5DBBA

Structure of human dna polymerase beta host-guest complex with the dg base paired with a da
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
329
structure length
327
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title N7 Methylation Alters Hydrogen-Bonding Patterns of Guanine in Duplex DNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
total genus 99
structure length 327
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2015-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 5dbbA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 5dbbA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 5dbbA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5dbbA03
3H37A 3TARA 1L5UA 4R65A 3PW7A 4ECYA 4UAYA 4X5VA 4DFMA 7ICUA 5KFNA 3RJHA 4RUAA 5KFJA 3IHQB 4Q45A 4I2GA 5KFGA 5DBCA 2NRXA 2ZTCA 4J9PA 4B9NA 2PXIA 1LB2B 1Z3EB 5L9XA 2HHTA 2KZZA 4M5DA 4IRDA 5L1JA 4WC7A 2XGPA 4GC6A 1BPBA 4EBCA 2NRKA 4DL2A 2BQRA 2IHNA 2KN7A 1VJ7A 3GQCA 3PR4A 2R8KA 3TI0A 4PHDA 5KG6A 4QZFA 4M47A 1IM4A 4C8MA 1ZQGA 2PFPA 5HRGA 2M9NA 1K1SA 4Z6FA 3EZ5A 1XSPA 2I9GA 3RJGA 8ICWA 4I2HA 3AQKA 1BGXT 4ATBB 1SZPA 5DB6A 7ICOA 2F1IA 9ICXA 4S3NA 5HR9A 3AU2A 3PW5A 1U47A 2W9BA 2RDJA 5HRLA 1X2IA 2W8KA 3UPSA 1RXVA 4DWIA 5KFZA 4PGXA 4Q44A 9ICLA 3L9DA 4RQ0A 4BGDA 3RB4A 5J2GA 3V6KA 4Z6DA 9ICUA 3BJYA 3LDAA 1NKCA 5J2FA 3C2LA 3RJEA 3RJFA 1JMSA 4KITB 1MQ3A 4ED8A 1ZQQA 4F91B 3H4DA 3N4MB 5HRFA 4NM1A 2RFFA 4IQWA 4YXJA 4AT8B 2ATLA 1BNOA 2FMSA 4PHPA 3G6YA 3KHLA 4PHAA 4DEZA 1UA1A 5J0TA 2IA6A 1HUOA 4IR9A 1MIVA 1UT5A 1DOQA 3RB0A 4Q8EA 4ED6A 3GDXA 5DLFA 2BQ3A 2XY5A 3MDCA 5BPCA 4ED2A 2RDIA 4QW9A 4I2EA 4DQPA 4BWMA 4ELUA 5EWGA 4Z6CA 2GWSA 1NOMA 4C8OA 5KG4A 1NK0A 5KFHA 4DOAA 4R64A 1C7YA 1L3SA 2ASJA 3HJ1A 4E0DA 1HUZA 4QZ9A 4R63A 1XC9A 4X4VA 4RQ6A 4DS5A 5D4BA 2OWOA 2NRZA 4FS1A 4I28A 3BQ1A 3RRGA 4WC0A 4YR3A 4EBKA 4I2FA 5CB1A 8ICOA 1K1QA 3AQNA 3MDAA 4CCHA 2ZH3A 9ICVA 2BPCA 1XO1A 3UXOA 4DL5A 3RB6A 4DSIA 2BKEA 2BE3A 5IIJA 3MFHA 3NYBA 1Z00B 1BPEA 2BPGA 2R8GA 8ICQA 1WOTA 4KLGA 2HHXA 1ZQLA 4XUSA 4DSEA 2JEJA 2ZJAA 5IIMA 2KFZA 1MIWA 3WFQE 4UB5A 5DBAA 4GLXA 2J6TA 4RQ5A 5F9LA 4EZ6A 9ICEA 1ZQSA 3PY8A 3PX0A 4DQIA 8ICXA 1S9FA 3H8WA 2AQ4A 1F5AA 9ICMA 4F4ZA 2ZH6A 1ZQDA 2J6SA 5IIOA 4KLOA 1ZQUA 4RZRA 4MF8A 5C5JA 5J2BA 5D46A 4EYIB 2BHNA 2MAXA 3C1YA 4TQSA 3V7JA 2FLLA 9ICFA 4KLMA 5HHHA 2BQUA 3MBYA 3C1ZA 2ZJ5A 3Q8RB 2DR9A 1BPZA 4J9LA 1RPLA 4ECXA 4FHVA 3WFRE 4DS4A 1UEVA 4JWMA 4WC2A 8ICTA 2UVVA 4UAWA 4HYKA 3OVSA 4UB4A 1NJZA 4F93B 3H38A 1B22A 1NKBA 3GV7B 4BXOB 