A;  3SAH A;  2HHV A;  4YCX A;  4KLM A;  1MSW D;  3RBE A;  3N7R C;  1NZP A;  2ZH4 A;  1V85 A;  4AP9 A;  2DRB A;  3NVY A;  4I2D A;  3GV5 B;  4F2S A;  1RG6 A;  2BQU A;  1F0M A;  4QW9 A;  3SQI A;  2DL0 A;  2ZIX B;  3AMZ A;  1X9X A;  2GWS A;  3NVW A;  4RQ6 A;  2MUT A;  4UAW A;  2DWQ A;  1OU5 A;  4ZOH C;  3NAS A;  3UXO A;  1SV0 C;  5DQH A;  1KSP A;  1ED1 A;  2GOL A;  4WBY A;  1P7D A;  2H3F A;  4TUP A;  8ICH A;  8ICT A;  3HPO A;  1SKS A;  5D62 A;  2RDI A;  1Q79 A;  5AIC A;  2QB0 B;  3AU6 A;  2XO7 A;  3QUQ A;  1KTQ A;  3GV8 B;  2Y9T A;  5L1I A;  4F4X A;  5KFY A;  4EP7 A;  5ALE A;  1N60 A;  1BNP A;  2KHV A;  3SAF A;  4F5R A;  2UVR A;  1ZRN A;  3PW2 A;  5AK5 A;  1PZN A;  2ALZ A;  2HOQ A;  4M04 A;  4QZD A;  2O6K A;  1SWV A;  1DXS A;  3T5H A;  2W3S A;  4X4V A;  1XWL A;  3BJY A;  1K1S A;  1ZQY A;  2K4P A;  4AT7 B;  4IR9 A;  4RQ5 A;  1R8B A;  2O5A A;  1BNO A;  2KKV A;  5EE9 A;  5KT4 A;  1L7N A;  2B51 A;  2W43 A;  1JX4 A;  4ECS A;  4IQV A;  5KFO A;  3OTQ A;  4ATB B;  2ZXH A;  1MQ3 A;  1X9W A;  2HN2 A;  5KFR A;  2XY5 A;  3RJG A;  2R8I A;  3TAC B;  2WTF A;  2IHM A;  4RT2 A;  4KLQ A;  4DL5 A;  4Y2V A;  4J9O A;  1FIQ A;  3EF2 A;  1TE2 A;  2ZHB A;  4B9T A;  1A76 A;  2HW3 A;  3KHR A;  9ICE A;  3PO5 A;  9ICO A;  5DLG A;  4UAY A;  2GA9 D;  4IR1 A;  4B9U A;  2ZH8 A;  1U4B A;  2ZJA A;  5KFU A;  2G0A A;  1WG8 A;  3F2D A;  4LEV A;  2ZUD A;  5J2E A;  4UB6 U;  3H0M B;  5KFP A;  4O3O A;  3OSP A;  5EE0 A;  3WKD A;  3RJE A;  1X9S A;  2XGQ A;  2FCL A;  3K1Z A;  4NLZ A;  5JTG A;  3QUB A;  4C4R A;  1JIH A;  2ZTD A;  2W8K A;  1L3V A;  4EGW A;  4B9V A;  2BQR A;  3JPP A;  4J9S A;  2BCR A;  2K8C B;  3AU2 A;  2MU2 A;  4Z6D A;  3U26 A;  3HX0 A;  2BKE A;  2KG5 A;  1X66 A;  4E8F A;  4NLG A;  1VDV A;  4PL2 A;  4YFK A;  3HRD D;  5DBA A;  1PK1 A;  3KD3 A;  4J9N A;  2ZXI A;  1RPL A;  1ZQL A;  2ESE A;  3PR4 A;  3ZD8 A;  2PMZ F;  7ICI A;  2EAN A;  4QIW C;  1BPB A;  4O5E A;  4KLS A;  3RH6 A;  2Q0Z X;  3QU9 A;  2VJ5 A;  2EZY A;  1XSN A;  4GXJ A;  3TAD C;  3M8R A;  5EWE A;  1SZP A;  4J9L A;  3TAN A;  4UW9 A;  3SZ2 A;  2EDU A;  3BQ1 A;  1WCL A;  3HP6 A;  3PY8 A;  1KNY A;  2A1J A;  4FHY A;  4LJX A;  3WK7 A;  3TQ1 A;  2KKP A;  4MFA A;  3H4D A;  3QUC A;  4YR3 A;  1K5O A;  4YMN A;  1KFD A;  5AKY A;  1Z4O A;  4LEZ A;  3PX0 A;  4QZI A;  1FA0 A;  7ICU A;  3AQF A;  2ZH1 A;  3QNM A;  3OVA A;  5J2C A;  1DGS A;  4I2A A;  1RYS A;  4RU9 A;  2PXI A;  1ZXI A;  3LYS A;  5J2B A;  4NL9 C;  4RQM A;  4QWD A;  2A3V A;  3ETL A;  3PX4 A;  1GPJ A;  8ICB A;  3ZDB A;  1NK8 A;  2HHP A;  2XVT A;  3SV4 A;  3JPT A;  3Q8Q B;  4F4Z A;  3RR7 A;  1YLQ A;  5C0Y A;  2KHQ A;  3WK4 A;  2W55 A;  3GIK A;  4K4G A;  2KIV A;  3WKE A;  5HC9 A;  2M2U A;  3FM9 A;  2OH2 A;  5ALF A;  3NUQ A;  2OHF A;  5KFN A;  1UCV A;  1ZQR A;  2B4V A;  3LDA A;  2C28 A;  1S5L U;  4EEL A;  1XO1 A;  4ICA A;  3HW8 A;  2JR5 A;  2IHO A;  3M6K A;  4EEN A;  2RRD A;  3H39 A;  1XNS A;  2OYY A;  1SIJ A;  5KG3 A;  4HX0 A;  3PW5 A;  2BGW A;  3JPO A;  1ZOL A;  4KLU A;  3ISB A;  2AJQ A;  4F5N A;  4KLF A;  1FFU A;  2UVU A;  3Q8P B;  5AKG A;  3RB3 A;  3IDW A;  1QSS A;  1PVP A;  2F77 X;  4IS7 A;  5G5H A;  2OCE A;  2KZZ A;  