5HC9A 1HJPA 3N97B 3V7LA 4F2SA 8ICGA 1LV5A 4X4PA 2DR5A 4RWQA 4RWPA 4ECQA 3RBDA 4WC5A 5DQGA 3ORYA 1ZQZA 4DQRA 3T5KA 5EWFA 1KRPA 4K4HA 1Q78A 3ZD9A 4DLGA 3PR5B 3T3FA 1Z00A 1ZQJA 4KLQA 2I1QA 4G3IA 4YXMA 5EWEA 4R8UA 3PVXA 3THVA 7ICRA 4MEXA 4PGQA 1S77D 4KLUA 4YQWA 1ZQEA 3BQ0A 4KLSA 4X4SA 5KFTA 4IQUA 3ISBA 4TUSA 4UBBA 3ISCA 4DQQA 3JPSA 4ED0A 1ZQFA 4Q8FA 2W9AA 4MFFA 4X0BA 2DRAA 4TURA 4BWJA 3RH4A 2C22A 4RWOA 2ZUDA 2AGQA 4XQ8A 4QZEA 4TQRA 3JYYA 1D9DA 4YP3A 4J9OA 3RJIA 4YMOA 3SV3A 2FPMA 3TAQA 1TAUA 1ZQYA 9ICKA 3H3AA 5J0RA 3HT3A 4F2RA 2XY6A 1Y88A 4DL7A 4UB1A 2KTQA 3BDPA 3BQTA 4RUCA 2DR7A 4YFKA 4X4TA 4YG2A 3JPNA 4UD4A 3Q8PB 7ICJA 1ZQHA 5BOLA 3ZDBA 4FH5A 4DLEA 2C28A 1EXNA 4YR2A 4QWCA 5J0WA 4BXOA 5KG1A 4ELVA 1CEZA 3IM1A 7ICTA 1WCNA 4M6WB 1TK8A 1NK9A 8ICEA 2HHSA 8ICJA 4P4PA 1UETA 4O3RA 1TKDA 3C2MA 4M9LA 4ZH4A 5KFRA 4F4KA 1RZTA 1H38A 5J0OA 2ZH2A 5L1LA 3OJSA 1JIHA 1ZETA 2DR8A 4EBJA 1JN3A 5IIKA 5HRDA 3QE9Y 1ZQTA 8ICNA 4FHWA 4QZ8A 2ID1A 5KFLA 5KG2A 4E7XA 2XCPA 5J2CA 2R8IA 2PBEA 1ZQWA 4O3OA 1ZQOA 2C2EA 3RTVA 4IRKA 4AT9A 4KLIA 3WFSC 4RNMA 1U49A 4QZAA 4O5EA 3RAXA 3ZDEA 2XC9A 4XQ7A 4F5NA 1QTMA 4M0AA 4I2BA 3AU6A 7ICNA 1BPDA 5DQIA 5CWRA 2ZTEA 4M9HA 4ECRA 2BGWA 3GV5B 9ICGA 1R89A 2VANA 4DL4A 2ZH5A 2BDPA 3MGIA 3OSNA 2ZHAA 4FH3A 1L3TA 4DSLA 4M04A 4MEYA 4PGYA 2ASDA 2JZBB 5KFEA 3T5JA 2JEFA 3JPPA 4O5KA 1S76D 1UEUA 3RR7A 4RT3A 1ZQNA 2FLPA 4WC3A 1UA0A 4EBDA 2NRWA 4O0IA 4ECSA 2P6UA 4XRHA 4FS2A 1NJYA 3H39A 2MUTB 1YLQA 4NXZA 4Q43A 1QSSA 4M6WA 5HMLA 4NM2A 4QZDA 1ZQPA 3QEAZ 3PX4A 2ZH4A 1NKEA 1NK5A 3GIJA 1MQ2A 3PV8A 4XA5A 4DSKA 8ICLA 1S0NA 3AQMA 4AT9B 5J0UA 4QZIA 4I2JA 3OHAA 1IXRA 5J0YA 1X9WA 4RQ8A 2B21A 1ZQXA 4J9QA 4KLFA 2W8LA 4DL3A 4MFAA 4F4WA 4DSJA 3H4BA 1T8EA 4ATBA 1RYSA 5CHGA 1TV9A 4F5QA 1SKSA 3RBEA 1KSPA 4E80A 5KFMA 4FHYA 2IMWP 4F8RA 1XSNA 2V9WA 7ICMA 9ICHA 1TFRA 7ICQA 5KT2A 4DF8A 4QWAA 4ED3A 4ECWA 2FLNA 4B9UA 9ICSA 3FYHA 4J9RA 3PO5A 4DFKA 3MR2A 4FO6A 4F5OA 2HVIA 4GXKA 3V7KA 4LVSA 1UT8A 4AT8A 2NRTA 5IINA 4JV0A 2HW3A 5CR0A 7ICFA 3K4GA 5KT4A 5J2JA 3PW4A 4M9GA 7ICGA 1PX5A 4F5RA 5DG8A 3OSPA 4KLHA 5KFVA 4QZGA 1NK7A 2JEGA 3UXNA 9ICCA 3M9OB 3H40A 5KFDA 2HHUA 2DFLA 4P2HA 3OUYA 1MIYA 1KLNA 3V72A 4J9SA 7ICSA 9ICWA 4BDPA 2KP7A 4KLTA 4QW8A 3ISDA 4AT7B 4ECVA 1BPYA 1R8BA 3M9NB 3UXPA 5L1KA 1XS9D 2PFNA 4NY8A 3NTUA 8ICBA 7ICIA 1QLNA 2H5XA 1V9PA 4YR0A 5J0SA 1ZJNA 1TVAA 4B9MA 5KFIA 4F92B 1JQRA 5DGAA 9ICJA 2O5AA 3MGHA 4YVZA 4EBEA 3B0XA 3EYZA 4NLZA 4TUPA 4KLLA 4RNNA 1ZQKA 2UVUA 2M2TA 3EW9A 2BCUA 1JXLA 5CA7A 3ZD8A 1T4GA 4UQGA 1L3VA 4RU9A 4QWBA 4QZCA 2ASLA 4KLEA 2HVHA 3AUOA 3MFIA 2BCSA 5HRHA 2KZ3A 1KFTA 4K4GA 4WCWA 4E8FA 1D8LA 1SKWA 3QZ8A 3Q8LA 3OGUA 4RPZA 2DPJA 2VA3A 3GIKA 5DG7A 1BPXA 4JWNA 4KLJA 2R8JA 4I2DA 2M2VA 4R66A 1OU5A 2LYHA 4UAZA 3JZ0A 1TFWA 4RQ1A 1S0OA 3PMNA 5DECA 9ICNA 4TUQA 1JXEA 2AGOA 4YMMA 4LZGA 2F1JA 2J6UA 1MSWD 1BVSA 5HREA 3M8SA 4RPXA 1R8AA 2BPFA 5F2VO 5DGBA 8ICIA 4C8KA 2O1PA 4M2YA 1KNYA 3KHHA 4F4YA 4M9JA 2DVIA 4J9NA 2VA2A 4I27A 3ZDAA 2KZMA 4YD1A 4P4MA 3GILA 8ICYA 5KFFA 2W9BB 3JPQA 3T5HA 4DF4A 3C21A 4AT7A 1X9MA 5J2AA 2W9CB 4X4UA 4X4NA 1XU4A 3JPRA 4PPXA 2ZH7A 1SL2A 2ZJ8A 5D49A 3BQ2A 2PI4A 2HHWA 3RJJA 3H8SA 2R8HA 7ICHA 2BCRA 4RPYA 3GFKB 3HPOA 3HJ4A 4JUZA 4WC6A 4RQ4A 8ICHA 4O5CA 3K75D 2C2DA 4RWNA 4RQ7A 3RB3A 9ICPA 1XWLA 1TK0A 2F1HA 2W9MA 5KFKA 4F4XA 4C8NA 4GXJA 5DBBA 3Q8SB 3PX6A 3Q8MA 1ZQCA 4JK1A 2UVRA 3TQ1A 9ICBA 1Q79A 1S10A 3RH6A 3RJKA 7ICLA 3B0YA 4MFCA 4ELTA 5J2KA 4NLKA 3MR3A 1QSLA 5KFQA 1KTQA 5KFBA 5BOMA 3OJUA 4O3QA 4DOCA 3RRHA 5HP4A 3Q8QB 1U45A 8ICVA 2ZH9A 2ZUCA 5KFSA 3OUYB 3MR6A 4P4OA 3QZ7A 1X9SA 2WTFA 2ALZA 4IQTA 1N48A 3SI8A 5J0XA 3T5LA 5HRIA 3RAQA 3JPTA 3E2EA 7ICEA 5DEDA 3UQ0A 1T3NA 3AQLA 1COOA 1RYRA 8ICCA 3C66A 4UD5A 2BR0A 1KDHA 1TFYA 1ZYQA 3WFOA 3M8RA 2FMPA 3ZDDA 5KFPA 4YMNA 2W9CA 5IILA 1ZQRA 4KTQA 4GC7A 4O9MA 3EWAA 3UPQA 1FA0A 2ZH1A 1ZQMA 5KFAA 1SL1A 5KFYA 2DPIA 8ICPA 4EEYA 1R8CA 1DGSA 3QEBZ 2ISOA 2XCAA 4WBZA 3NGDA 3C18A 4IQVA 8ICUA 2M2WA 1TAQA 3C23A 4O3PA 4EYHB 3HW8A 4ED1A 2AJQA 3ETLA 2FPLA 1QSYA 4GXIA 5CP2A 5HRKA 1VFGA 4WC1A 5KFXA 1WCLA 5KFUA 4K4IA 9ICIA 4YCXA 3PNCA 4KN7A 4F5PA 3SV4A 3MR5A 1N56A 1A76A 4IG8A 2AU0A 1U4BA 3FDSA 2ZTDA 4Z6EA 4FBUA 5DB8A 2C2RA 4F3OA 2IHMA 4I2AA 2FMQA 7ICPA 1TK5A 1KEJA 2IBKA 3RR8A 4PH5A 5L1IA 9ICOA 1ZJMA 1NK6A 2ZHBA 2VA8A 5IIIA 4X4RA 3PW2A 3LWMA 1JX4A 8ICKA 2JZBA 3KHGA 3HIYA 1KFDA 1S97A 3HWTA 1U48A 4NLNA 5J2EA 3HX0A 4ECUA 5KG3A 4RQ3A 4DFJA 5TZVA 2JEIA 1AROP 5KT6A 2PFQA 4JV2A 2V4RA 2UVWA 3OVAA 5HHIA 2MUTA 3V6HA 1NJXA 8ICSA 4DL6A 3EPGA 4EP7A 4X0AA 3RH5A 5KG7A 1KFSA 4I29A 7ICVA 4O3NA 3UQ2A 4R8UB 2Y1JA 2XY7A 1DK3A 3H7IA 5CJ7A 4DO9A 2Y1IA 2Q66A 3KTQA 3EPIA 4DSFA 5DQHA 2XO7A 3G6VA 1NK8A 8ICMA 4KMUA 5KT3A 3LQCB 4IRCA 4QZHA 5KFOA 1SL0A 1T7PA 4B9VA 1DK2A 3OHBA 4WBYA 3GIMA 4NKUA 4J9KA 3H8JA 5DB7A 5DB9A 2P6RA 3PMLA 3SZ2A 2A1JB 5KFCA 1V4AA 2PFOA 5KFWA 5F9NA 3GV8B 1NJWA 1L3UA 4WC4A 1S0MA 2FPKA 3C5FA 2V4QA 4RNOA 1XSLA 4PHEA 3PO4A 4I2CA 4KLDA 8ICZA 4O3SA 5KTQA 5KG5A 1RXWA 5J0QA 4ECTA 2PI5A 1NZPA 2HHQA 5HRBA 3OVBA 3ZDCA 4NLGA 5J0PA 9ICQA 1D9FA 2KFNA 2ISPA 4J9MA 7ICKA 2M2UA 5DDYA 3OV7A 