3GU3 A;  3F5A A;  1KFS A;  4F72 A;  3L3F X;  3I76 A;  1JMS A;  4Y2Q A;  3UMB A;  4EX7 A;  4KLG A;  2GO7 A;  1BVS A;  4LEY A;  4C8L A;  3H40 A;  2BCS A;  4P4O A;  3RTV A;  2W9A A;  1ZYQ A;  2ZIW B;  2ZH2 A;  2EZZ A;  4NV0 A;  1ZD4 A;  4ELT A;  2HSZ A;  3RJK A;  4I28 A;  4CDG A;  4Y2R A;  1LKY B;  4I2G A;  4JV0 A;  9ICU A;  3ER9 B;  2P6U A;  4WOY A;  2HMX A;  4AYB F;  4DSI A;  5JU5 A;  2AGP A;  1BPD A;  5HR7 A;  2AXT U;  3V7J A;  4ECT A;  1V4A A;  3E0F A;  1JI7 A;  1NI3 A;  2BHN A;  3BQT A;  2KSO A;  4GLX A;  3MR5 A;  4F5P A;  5HRG A;  2DR9 A;  4J9R A;  2YML A;  4UAS A;  2K8B B;  5KFD A;  5DQI A;  4NLN A;  1SL0 A;  2F44 A;  4BGD A;  2IOF A;  2K4E A;  4DL2 A;  4QIW F;  4FHP A;  5ALL A;  5KFA A;  4RWN A;  3UQ2 A;  4RNN A;  8ICR A;  4XRH A;  4PHP A;  1T4G A;  4QW8 A;  1RXV A;  2BBH A;  1ZQO A;  4X4Q A;  1QQ7 A;  5CHG A;  3B9J A;  2UVW A;  1PUZ A;  4UBB A;  2M9N A;  2K8A A;  2HHT A;  5H2F U;  4PHE A;  2DRA A;  1NO5 A;  5L1K A;  5AI4 A;  5KG4 A;  4PGY A;  5J8Y C;  4OJ5 A;  1KLN A;  2JXJ A;  1L7O A;  5AM3 A;  2F1J A;  2EAM A;  3UQ0 A;  5HRL A;  4M2Y A;  5KFW A;  3ETR A;  5CHE A;  2AU0 A;  4PHD A;  2Q66 A;  5ALS A;  1SL1 A;  4DS4 A;  5ALR A;  4MF2 A;  2GH1 A;  1ZRM A;  4U7C A;  4RQN A;  5KNI A;  5HRK A;  4Z6F A;  4OJL A;  5CB1 A;  2DBY A;  4EZ6 A;  2JEI A;  4UAU A;  4USA A;  1S77 D;  4Y2P A;  7ICH A;  1IM4 A;  4BDP A;  3D2S A;  4J03 A;  5KL8 B;  3N4M B;  1R89 A;  2VAN A;  1YZ6 A;  3TAQ A;  1HUZ A;  1QH9 A;  1ZJN A;  5ALN A;  5A0L A;  4GXK A;  3QE9 Y;  1ZJM A;  3E2E A;  8ICF A;  4XQ7 A;  5ALZ A;  1U9L A;  2G07 A;  3QUT A;  4ECZ A;  1S0O A;  4ED8 A;  7ICN A;  5DDY A;  2KVS A;  3CNH A;  5K4L A;  4RWO A;  2RDJ A;  4GFJ A;  4PGQ A;  3WK8 A;  2IOH A;  2DVI A;  3GDX A;  4NM1 A;  1CI4 A;  4G3I A;  5ALI A;  2HHW A;  3CRX A;  2G08 A;  3ER8 C;  2WB1 C;  3AN1 A;  4YQW A;  5C5J A;  3PV8 A;  2ZHA A;  4GXI A;  4DL7 A;  2FMS A;  2DGZ A;  4NKT A;  2Z7J A;  1NK9 A;  4KLT A;  2WF9 A;  4QWA A;  3DV9 A;  5F9N A;  4MKP A;  5DEC A;  4EBJ A;  5AK3 A;  3UXP A;  4JV2 A;  5ALX A;  5ALU A;  1EXN A;  3GIL A;  1VJ5 A;  1TVA A;  4RQ0 A;  9ICH A;  1S10 A;  2LKY A;  4CF4 A;  4K4I A;  3G6V A;  4Z6C A;  1UET A;  2A1J B;  1F44 A;  2F2A B;  2KV2 A;  5AKL A;  4A8E A;  3Q8L A;  4EBC A;  4M9N A;  3IG5 A;  4TUQ A;  4WC0 A;  5AKK A;  3LQC B;  1L3S A;  5CR0 A;  4RUC A;  4JK1 A;  3PW0 A;  3ZD9 A;  2R8G A;  1TAQ A;  2RQ5 A;  3HJ1 A;  1S8O A;  5AM2 A;  4RQ1 A;  4X4P A;  2LBO A;  2KJ8 A;  8ICE A;  1A0P A;  2EZX A;  9ICS A;  1C20 A;  4BUG A;  5ALM A;  3AQM A;  4F4W A;  4RNM A;  4B9S A;  1ZD2 P;  4DL3 A;  2KJ9 A;  1J2M A;  2W9C A;  3C29 A;  5J0S A;  3H38 A;  1UT5 A;  4P4P A;  4DL4 A;  2D8C A;  2HBL A;  2OM6 A;  3MAB A;  4M5D A;  2E8N A;  3PST A;  5AI6 A;  8ICN A;  2NRZ A;  4OAG A;  1ZQI A;  9ICI A;  2HBJ A;  4KM5 A;  2LMR A;  3IG8 A;  5AIA A;  1SKW A;  3DDH A;  3R9K A;  4OAH A;  4NXV A;  4JLX A;  1OXJ A;  2NRT A;  5DB9 A;  2HOI A;  3RJJ A;  4P2H A;  4TUR A;  3WFS C;  2MRL A;  4DOC A;  1U48 A;  4EZ9 A;  2HN1 A;  4DOA A;  4G9B A;  1ZQU A;  2BPC A;  4WQL A;  4BWM A;  5AM5 A;  2XY6 A;  3A0H U;  5AK6 A;  4PJ0 U;  1ZD3 A;  1UQV A;  3MR6 A;  2FE9 A;  4ZH4 A;  