2BCVA 5J2HA 4RQ2A 4UB2A 3MABA 4QWEA 5KT7A 4QZBA 3LWLA 4DOBA 3Q8KA 5J2DA 9ICTA 4YD2A 1SKRA 2DRBA 4UBCA 5JUMA 1A77A 3M9MB 4FHXA 4QWDA 4ED7A 2P66A 4YN4A 2NRVA 4DFPA 1MC8A 4FHPA 3TANA 2XGQA 1NK4A 4M9NA 3G6XA 4DQSA 4B9TA 4EZ9A 9ICAA 3LK9A 4C8LA 3KHRA 2Q0ZX 4X4QA 4I2IA 5J2IA 8ICAA 5DLGA 1ZQAA 1ZQBA 2ZH8A 5DG9A 5DKWA 4B9SA 3HP6A 3C2KA 1S0VA 8ICRA 8ICFA 9ICRA 2AGPA 1ZQIA 5DDMA 1ZQVA 4LT6A 4X4OA 1BNPA 1PZNA 4ECZA 5HMMA 4KN4A 4UB3A 4F50A 3TFRA 3JPOA 4LZDA 1D8YA 4B9LA 2A1JA 1U9LA 5KT5A 3V6JA 3TAPA 4FBTA 5J29A 2AQ0A 2BCQA 2HHVA 1B43A 4RT2A 5EOZA 1JAJA 2HHPA 3WFPA 3GIIA 1CUKA 4IR1A 4MF2A 4JV1A 1NO5A 3PW0A 3C5GA 5KG0A 4NKTA 5HNKA 3SYZA 3TFSA 2ZUBA
chains in the Genus database with same CATH superfamily
3F5EA 1L5UA 4R65A 4UAYA 4X5VA 4DFMA 3PSTA 3KOOA 1SWVA 2DKZA 3RJHA 5KFJA 4LEZA 4Q45A 5KFGA 4J9PA 2HHTA 3VC8A 4NLBA 5L1JA 2XGPA 1BPBA 2NRKA 2H3ZA 2R8KA 3OPXA 5CHEA 4PHDA 3EF2A 5KG6A 1ZQGA 4O6AA 1QH9A 3RJGA 1XSPA 1Q46A 4ATBB 5ALSA 2OEHA 2NO4A 4S3NA 3UPSA 4N7RA 4K96A 3L3FX 4DWIA 5KFZA 1L7PA 4PGXA 3RB4A 3BJYA 5J2FA 3RJFA 4KITB 1ZQQA 4NM1A 2RFFA 4AT8B 2RQ5A 4PHPA 3MCRA 2AH5A 4DEZA 1HUOA 3RB0A 5AK3A 4Q8EA 2BQ3A 4ED2A 3PSIA 4DQPA 2GAFD 4C8OA 1SGGA 2HBJA 4NJ8A 5KFHA 4DOAA 4E0DA 1HUZA 4QZ9A 1L8OA 4RQ6A 1X9XA 5D4BA 4WC0A 5CB1A 3F5AA 1K1QA 3QUBA 3MDAA 4JMUA 1XO1A 4CE6A 1Z00B 1BPEA 3SEIA 4KLGA 1IV8A 2ZJAA 1NI3A 1WWVA 4UB5A 2J6TA 5K4LA 4RQ5A 5F9LA 2RLTA 2WF9A 3H8WA 4Y2TA 2LM4A 1ZQUA 4HAIA 4MF8A 5C5JA 2BHNA 3V7JA 5ALWA 4DS4A 4JWMA 4F72A 5AM3A 1PK3A 1NJZA 1B22A 3N97B 3OTQA 1LV5A 1PUZA 4X4PA 2LKYA 4WC5A 2YMMA 1KRPA 3T5KA 1Q78A 4LEYA 4G3IA 3T3FA 1L8LA 4R8UA 1S77D 2NYVA 1ZQEA 3BQ0A 4OAFA 5KFTA 4ED0A 4UBBA 1Q3UA 2C22A 2E8OA 2ZUDA 2AGQA 4TQRA 1FEZA 3RJIA 3TAQA 3H3AA 1ZQYA 3HT3A 4F2RA 3KD3A 4DL7A 2KMDA 3BDPA 4YFKA 4X4TA 1IIPA 3QUQA 7ICJA 2DWQA 2WFAA 2D8CA 4BXOA 1CEZA 9ICQA 1TK8A 8ICJA 3C2MA 1ZETA 4EBJA 1JN3A 5IIKA 3WU2U 8ICNA 4QZ8A 2ID1A 5KFLA 2YB4A 2R8IA 2PBEA 2WB1F 3RTVA 1FIQA 4RNMA 3VCBA 1U49A 4NWIA 3RAXA 3ZDEA 4M9HA 4ECRA 2BGWA 9ICGA 4DL4A 3OSNA 2W11A 1L3TA 4DSLA 1RM6C 1AQ6A 4PGYA 1UEUA 3RR7A 4RT3A 4WC3A 4FO1A 2F2AB 2NRWA 1NJYA 3B9JA 5HMLA 4QZDA 3KKAC 1NKEA 2GA9D 2IOHA 1MQ2A 3PV8A 3D2SA 3K7DA 2B21A 1ZQXA 2EANA 4KLFA 4MFAA 4DSJA 1T8EA 1KL9A 4UW9A 5CEHA 4F5QA 1SKSA 5CRXA 3RBEA 1KSPA 4E80A 3KZIU 1YT3A 2ZXIA 9ICHA 2B0CA 4J9RA 4K97A 2WHEA 1O03A 4AP9A 3MR2A 4RQMA 4GXKA 1Q3VA 5JTGA 5CR0A 1QQ6A 1ZOLA 2VJ4A 1PX5A 5AM4A 1NK7A 1Q8KA 2HHUA 3M7DA 2OM6A 5AHXA 5ALZA 4FZNA 3ISDA 4AT7B 1P7DA 5EE9A 4F71A 1ZXIA 2QARB 3NTUA 2JR5A 3CK6A 3T79A 4F92B 2O5AA 1JROA 3B0XA 3EYZA 4RNNA 1ZQKA 2HOQA 3BZKA 5CA7A 2DQNB 2H3FA 3MFIA 3AN1A 1N5XA 1D8LA 2H3VA 1SKWA 3OGUA 2B4VA 2DF4B 3NKUA 4ACOA 2W43A 2Y0SC 1GPJA 1TFWA 4RQ1A 1S0OA 5KAFU 9ICNA 4LZGA 4YMMA 5FP0A 5HREA 1XO0A 3QYPA 4WQLA 4RPXA 1R8AA 2YY6A 4Y2JA 2O1PA 4M2YA 2DKXA 3SAHA 5ALEA 4I27A 3ZDAA 4YD1A 3T5HA 4DF4A 2KHVA 5D62A 4PPXA 2HHWA 3H8SA 4RPYA 3HPOA 2FE9A 4WC6A 4O5CA 3RF9A 3I76A 1OXJA 4OD0A 4RQ7A 1TK0A 4F4XA 5AK6A 1Z19A 4P0QB 2UVRA 1S10A 3ER8C 3RJKA 4ELTA 4FZLA 5J2KA 3MR3A 1QSLA 2K8BB 3BS7A 4DOCA 2ZH9A 4NXTA 3ER9B 2ALZA 3TADA 2KVSA 3SI8A 3T5LA 4UATA 7ICEA 5DEDA 3UQ0A 3AQLA 2F77X 1MA7A 8ICCA 1FFUA 1DXSA 1KDHA 2FMPA 4LEWA 4NXXA 4YMNA 5KFPA 4KTQA 3UPQA 1FA0A 1LKYA 8ICPA 4WBZA 3NGDA 4IQVA 3C23A 4EYHB 2HI0A 1QSYA 4EEDA 5B3QA 5A0LA 2HCFA 3QU5A 3QU9A 4K4IA 2HMXA 4YCXA 3PNCA 9ICIA 3SV4A 1SIJA 1N56A 4J03A 4OJLA 1U4BA 3FDSA 2ZTDA 2KZZA 3OUYA 9ICOA 5AKJA 3KKAA 3LWMA 3HWTA 4NLNA 5J2EA 2ZIWB 3U26A 5TZVA 4U6PA 3OVAA 4KM5A 2K4IA 5HHIA 3V6HA 8ICSA 4EP7A 4Y2UA 4I29A 4O3NA 2Y1JA 2XY7A 2A1AA 3FC4A 3KTQA 2YX8A 1T94A 3HRDD 1NK8A 3L5KA 5AIBA 2W7PA 2D3DA 3OHBA 4J9KA 5AI8A 4K98A 3QUCA 3PMLA 3SZ2A 5KFCA 2PFOA 1L3UA 1S0MA 2FPKA 4RNOA 4KLDA 3BQ7A 8ICZA 5KG5A 4ECTA 2KFNA 4JLXA 2WAQC 3OV7A 4UB2A 4P0PB 5KNIA 4DOBA 3Q8KA 5J2DA 3TKAA 5D61A 2DRBA 5JUMA 2P66A 2KK0A 2NRVA 1JRPA 3TANA 1UQVA 1NK4A 9ICAA 2Q0ZX 5AKLA 4KB6A 2HBLA 2JV3A 1ZQBA 3H0RB 5ALXA 1VDVA 5DKWA 3C2KA 8ICRA 4AT9B 9ICRA 4UB6U 3IV6A 4IL6U 4B9LA 4FBTA 3TAPA 2HHVA 2BCQA 2HHPA 4MF2A 5AK5A 4IC9A 1D8BA 3TARA 3IHQB 2GLEA 2NRXA 4B9NA 2OHFA 5L9XA 4IRDA 3NRZA 5JU5A 1F5SA 2KN7A 5HRGA 3AQKA 4Z6FA 3F2CA 1BGXT 5DB6A 7ICOA 1RQLA 2F1IA 5HRLA 2RDJA 1RXVA 3L9DA 2LMRA 9ICUA 4IS7A 3C2LA 4F91B 4YXJA 1L7OA 3LVVA 5D63A 4PHAA 1MIVA 4IR9A 2HDOA 2XY5A 5AICA 4GIBA 4Y2RA 3F53A 2GWSA 1NOMA 5KG4A 4ICAA 4B6JA 4R64A 1L3SA 5CFTA 5AM5A 4R63A 4K8VA 2OWOA 4I28A 3BQ1A 4YR3A 5G5HA 4I2FA 2DUYA 8ICOA 2ZH3A 2E5SA 4DSIA 2CN1A 3MFHA 2R8GA 2BPGA 8ICQA 2HHXA 2ZIXB 2Y9TA 5DBAA 8ICXA 1F5AA 3TACB 4U7CA 4F4ZA 1ZQDA 5KL8B 4RZRA 4TQSA 5HHHA 5ALRA 3ICXA 3MBYA 2ZJ5A 2DR9A 4J9LA 1RPLA 2DL0A 5KL1B 4HYKA 3GU3A 4WJ3B 3H38A 2XIDA 4F2SA 8ICGA 3RFAA 4ECQA 2OXOA 1ZQZA 2EZYA 2FJ6A 5E79U 5EWFA 4DQRA 3PR5B 1Z00A 1ZQJA 5EWEA 4PGQA 4KLUA 4WOYA 2WF5A 4YQWA 4QIWC 3IG8A 4IQUA 3ISBA 4DQQA 3JPSA 4X0BA 4MFFA 2EH9A 4TURA 3NVWA 4XQ8A 2RHFA 4J9OA 4YMOA 4Y2XA 5J0RA 2XY6A 3M6ZA 3BQTA 5GTIU 4CRXA 3JPNA 1ZQHA 4DLEA 1EXNA 3LYSA 8ICEA 4P4PA 4M9LA 4F4KA 1RZTA 4JLZA 2ZH2A 2DR8A 1ZQTA 5HR7A 5AI5A 5KG2A 2XCPA 2YMPA 4OJPA 5H2FU 4IRKA 4OJ5A 