5AI5 A;  7ICR A;  4BJQ A;  2F1H A;  1B0X A;  5KTQ A;  1BGX T;  1T3Q A;  5J2F A;  3B0Y A;  5J2A A;  4P0P A;  4CF5 A;  4I0U A;  3O0F A;  1SL2 A;  2WAQ C;  2D6F C;  5CWR A;  8ICK A;  2E8O A;  3RF9 A;  4US9 A;  1UEU A;  5J0P A;  1KFT A;  2DPJ A;  2ZIU A;  2QAR B;  2MSN A;  4O3R A;  1ZQ1 C;  5AKE A;  2KEY A;  4ECU A;  5DGB A;  1KKX A;  1PX5 A;  3BQ2 A;  3EWA A;  2BQ3 A;  5HR6 A;  3LWL A;  3K4G A;  3IP4 B;  2KMD A;  5DBC A;  3M9O B;  1IG6 A;  3ZDD A;  1YT3 A;  1DRG A;  3C2L A;  5CFU A;  3C66 A;  1JAL A;  1XSP A;  9ICC A;  4OAF A;  4E80 A;  2WB1 F;  1RQN A;  1U47 A;  3GFK B;  3ICX A;  2W8L A;  5KT6 A;  8ICP A;  4KLJ A;  4F50 A;  5L1J A;  3SR6 A;  3QU7 A;  4LVS A;  4EEK A;  4DL6 A;  1PVR A;  3MDA A;  5D4B A;  2H5X A;  1KEJ A;  2I5H A;  3FAH A;  3C2K A;  2JV3 A;  4K9A A;  3HJ4 A;  3SI8 A;  1JRP A;  5AI8 A;  3M1Y A;  3GIM A;  4DFJ A;  4DSL A;  4O3Q A;  3RH5 A;  5KFB A;  4J9Q A;  2KE7 A;  4MEY A;  1ZQV A;  5KFH A;  2KP7 A;  3IRU A;  2EQY A;  2JEG A;  3CP8 A;  2JH1 A;  4XUS A;  2HHQ A;  1F5S A;  5DG8 A;  5KFJ A;  5KT2 A;  3OWG A;  1ECW A;  3K1R B;  3Q8S B;  4DF4 A;  3AL0 B;  3RRH A;  3OJS A;  3EPG A;  4ECR A;  3RB0 A;  4KIT B;  5AKZ A;  1RXW A;  7ICS A;  3PW7 A;  5ALY A;  1ZQX A;  4NLK A;  5AKX A;  3UMC A;  1KW4 A;  4EX6 A;  2AH5 A;  3BDP A;  2A1A A;  2MA1 A;  8ICJ A;  2YQE A;  2YMP A;  5KFX A;  3CW2 C;  5D61 A;  4DQR A;  1D9D A;  1TK8 A;  2W9B A;  4F71 A;  4K99 A;  1Q8K A;  2H3Z A;  1TFY A;  1L7M A;  5TZV A;  3T5J A;  2HBK A;  1SV0 A;  5B3Q A;  8ICV A;  5KG5 A;  1T3N A;  7ICM A;  2ASJ A;  5J0W A;  1JQR A;  2EWR A;  1Z00 B;  4R8U B;  2KVC A;  4RQ8 A;  5DLF A;  3MR2 A;  4M6W A;  4ACO A;  2JHD A;  4QWE A;  1L3T A;  1KN5 A;  4JWM A;  5DGA A;  2H3Q A;  5FP0 A;  2HOF A;  4C8O A;  3NVZ A;  2NYV A;  4P0Q A;  5IIM A;  8ICW A;  1V38 A;  3T5L A;  1WUD A;  1X42 A;  2A19 A;  4Q8F A;  3OUY A;  4Q43 A;  3M6Z A;  4FS2 A;  3D2Q A;  9ICQ A;  4TQS A;  9ICV A;  2CRX A;  2R8J A;  3H37 A;  1B22 A;  1RQL A;  2ZJ5 A;  2QB1 A;  5III A;  5J0U A;  2FMP A;  5HMM A;  2XCA A;  3H7I A;  3RFA A;  2IBK A;  2WF5 A;  8ICS A;  2HCF A;  4KX3 A;  5HHI A;  1JUD A;  1T8E A;  1ZET A;  4ELV A;  5EOZ A;  3NRW A;  7ICV A;  1JXE A;  3THV A;  2CPR A;  4Y2T A;  3N7S C;  4RT3 A;  2DFL A;  4E7X A;  4JUZ A;  4I29 A;  2OWO A;  2PFO A;  4FZN A;  4M0A A;  2K4H A;  5D46 A;  4K8V A;  3NGD A;  5BPC A;  4FZM A;  2WFA A;  4CF3 A;  4OCZ A;  1VFG A;  5KT3 A;  3C1Y A;  1NK5 A;  4DWI A;  7ICG A;  2JZB A;  1ZD5 A;  1ZQF A;  5IIO A;  4O69 A;  3L5K A;  5KFZ A;  4X4T A;  1N48 A;  2VA8 A;  3NKU A;  2ZH9 A;  2HVI A;  2Y0S C;  4YVZ A;  1B43 A;  5L1L A;  2IHN A;  1TKD A;  4DFP A;  2BR0 A;  1RZT A;  1Z1V A;  2DPI A;  9ICJ A;  3PW4 A;  1WOT A;  5ALO A;  9ICW A;  5KFT A;  4QZ8 A;  1WWV A;  4DSE A;  3BQ0 A;  4QZF A;  5KFM A;  9ICN A;  3QU5 A;  3C2M A;  5JUM A;  4CGZ A;  2J6U A;  4NXW A;  2YMM A;  2BE3 A;  4F2R A;  3GV7 B;  4AT8 B;  4AT9 A;  3M9M B;  5EWF A;  4XA5 A;  3M7D A;  2BPG A;  3D6J A;  5ALH A;  1K1Q A;  5KFL A;  3PMN A;  4EYI B;  4F91 B;  1Q3V A;  5DB8 A;  3JPQ A;  3WFO A;  2ZIV A;  9ICF A;  4C7Z A;  3PHZ A;  2DR7 A;  1RYR A;  4F93 B;  4I2J A;  3RR8 A;  3AM9 A;  5CA7 A;  3A0B U;  3TFR A;  3TAD A;  4OJO A;  2PFP A;  4NKU A;  2P66 A;  2KNJ A;  2C22 A;  1OUQ A;  3KKA C;  5B66 U;  2FI1 A;  4MEX A;  5J2D A;  4FS1 A;  4F4Y A;  4RPZ A;  4WBZ A;  1SV4 A;  4US8 A;  2K89 A;  3JZ0 A;  4DF8 A;  5KT7 A;  1T7P A;  4P0P B;  5KFI A;  3T3F A;  2ZIX A;  3V7K A;  3PVX A;  4JMU A;  4EV6 A;  1XSL A;  2NO4 A;  2MUT B;  4CCH A;  5KFF A;  1X6J A;  5CJ7 A;  1Z1B A;  2NRK A;  4M9G A;  1N63 A;  3KHH A;  2JEJ A;  3HKZ C;  4Y2S A;  4MHV A;  3FC4 A;  3QEA Z;  4JB3 A;  5KG0 A;  2YMQ A;  2ISO A;  1JRO A;  4KMO B;  4B6J A;  2E8P A;  4NL9 A;  2QB0 A;  5EE3 A;  1R8A A;  1CUK A;  4Y2U A;  4B9M A;  4Z6E A;  1N61 A;  4YD1 A;  9ICT A;  4Y2X A;  2ATL A;  8ICC A;  5CFT A;  3RRG A;  3S6J A;  3Q8K A;  5KG7 A;  2LM4 A;  1TAU A;  1UA0 A;  5TIS U;  2W7O A;  3AQE A;  3EYZ A;  1TAM A;  2Q4T A;  2ZUB A;  1MQ2 A;  4IRK A;  2J6T A;  3QXG A;  3WK5 A;  1ZQE A;  1IIP A;  1Q78 A;  4AT7 A;  5DDM A;  5J29 A;  3C23 A;  1A77 A;  2H3I A;  3OGU A;  1SKR A;  1KRP A;  4RQ3 A;  1RDF A;  5JTI A;  3UXN A;  3GIJ A;  3FDS A;  9ICR A;  2NO5 A;  5D63 A;  4ED1 A;  2PFN A;  4ATB A;  4FO1 A;  2BPF A;  1S0N A;  4EYH B;  4FH3 A;  2E1E A;  3AQL A;  5ALT A;  3RB4 A;  4KN7 A;  3RJI A;  1X9M A;  5GTI U;  4K97 A;  3RBD A;  1BPX A;  3NS1 A;  5HRH A;  3RB6 A;  5KFV A;  4DSJ A;  4QZB A;  3EUB 2;  2KJ5 A;  1M6Y A;  2W04 A;  3KKA A;  2JRZ A;  1NKE A;  3H4B A;  3OV7 A;  4M9L A;  4NXU A;  5EWG A;  1WCN A;  2E1F A;  5EE1 A;  1NJZ A;  1KBU A;  1ZQN A;  2O1P A;  1NK7 A;  3LWM A;  4BX9 C;  5J0T A;  4MF8 A;  3V6H A;  3H3A A;  3OSN A;  3AUO A;  3RH4 A;  3ISD A;  2KTQ A;  5ALW A;  4UAZ A;  2WF8 A;  5CRX A;  1NK6 A;  4ED3 A;  1QQ5 A;  3L9D A;  2DR5 A;  1V9P A;  3F2B A;  3V7L A;  4YR2 A;  4C0Z A;  3SYZ A;  3NTU A;  5KG1 A;  4NXX A;  2YB1 A;  4CE6 A;  1NOM A;  2BBJ A;  1NK4 A;  2HBM A;  2JEF A;  3C1Z A;  4UBC A;  5IIN A;  4C8M A;  2BDU A;  9ICX A;  2FLL A;  4HYK A;  1D9F A;  3H8M A;  1A6S A;  1PK1 B;  4X0B A;  8ICI A;  3QU4 A;  1Z19 A;  1VJ7 A;  2ISP A;  3OHA A;  4ED7 A;  3CK6 A;  2P6R A;  3QX7 A;  5KAF U;  7ICE A;  4ECY A;  3KHG A;  4CNQ A;  3G6Y A;  3DEE A;  1L3U A;  3MDC A;  3MC1 A;  3G6X A;  2RLT A;  1ZQA A;  5AM4 A;  2JGA A;  2AGQ A;  2MAX A;  1S97 A;  3PZP A;  2NRV A;  1ZQB A;  1QSL A;  2BDP A;  2DUY A;  4WC6 A;  3V6J A;  1UEV A;  1ZQS A;  3JYY A;  4O3S A;  2Y9U A;  4JLZ A;  4UB5 A;  2XC9 A;  2VJ4 A;  4K96 A;  1O08 A;  2FPL A;  5J8Y A;  4J9M A;  1Z3E B;  1UHU A;  4RPX A;  7ICK A;  2DF4 B;  4R63 A;  4I27 A;  2R18 A;  3NRZ A;  5KG2 A;  2ES6 A;  1D8Y A;  4ED6 A;  4XQ8 A;  5KFQ A;  4PZN A;  1QSY A;  1X40 A;  2PFQ A;  1X6I A;  3JCF A;  2WF7 A;  4FBU A;  4KLD A;  3T5K A;  2V9W A;  2ASL A;  2BCV A;  1HUO A;  2RP5 A;  4WH5 A;  2F76 X;  3GII A;  2FMQ A;  4UQG A;  3C5G A;  5DB7 A;  1ZQJ A;  3D2N A;  3HJE A;  4ELU A;  4WC4 A;  5CFS A;  1N2X A;  4UAT A;  5AIB A;  4FHW A;  2IA6 A;  5E79 U;  4WC5 A;  2ZH3 A;  4BWJ A;  3WFP A;  3BS5 A;  4F5Q A;  1ZQQ A;  1GO3 F;  5HP4 A;  1VLB A;  2LHT A;  3WKC A;  4DLG A;  1NJY A;  5CEH A;  1COK A;  5F9L A;  4GC7 A;  3OVS A;  1ARO P;  4ECV A;  2KD1 A;  1J97 A;  4UD4 A;  2ASD A;  4DQP A;  3KHL A;  2G5I B;  3RJF A;  3ZDE A;  