5ALUA 1M6YA 1F0MA 5L1MA 3ONNA 4XJEA 1QTMA 7ICNA 4I2BA 3AU6A 2LM1A 3GV5B 2VANA 3MGIA 4FH3A 1ZD4A 2G5IB 4M04A 2JZBB 2KSOB 3T5JA 2Y0SF 3WK4A 1ZQNA 1UA0A 4EBDA 2OCEA 4ECSA 3H39A 2MUTB 3KFUF 4NXZA 4Q43A 5J8YA 4NM2A 2ZH4A 1NK5A 3GIJA 2G07A 5AKXA 4I2JA 3OHAA 5J0YA 1B4FA 5B3PA 4K9BA 3QXGA 5EE1A 3WKAA 4J9QA 2W8LA 5CFUA 3SMVA 1RYSA 3N7PD 2IOFA 5KFMA 2I6XA 2W03A 1TFRA 5AI9A 4B9UA 2EAOA 4F5OA 2F3NA 2F8KA 4LVSA 4EX7A 2HW3A 3D6JA 2E1EA 2W3RA 5J2JA 4F5RA 4KLHA 3OSPA 1QQ7A 5KFVA 4QZGA 1RDFA 5KFDA 2F76X 2K4HA 2EZZA 4BDPA 2KP7A 1DRGA 2KJ9A 2CPRA 4QW8A 2ZIVA 3F2BA 3NRWA 1BPYA 4QNLA 1QLNA 2K89A 1V9PA 2H5XA 2YB1A 3R9KA 5F3XB 1PVRA 1TVAA 4B9MA 5KFIA 9ICJA 2UVUA 2M2TA 2BCUA 1L3VA 2E8MA 1RG6A 2ASLA 4QZCA 4KLEA 2BCSA 2VKQA 4WCWA 2QB1A 3GIKA 5DG7A 1BPXA 4I2DA 2LYHA 3PMNA 2AGOA 2BZFA 1BVSA 1URJA 1MSWD 3M8SA 2BPFA 2EDUA 5DGBA 4C8KA 2XICA 4J9NA 2VA2A 2KZMA 1YZ7A 3GILA 2HSZA 4AT7A 3DV9A 2ZIUB 3TADC 2W9CB 2QARA 1XU4A 4X4NA 3JPRA 2ZH7A 5D49A 3RJJA 3D2NA 2BCRA 3GFKB 4PL1A 2VJ5A 1N63A 3K75D 4US8A 1RQNA 4GXJA 2F1HA 2KNJA 5DBBA 3Q8MA 9ICBA 2E3TA 5AM1A 4MFCA 5ALPA 5KFQA 1U45A 4O3QA 1V97A 1GO3F 5AKIA 8ICVA 2WAQF 3MR6A 3QZ7A 1X9SA 2WTFA 5AI0A 1Z1VA 3JPTA 3SD7A 3E2EA 3DDHA 5EE3A 3HILA 3M8RA 3HKZC 1ZQRA 1SL1A 2JGAA 1DGSA 3QEBZ 3C18A 2M2WA 4O3PA 3HW8A 2AJQA 2FPLA 1Z4OA 4PZOA 4P0QA 1WCLA 5KFUA 4K99A 4KN7A 2AU0A 4FBUA 2ZH6A 2C2RA 4F3OA 3QU2A 4I2AA 2FMQA 5L1IA 2ZHBA 5ALJA 2VA8A 2PMZF 8ICKA 2JH7A 3HIYA 1KFDA 3HX0A 4RQ3A 4PZNA 1KBUA 3RH5A 1SXEA 7ICVA 4R8UB 2Q66A 4DO9A 5CJ7A 2Y1IA 1L7MA 5DQHA 3LQCB 1T7PA 3GIMA 4KX3A 2HOIA 2A1JB 5F9NA 3GV8B 1NJWA 4WC4A 1XNSA 3PO4A 5G5GA 5J0QA 3ZDCA 5J0PA 7ICKA 4J9MA 4QZBA 3LWLA 2ZXHA 5T14A 9ICTA 2ZIWA 3PSPA 2W04A 1SKRA 4UBCA 3N7RC 4YN4A 1J2MA 1MC8A 4FHPA 3H0LB 4M9NA 3LK9A 4C8LA 2ZH8A 3HP6A 2HBMA 1S0VA 4FHWA 2AGPA 3N28A 1KQQA 3NVOA 4X4OA 1BNPA 1PZNA 4BJQA 5HMMA 4UB3A 4F50A 3TFRA 4CF4A 5ALTA 3FM9A 5KT5A 1FO4A 1ED1A 5J29A 2AQ0A 2EQYA 1B43A 3GIIA 4JV1A 3L4PA 3AM9A 5HNKA 5AKEA 3PW7A 3PHZA 2RP5A 5KFNA 4RUAA 5DBCA 4CF3A 4OCZA 4WC7A 2QKQA 4EBCA 4DL2A 2KIWA 2BQRA 2IHNA 2LBOA 3GQCA 3PR4A 2KE7A 3TI0A 4M47A 4C8MA 2PFPA 2M9NA 1K1SA 2I9GA 8ICWA 5ALDA 1WG8A 2EAPA 9ICXA 2W9BA 3F2DA 9ICLA 4NLCA 2YQEA 4QIWF 4BGDA 1NKCA 5AKZA 3RJEA 1MQ3A 4ED8A 5HRFA 1SWWA 3N4MB 2KV2A 2OYYA 2ATLA 3CW2C 4AYBC 2LI6A 2FMSA 3G6YA 3KHLA 4GFJA 1X42A 2GH1A 1UT5A 1DOQA 4ED6A 3GDXA 5DLFA 4I2EA 5BPCA 4BWMA 3MGVA 4ELUA 4Z6CA 1NK0A 1S8OA 1SZHA 1COKA 3HJ1A 4LEVA 4RQNA 2KJ8A 4DS5A 4JB3A 2NRZA 3RRGA 2ZG6A 3AQNA 4CCHA 9ICVA 3UXOA 2NV3A 3RB6A 4DCCA 2BKEA 3NYBA 5IIJA 1WOTA 5AM2A 4DSEA 2KFZA 3WFQE 1ZQSA 3SAFA 3PY8A 2AQ4A 3AEVA 2AXTU 2H3IA 2J6SA 5IIOA 4KLOA 3M1YA 2W3SA 5D46A 5J2BA 4EYIB 2MAXA 3C1YA 3Q8RB 3WFRE 1BPZA 4ECXA 5AK4A 1UEVA 8ICTA 2UVVA 3OVSA 2B56A 1NKBA 3AQEA 1HJPA 4CGZA 2DR5A 4RWQA 4NV0A 4RWPA 2HBKA 4EV6A 3ORYA 3HJEA 4USAA 1N5WA 4KLQA 2I1QA 4YXMA 3PVXA 2R18A 3D2QA 7ICRA 4MEXA 2ZIXA 4MKPA 4KLSA 4TUSA 3UMGA 3ISCA 1ZQFA 2W9AA 4BWJA 4QZEA 4DFDA 3S6JA 3SV3A 2FPMA 1K5OA 3ETRA 1Y88A 4UB1A 2KTQA 4RUCA 2MA1A 3IN5A 4UD4A 4QJFB 4FH5A 5EE0A 2C28A 1WYGA 4YR2A 4QWCA 5J0WA 5KG1A 4ELVA 7ICTA 3IM1A 4M6WB 1UETA 5HR6A 1N61A 2KICA 1V85A 4ZH4A 1H38A 1Z4NA 3IRUA 3BS5B 3OJSA 1JIHA 5ALMA 4NL9A 3QE9Y 2W55A 4C0ZA 4O3MA 5J2CA 3NASA 1ZQWA 4KX5A 5J8YC 1ZQOA 2C2EA 1ECWA 2E1FA 3WKDA 3WFSC 4EEBA 2XC9A 2N1RA 4M0AA 1BPDA 5DQIA 5CWRA 2ZTEA 4WQKA 1R89A 2YMLA 2ZH5A 2BDPA 3ALRA 4O67A 3ERCC 4MEYA 2ASDA 2JEFA 3JPPA 1S76D 2KJ5A 3WK6A 2ESEA 4OJOA 2FLPA 3NVYA 4FS2A 1YLQA 1VJ5A 1QSSA 2MSNA 1FFVA 1ZQPA 3PX4A 4DSKA 4QZIA 1IXRA 3I1YA 3IG5A 3WKCA 4RQ8A 1X9WA 3WK8A 2YTUA 5CFSA 3H4BA 4ATBA 2CRXA 2KIVA 4OAIZ 2V9WA 1X66A 4PL2A 3I28A 7ICQA 4ED3A 3FYHA 2E8PA 2HVIA 4AT8A 3WKEA 2K8CB 5IINA 4HX0A 3PW4A 7ICGA 3A0HU 5DG8A 3UXNA 4P2HA 1CRXA 1MIYA 3V72A 1NZBA 7ICSA 3NVZA 3H0MB 3HKZF 4EELA 3M9NB 3UXPA 4NY8A 2P35A 4YR0A 5J0SA 1ZJNA 5DGAA 4EBEA 4YVZA 4TUPA 5AIAA 3ZD8A 1T4GA 2HVHA 4RU9A 4QWBA 2DRAA 2KZ3A 1KFTA 4E8FA 4K9AA 3Q8LA 4JWNA 4KLJA 1PK1B 2VA3A 2R8JA 2M2VA 4O69A 4R66A 4UAZA 3N7SC 4TUQA 2B51A 3CP8A 1MN8A 5ALKA 3LVWA 3NUQA 1KKXA 4NXVA 4F4YA 4CF5A 3JPQA 1TAMA 3C21A 5J2AA 4X4UA 4BX9C 1SL2A 3NVVA 2PI4A 3BQ2A 3E58A 7ICHA 3HJ4A 4JUZA 4RQ4A 2C2DA 9ICPA 1J97A 1TKDA 2W9MA 5KFKA 4C8NA 3PX6A 1ZQCA 4JK1A 1X6IA 7ICLA 3B0YA 4C4TA 4OAHA 4EGWA 5BOMA 2ZUCA 2D6FC 5KFSA 4P4OA 1N48A 5J0XA 3QU7A 3RAQA 2JMGA 1RYRA 1HEKA 2W54A 3PSFA 1ZYQA 2ZIUA 3ZDDA 2A19A 5IILA 2W9CA 5KFAA 5KFYA 2DPIA 1L6NA 2XCAA 2MRLA 4NXUA 1TAQA 2MU2A 4ED1A 4KMOB 4GXIA 5HRKA 1VFGA 4WC1A 5KFXA 1OW5A 3PZPA 7ICPA 2QB0B 2IHMA 3FAHA 2LYBA 4Y2PA 1TK5A 2IBKA 1NK6A 4CDGA 4US9A 5IIIA 4X4RA 3PW2A 3KHGA 4ZOHC 5ALHA 1U48A 4ECUA 4WH5A 2JEIA 5AM0A 2G08A 5KT6A 2FCLA 2F44A 3NWIA 1NJXA 4Y2VA 4DL6A 3EPGA 3E0FA 5KG7A 1KFSA 3UQ2A 3EPIA 3G6VA 1N2XA 4XQ7A 4X4VA 5KT3A 4IRCA 4NKUA 1VLBA 5DB7A 5DB9A 2KOBA 5KFWA 5B66U 2IHOA 5AKGA 4PHEA 4I2CA 4AYBF 4O3SA 1IG6A 2PI5A 5HRBA 1D9FA 2ISPA 2XI9A 2M2UA 5DDYA 2BCVA 1N62A 4RQ2A 3IDWA 3MABA 5C0YA 1LVHA 1A77A 4UARA 4FHXA 2EAMA 2XGQA 4DQSA 4EZ9A 4I2IA 2FDRA 4C80A 8ICAA 5DLGA 1UCVA 4UB8U 5DG9A 8ICFA 1X6JA 1ZQIA 5DDMA 4ECZA 