4O5C A;  1L6N A;  2XIC A;  2M2V A;  3PNC A;  2PMZ C;  3ERC C;  1UT8 A;  4K9B A;  2P35 A;  4X4N A;  2I6X A;  4X5V A;  3K7D A;  2J6S A;  3WFR E;  4DQQ A;  5IIJ A;  3MR3 A;  5F2V O;  5AM0 A;  4PHA A;  4IQU A;  4WC1 A;  5T14 A;  4EBE A;  3QYP A;  4IRD A;  5KFS A;  4KN4 A;  4MFC A;  1Q3U A;  4K4H A;  3Q8M A;  2OEH A;  3AQK A;  1DGJ A;  4BXO A;  3ALR A;  5J2J A;  3H8W A;  3PSI A;  2C2R A;  1JN3 A;  2ZIW A;  4O68 A;  4X4R A;  1QQ6 A;  4JWN A;  2XGP A;  1C7Y A;  1N5X A;  3C21 A;  1LKY A;  2L5Y A;  2W3R A;  3FYH A;  5G5G A;  1SXD A;  2PKE A;  3UPQ A;  5B3P A;  2KFN A;  2AQ0 A;  4J9P A;  7ICJ A;  9ICM A;  3PSP A;  3PSF A;  4KLO A;  2R8H A;  4O3P A;  4FBT A;  2KSO B;  3MGV A;  3JPN A;  1NJW A;  3HIY A;  1R8C A;  5AK4 A;  5HRE A;  1DK3 A;  1AQ6 A;  5JRT A;  1FO4 A;  1ZQH A;  3IHQ B;  3M8S A;  5ALJ A;  3LK9 A;  1ZQT A;  3OHB A;  3KZI U;  1WYG A;  2HHS A;  4I2E A;  1SWW A;  3GQC A;  1HJP A;  4QWC A;  5B5E U;  3PML A;  2W03 A;  1BPE A;  3N97 B;  3F5E A;  2G09 A;  1L8O A;  3ZDA A;  1FFV A;  4M9J A;  9ICB A;  1NKB A;  2ZH5 A;  2F1I A;  2HHU A;  4KTQ A;  4RQ7 A;  3JPS A;  5DED A;  3H8S A;  2I9G A;  4M47 A;  3C5F A;  4XJE A;  1KQQ A;  3OJU A;  3GZF A;  4LEW A;  3ONN A;  1COO A;  3BQ7 A;  4Q45 A;  2M2T A;  3LVW A;  3OVB A;  5DG9 A;  2W54 A; 
#chains in the Genus database with same CATH homology
 4I2F A;  4AT9 B;  5CB1 A;  3M9M B;  4AT9 A;  4AT8 A;  5EWF A;  4EZ6 A;  3PO4 A;  2JEI A;  4XA5 A;  2BPG A;  4QWB A;  3QEB Z;  2XY7 A;  1S77 D;  7ICH A;  1IM4 A;  4QZE A;  1K1Q A;  2VA3 A;  4BDP A;  5KFL A;  5KFC A;  4UB4 A;  3PMN A;  4EYI B;  3N4M B;  4F91 B;  2VAN A;  4TUS A;  2BCQ A;  3TAQ A;  1R89 A;  4EBK A;  5DG7 A;  1HUZ A;  1ZJN A;  5DB8 A;  4X4U A;  1LV5 A;  4NXZ A;  4GXK A;  3JPQ A;  3QE9 Y;  3Q8R B;  1ZJM A;  2PBE A;  3WFO A;  9ICG A;  3MFI A;  3E2E A;  8ICF A;  9ICF A;  4XQ7 A;  2DR7 A;  1ZQP A;  1TV9 A;  1RYR A;  4DSF A;  4F93 B;  1U9L A;  4I2J A;  4ECZ A;  4DOB A;  1S0O A;  4ED8 A;  4O5K A;  1BPY A;  4DSK A;  4F3O A;  7ICN A;  3RR8 A;  5DDY A;  2VA2 A;  2PI4 A;  3MFH A;  1MIW A;  4RWO A;  1XS9 D;  1N56 A;  2RDJ A;  5CA7 A;  5DKW A;  1TK5 A;  3TFR A;  4R66 A;  4NKU A;  2PFP A;  2P66 A;  4YR0 A;  4PGQ A;  1KDH A;  5HRD A;  2C22 A;  4WC3 A;  3ORY A;  2HHV A;  3GDX A;  4NM1 A;  5J2H A;  2DVI A;  4YCX A;  4KLM A;  4YP3 A;  4G3I A;  4MEX A;  1MSW D;  2HHW A;  5J2D A;  4FS1 A;  3RBE A;  4X4S A;  4AT8 B;  4F4Y A;  4RPZ A;  1NZP A;  4WBZ A;  2ZH4 A;  3QZ8 A;  2DRB A;  2ZJ8 A;  4I2D A;  3JZ0 A;  4DF8 A;  3GV5 B;  1MIV A;  4YQW A;  3H8J A;  5C5J A;  5KT7 A;  4YXM A;  3PV8 A;  1T7P A;  5KFI A;  3T3F A;  4F2S A;  2BQU A;  4F8R A;  4QW9 A;  2ZHA A;  4GXI A;  4DL7 A;  1L5U A;  2UVV A;  4ECW A;  3V7K A;  3PVX A;  2FMS A;  2GWS A;  4NKT A;  1XSL A;  4RQ6 A;  2Y1I A;  2MUT B;  4DS5 A;  2MUT A;  4UAW A;  4CCH A;  1OU5 A;  1S9F A;  5KFF A;  2NRK A;  5CJ7 A;  5BOL A;  1NK9 A;  4KLT A;  4M9G A;  3UXO A;  5DQH A;  1KSP A;  3KHH A;  2DR8 A;  2JEJ A;  2LYH A;  4WBY A;  4QWA A;  4FHV A;  4B9N A;  5HR9 A;  5F9N A;  3QEA Z;  5J2K A;  4GC6 A;  4TUP A;  7ICO A;  5HNK A;  1DK2 A;  1JAJ A;  5DEC A;  1U49 A;  8ICH A;  4EBJ A;  8ICT A;  5HHH A;  3UXP A;  4QZ9 A;  3HPO A;  1SKS A;  2RDI A;  1Q79 A;  5KG0 A;  4QZH A;  4O0I A;  2ISO A;  4FHX A;  4JV2 A;  1EXN A;  3GIL A;  1QTM A;  3ZDC A;  2ZTE A;  3AU6 A;  2XO7 A;  1TVA A;  4RQ0 A;  1KTQ A;  3GV8 B;  9ICH A;  1S10 A;  4DQS A;  1R8A A;  1CUK A;  5L1I A;  4F4X A;  5KFY A;  4DLE A;  4B9M A;  4K4I A;  4Z6E A;  3KTQ A;  1BNP A;  4YD1 A;  1F5A A;  9ICT A;  3G6V A;  2ATL A;  4Z6C A;  3RJH A;  8ICC A;  1UET A;  2A1J B;  4F5R A;  3RRG A;  4WC7 A;  5IIL A;  3Q8K A;  5KG7 A;  2UVR A;  3PR5 B;  3PW2 A;  1TAU A;  8ICL A;  3AQN A;  1ZQW A;  1PZN A;  1UA0 A;  2ALZ A;  3Q8L A;  1ZQD A;  9ICL A;  4X4O A;  4MFF A;  4M04 A;  4EBC A;  4QZD A;  1B22 A;  5HRI A;  3EYZ A;  4M9N A;  4TUQ A;  2ZUB A;  1MQ2 A;  4WC0 A;  4IRK A;  1S76 D;  2J6T A;  3T5H A;  3LQC B;  4YG2 A;  1L3S A;  4X4V A;  1ZQE A;  1D8L A;  5KFG A;  5CR0 A;  1DOQ A;  4RUC A;  7ICQ A;  1XWL A;  3BJY A;  4JK1 A;  1K1S A;  1ZQY A;  4EBD A;  3PW0 A;  3ZD9 A;  1Q78 A;  4AT7 A;  5DDM A;  5J29 A;  2R8G A;  4IR9 A;  4PPX A;  4AT7 B;  2NRX A;  1TAQ A;  4RQ5 A;  2Y1J A;  3C23 A;  3EPI A;  1R8B A;  2O5A A;  3HJ1 A;  1A77 A;  3OGU A;  1BNO A;  4RQ1 A;  4X4P A;  1SKR A;  1KRP A;  5KT4 A;  4RQ3 A;  1TK0 A;  1BPZ A;  8ICE A;  1JX4 A;  3UXN A;  1XU4 A;  4ECS A;  4IQV A;  5KFO A;  3GIJ A;  3FDS A;  9ICS A;  9ICR A;  4ED1 A;  2PFN A;  4ATB B;  4ATB A;  3AQM A;  2BPF A;  4F5O A;  5HRB A;  1S0N A;  1X9W A;  3HWT A;  5KFR A;  4F4W A;  2XY5 A;  1MQ3 A;  4RNM A;  3RJG A;  3UPS A;  2R8I A;  4B9S A;  4DL3 A;  4EYH B;  4FH3 A;  4I2H A;  4QZG A;  2WTF A;  2IHM A;  2W9C B;  4RT2 A;  2W9C A;  4LT6 A;  4KLQ A;  4DL5 A;  3AQL A;  5J0S A;  4KLE A;  5J0Q A;  1UT5 A;  3RB4 A;  2KFZ A;  4J9O A;  8ICY A;  3MGH A;  3H38 A;  4P4P A;  4DL4 A;  4KN7 A;  3RJI A;  1H38 A;  3TFS A;  4X0A A;  1X9M A;  1S0V A;  2M2W A;  2ZHB A;  4B9T A;  4YMM A;  2W9M A;  3MGI A;  8ICQ A;  3MAB A;  1A76 A;  3RBD A;  2HW3 A;  9ICP A;  4M5D A;  3KHR A;  1BPX A;  4TQR A;  9ICE A;  5KFE A;  3PO5 A;  8ICN A;  5DLG A;  4UAY A;  9ICO A;  2NRZ A;  4WCW A;  8ICA A;  5HRH A;  3MBY A;  5KFV A;  3RB6 A;  1U4B A;  4QZB A;  1JXL A;  4B9U A;  4DSJ A;  4IR1 A;  2ZJA A;  7ICF A;  2ZH8 A;  5KFU A;  1ZQI A;  3K75 D;  1NKE A;  2ZUD A;  9ICI A;  1SKW A;  3H4B A;  3OV7 A;  4M9L A;  4DFM A;  5EWG A;  1WCN A;  2NRT A;  5DB9 A;  5J2E A;  4O9M A;  4M9H A;  1NJZ A;  5KFP A;  3RJJ A;  4P2H A;  4TUR A;  1ZQN A;  2O1P A;  3WFS C;  1NK7 A;  4O3O A;  3LWM A;  4DOC A;  1U48 A;  4EZ9 A;  5J0T A;  4MF8 A;  3OSP A;  3V6H A;  3H3A A;  4DOA A;  1ZQU A;  1X9S A;  2BPC A;  3OSN A;  3RJE A;  3AUO A;  4E0D A;  4BWM A;  2XGQ A;  3RH4 A;  2XY6 A;  3ISD A;  4NLZ A;  4QZC A;  2KTQ A;  4UAZ A;  1NK6 A;  1JIH A;  2ZTD A;  4ED3 A;  2W8K A;  2KZM A;  8ICX A;  3L9D A;  1L3V A;  1V9P A;  2DR5 A;  4B9V A;  3V7L A;  4YR2 A;  3JPP A;  3MR6 A;  3V72 A;  2BQR A;  4J9S A;  2BCR A;  4ZH4 A;  3SYZ A;  1Y88 A;  3AU2 A;  3NTU A;  5KG1 A;  7ICR A;  4RNO A;  1NOM A;  4Z6D A;  2F1H A;  1NK0 A;  1NK4 A;  4P4M A;  5KTQ A;  2JEF A;  1BGX T;  5J2F A;  3HX0 A;  3B0Y A;  5J2A A;  3C1Z A;  4UBC A;  5IIN A;  4S3N A;  2BKE A;  4C8M A;  4E8F A;  4NLG A;  9ICX A;  4RQ2 A;  2FLL A;  4HYK A;  1D9F A;  3JPR A;  4YFK A;  2ZUC A;  5DBA A;  1SL2 A;  4FH5 A;  4IQT A;  4X0B A;  4J9N A;  8ICI A;  5CWR A;  5BOM A;  8ICK A;  1RPL A;  1TFR A;  1ZQL A;  2ISP A;  3OHA A;  4J9K A;  5J0P A;  4DO9 A;  1UEU A;  1KFT A;  2DPJ A;  2ZH7 A;  1ZQC A;  4ED7 A;  2BE3 A;  3PR4 A;  2V4Q A;  4YMO A;  4O3R A;  3ZD8 A;  4RWQ A;  2P6R A;  4FO6 A;  7ICI A;  5IIK A;  7ICE A;  4ECY A;  3KHG A;  1BPB A;  4ECU A;  3G6Y A;  1L3U A;  4O5E A;  3MDC A;  3RH6 A;  5DGB A;  4KLS A;  7ICT A;  3G6X A;  1PX5 A;  4WC2 A;  2Q0Z X;  3BQ2 A;  1ZQA A;  4BXO B;  2AGQ A;  1X2I A;  3EWA A;  1XSN A;  4GXJ A;  2BQ3 A;  2MAX A;  3B0X A;  1S97 A;  4IG8 A;  3LWL A;  3K4G A;  2NRV A;  2AQ4 A;  1ZQB A;  1QSL A;  3M8R A;  4KLH A;  5EWE A;  2BDP A;  4F4K A;  4YN4 A;  1SZP A;  4J9L A;  3TAN A;  4DFK A;  5HML A;  3V6J A;  4WC6 A;  1UEV A;  4UB2 A;  1ZQS A;  4IRC A;  5DBC A;  3M9O B;  3SZ2 A;  3TI0 A;  3BQ1 A;  3ZDD A;  1WCL A;  3RAX A;  3HP6 A;  3C2L A;  4ECQ A;  1LB2 B;  3C66 A;  3JYY A;  4O3S A;  4UB1 A;  1XSP A;  2IMW P;  3PY8 A;  2HHX A;  2A1J A;  9ICC A;  4UB5 A;  2XC9 A;  4PGX A;  1KNY A;  4FHY A;  4E80 A;  2FPL A;  1U47 A;  3GFK B;  3TQ1 A;  2W8L A;  5KT6 A;  4J9M A;  8ICP A;  1Z3E B;  4KLJ A;  4F50 A;  4RPX A;  4MFA A;  1U45 A;  7ICK A;  5L1J A;  3H4D A;  4I2B A;  4LVS A;  4DL6 A;  4YR3 A;  4YMN A;  1KFD A;  4R63 A;  3MDA A;  4I27 A;  3PX0 A;  5D4B A;  2H5X A;  4QZI A;  1KEJ A;  5KG2 A;  1FA0 A;  3C2K A;  7ICU A;  4ECX A;  3HJ4 A;  3SI8 A;  1NKC A;  2ZH1 A;  3OVA A;  3GIM A;  5J2C A;  4DFJ A;  1DGS A;  4DSL A;  4O3Q A;  4I2A A;  3RH5 A;  2BCU A;  1D8Y A;  4ED6 A;  4XQ8 A;  1RYS A;  2XCP A;  5KFQ A;  5KFB A;  4RU9 A;  2PXI A;  4J9Q A;  4KLL A;  8ICZ A;  1QSY A;  5J2B A;  3H37 A;  4MEY A;  1ZQV A;  1IXR A;  4QWD A;  5KFH A;  4O3N A;  2PFQ A;  4NY8 A;  3ETL A;  3PX4 A;  4C8K A;  4Q8E A;  2KP7 A;  1VJ7 A;  4FBU A;  4KLD A;  8ICB A;  4I2C A;  3T5K A;  2JEG A;  2V9W A;  3NYB A;  3ZDB A;  2ASL A;  1NK8 A;  4XUS A;  2BCV A;  1HUO A;  1ZQM A;  1ZQG A;  2HHQ A;  7ICL A;  5J0X A;  2HHP A;  5DG8 A;  5KFJ A;  5KT2 A;  2R8K A;  3GII A;  9ICA A;  4I2I A;  1CEZ A;  3SV4 A;  2FMQ A;  3Q8S B;  4RPY A;  4DF4 A;  4UQG A;  3JPT A;  3RRH A;  3C5G A;  3Q8Q B;  4F4Z A;  3OJS A;  3EPG A;  5L9X A;  3RR7 A;  4ECR A;  1YLQ A;  3RB0 A;  4EP7 A;  5DB7 A;  4KIT B;  1ZQJ A;  3EW9 A;  3GIK A;  1RXW A;  7ICS A;  4ELU A;  4K4G A;  4WC4 A;  3RAQ A;  3PW7 A;  2AGO A;  5J0Y A;  2C2D A;  4RUA A;  5HC9 A;  2M2U A;  1ZQX A;  8ICU A;  2I1Q A;  4NLK A;  4FHW A;  4RQ4 A;  2IA6 A;  3IM1 A;  4WC5 A;  2ZH3 A;  4BWJ A;  3WFP A;  3BDP A;  4F5Q A;  1ZQQ A;  5KFK A;  4R64 A;  5HP4 A;  4KMU A;  5KFN A;  8ICJ A;  7ICP A;  1ZQR A;  5CP2 A;  3LDA A;  4DLG A;  1NJY A;  2C28 A;  5KFX A;  5F9L A;  4GC7 A;  4DQR A;  1XO1 A;  1TK8 A;  1D9D A;  3HW8 A;  2W9B B;  2W9B A;  3SV3 A;  3OVS A;  1ARO P;  4ECV A;  3H39 A;  4DQI A;  5KG3 A;  2ASD A;  4DQP A;  4YXJ A;  4LZG A;  3PW5 A;  4UD4 A;  3KHL A;  1TFY A;  2FPK A;  2BGW A;  3JPO A;  1S0M A;  4R65 A;  4KLU A;  3ISB A;  3RJF A;  2FPM A;  3ZDE A;  2AJQ A;  4F5N A;  3EZ5 A;  4O5C A;  5TZV A;  3T5J A;  4KLF A;  2M2V A;  8ICV A;  3PNC A;  5KG5 A;  3M9N B;  1T3N A;  1UT8 A;  7ICM A;  2ASJ A;  5J0W A;  1JQR A;  2ZH6 A;  4X4N A;  2UVU A;  4X5V A;  1Z00 B;  4R8U B;  1Z00 A;  4R8U A;  4RQ8 A;  5DLF A;  2J6S A;  3Q8P B;  3MR2 A;  4ED2 A;  3WFR E;  4M6W B;  4M6W A;  3RB3 A;  4DQQ A;  5IIJ A;  4QWE A;  3MR3 A;  1QSS A;  1L3T A;  4RWP A;  4JWM A;  5F2V O;  5DGA A;  4PHA A;  4C8O A;  4IQU A;  8ICM A;  4WC1 A;  5IIM A;  4EBE A;  8ICW A;  4IRD A;  5J2G A;  2ZTC A;  5DB6 A;  1ZQZ A;  5KFS A;  3T5L A;  4KLI A;  4KN4 A;  3PX6 A;  4MFC A;  2KZ3 A;  2KZZ A;  1KFS A;  5J0O A;  2PI5 A;  4Q8F A;  4K4H A;  3OUY B;  3OUY A;  1JMS A;  5KT5 A;  2FLN A;  4Q43 A;  4KLG A;  3Q8M A;  1BVS A;  4UB3 A;  4FS2 A;  9ICQ A;  4TQS A;  3AQK A;  9ICV A;  4BXO A;  4C8L A;  3H40 A;  2BCS A;  4P4O A;  3RTV A;  4JV1 A;  2R8J A;  3H8W A;  5J2J A;  5KG6 A;  2ZJ5 A;  2W9A A;  5III A;  5J0U A;  3TAP A;  1ZYQ A;  2FMP A;  1XC9 A;  5HMM A;  2C2R A;  1JN3 A;  2KN7 A;  2XCA A;  2RFF A;  2ZH2 A;  3H7I A;  2IBK A;  4ELT A;  4X4R A;  3RJK A;  2NRW A;  4I28 A;  4JWN A;  2XGP A;  8ICS A;  1C7Y A;  3C21 A;  5HHI A;  4I2G A;  4JV0 A;  3FYH A;  9ICU A;  5J0R A;  1NJX A;  5J2I A;  3UPQ A;  4B9L A;  2KFN A;  2AQ0 A;  4J9P A;  3TAR A;  7ICJ A;  9ICM A;  1ZQK A;  1MC8 A;  2P6U A;  4PH5 A;  3WFQ E;  1T8E A;  1ZET A;  4KLO A;  4ELV A;  2R8H A;  4DSI A;  5EOZ A;  8ICG A;  7ICV A;  1JXE A;  2AGP A;  5DBB A;  1BPD A;  3THV A;  3HT3 A;  3V7J A;  4ECT A;  1V4A A;  4RT3 A;  2DFL A;  4O3P A;  4FBT A;  4DEZ A;  4E7X A;  2BHN A;  3BQT A;  4JUZ A;  4I29 A;  4GLX A;  3ISC A;  2OWO A;  3MR5 A;  3JPN A;  2PFO A;  4M0A A;  4NM2 A;  4F5P A;  1NJW A;  3HIY A;  1R8C A;  5HRG A;  5D46 A;  3NGD A;  2DR9 A;  4J9R A;  5BPC A;  5HRE A;  1DK3 A;  5KFD A;  5DQI A;  4NLN A;  1VFG A;  1UA1 A;  4BGD A;  3C1Y A;  5KT3 A;  1SL0 A;  1TFW A;  4DL2 A;  1NK5 A;  1ZQH A;  2JZB B;  4DWI A;  2JZB A;  7ICG A;  4FHP A;  3IHQ B;  1ZQF A;  5KFA A;  3M8S A;  4RWN A;  3UQ2 A;  4RNN A;  1ZQT A;  5IIO A;  3LK9 A;  3OHB A;  8ICR A;  4XRH A;  4PHP A;  2HHS A;  4I2E A;  5KFZ A;  4Q44 A;  3GQC A;  1N48 A;  4RZR A;  4X4T A;  2C2E A;  1T4G A;  2VA8 A;  1HJP A;  4QW8 A;  4QWC A;  1RXV A;  4UD5 A;  1ZQO A;  4X4Q A;  8ICO A;  2ZH9 A;  2HVI A;  5CHG A;  3PML A;  5D49 A;  4C8N A;  2UVW A;  2ID1 A;  4EEY A;  4UBB A;  1BPE A;  2M9N A;  5HRF A;  4F92 B;  2HVH A;  4YVZ A;  1B43 A;  5L1L A;  3N97 B;  2IHN A;  2HHT A;  4PHE A;  3C18 A;  2DRA A;  1TKD A;  1NO5 A;  5L1K A;  4DFP A;  3ZDA A;  4M9J A;  9ICB A;  5KG4 A;  1NKB A;  4PGY A;  2F1I A;  2BR0 A;  2ZH5 A;  5DQG A;  1RZT A;  2DPI A;  1KLN A;  4KTQ A;  2HHU A;  3PW4 A;  4RQ7 A;  3JPS A;  9ICJ A;  2B21 A;  1MIY A;  1WOT A;  5DED A;  1QLN A;  2F1J A;  3V6K A;  3UQ0 A;  2V4R A;  3QZ7 A;  9ICW A;  5KFT A;  5HRL A;  4M2Y A;  5KFW A;  4QZ8 A;  3H8S A;  4DSE A;  2AU0 A;  2I9G A;  4M47 A;  3C5F A;  4YD2 A;  4PHD A;  3BQ0 A;  2Q66 A;  4QZF A;  4QZA A;  5KFM A;  3OJU A;  1SL1 A;  9ICN A;  4DS4 A;  3C2M A;  5JUM A;  4LZD A;  4ED0 A;  1COO A;  9ICK A;  4Q45 A;  4MF2 A;  2J6U A;  2M2T A;  4IQW A;  5HRK A;  3OVB A;  5DG9 A;  2FLP A;  4F2R A;  3GV7 B;  4Z6F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...