4CNQA 2K8AA 2GOLA 3M6KA 4KN4A 4UAUA 3JPOA 4LZDA 1D8YA 2A1JA 1U9LA 5AI4A 3V6JA 1JAJA 1CUKA 5ALVA 4IR1A 1NO5A 3PW0A 3C5GA 5KG0A 3SYZA 3TFSA 1BNOA 2KD1A 3H37A 2Z7JA 4ECYA 7ICUA 4I2GA 5ALQA 2ZTCA 2PXIA 1LB2B 1Z3EB 3GZFA 4M5DA 3NS1A 4GC6A 3KBBA 4PJ0U 1VJ7A 1KN5A 3K1RB 4QZFA 1IM4A 3EZ5A 2BBJA 3J81j 1F44A 1X40A 4I2HA 1SZPA 3QX7A 5HR9A 3AU2A 5ALNA 3PW5A 1U47A 2EZXA 1X2IA 3WKBA 2W8KA 2NO5A 4Q44A 4RQ0A 5J2GA 3V6KA 4Z6DA 3LDAA 1JMSA 3H4DA 3C29A 4IQWA 2ODGA 2YN4A 1UA1A 5J0TA 2IA6A 1ZQ1C 3C28A 2Q4TA 2IOFK 3H8MA 4C7ZA 2G5HB 2VIXA 3MDCA 2RDIA 4QW9A 5EWGA 1Z1BA 2BBHA 1C7YA 2ASJA 2ZIVB 1XC9A 2B6GA 2K60A 4FS1A 2GO7A 1ZD5A 2BPCA 4DL5A 4Y2QA 2BE3A 2HOFA 1HIWA 1ZQLA 3SR6A 4XUSA 2WF6A 2JEJA 5IIMA 1UHUA 1MIWA 3ED5A 2E8NA 4GLXA 2G06A 4EZ6A 2WF7A 9ICEA 4DQIA 3PX0A 1S9FA 9ICMA 1SXDA 4OO1J 3IP4B 9ICFA 2FLLA 4KLMA 2KVCA 2BQUA 3C1ZA 2WF8A 2ES6A 4FHVA 2JXJA 4WC2A 4UAWA 4UB4A 1ZD2P 4F93B 5HC9A 3GV7B 4EENA 4BXOB 3V7LA 5ALFA 5ALGA 2G0AA 3SENA 1O08A 3RBDA 5DQGA 5TISU 4K4HA 3ZD9A 4DLGA 2BDUA 3THVA 3OWGA 3UMBA 4OJ6A 2AHOB 4X4SA 4Q8FA 2K4PA 3RH4A 4RWOA 4NL9C 1OUQA 2G09A 3JYYA 1D9DA 4YP3A 4EEKA 1TAUA 9ICKA 3JCFA 2LYAA 2DR7A 4YG2A 3Q8PB 5BOLA 3ZDBA 1SV0C 4UAVA 4P0PA 1WCNA 1NK9A 5ALYA 2HHSA 1QQ5A 4O3RA 5KFRA 5J0OA 5L1LA 5HRDA 4O68A 4E7XA 2H3QA 4O3OA 4FE3A 2QLTA 4AT9A 4KLIA 2A3VA 1KW4A 4QZAA 1V38A 4O5EA 3UMCA 4F5NA 1N60A 2ZHAA 1ZRNA 5KFEA 2LPEA 1NNLA 4O5KA 4O0IA 2P6UA 4XRHA 4BUGA 4M6WA 3WK9A 3AMZA 1WWUA 3QEAZ 3BS5A 4XA5A 8ICLA 1S0NA 3AQMA 5J0UA 4OAGA 3ZI4A 4DL3A 4F4WA 5CHGA 1TV9A 1S5LU 1QCKA 4EX6A 4FHYA 2IMWP 4F8RA 1XSNA 7ICMA 1T3QA 2YMQA 5KT2A 4DF8A 4QWAA 2L5YA 4I0UA 5AKYA 3CYMA 4ECWA 2FLNA 2OH2A 9ICSA 5GTHU 3PO5A 4DFKA 4FO6A 3V7KA 1UT8A 2NRTA 4JV0A 2DBYA 7ICFA 3K4GA 5KT4A 4M9GA 4LJXA 1WUDA 5JRTA 9ICCA 2JEGA 2CXYA 3M9OB 3H40A 1ZRMA 2DFLA 1KLNA 1PVPA 4J9SA 3KZXA 1C20A 3DEEA 9ICWA 4KLTA 4ECVA 1R8BA 4A8EA 2PFNA 5L1KA 1XS9D 8ICBA 7ICIA 5AKHA 2HN1A 5AKKA 2KKPA 2WB1C 3CNHA 1SV4A 1JQRA 2IUBA 3MGHA 4NLZA 4KLLA 3EW9A 4MHVA 1JXLA 4UQGA 3AUOA 5HRHA 4K4GA 3MC1A 3QZ8A 3QUTA 4RPZA 2DPJA 3CRXA 1CI4A 1OU5A 3SAGA 3JZ0A 5DECA 1JXEA 1RYUA 2F1JA 2J6UA 5F2VO 1JALA 8ICIA 2JRZA 1KNYA 3KHHA 4M9JA 5AI6A 2DVIA 4P4MA 8ICYA 5KFFA 2W9BB 1X9MA 3BZCA 1J2NA 4UASA 2ZJ8A 1LKYB 2HN2A 3QU4A 2R8HA 5B5EU 8ICHA 4RWNA 3RB3A 1XWLA 1L7NA 5ALOA 1DGJA 3K1ZA 3Q8SB 3TQ1A 1Q79A 3RH6A 5ALLA 1A6SA 3O0FA 4NLKA 5KFBA 3OJUA 1KTQA 3RRHA 2PMZC 5HP4A 1SV0A 1PK1A 3UM9A 3Q8QB 3OUYB 1YZ6A 4IQTA 5HRIA 2KG5A 1T3NA 1COOA 2JHDA 3C66A 4UD5A 2BR0A 1TFYA 3WFOA 4O9MA 2ZH1A 4GC7A 3EWAA 1A0PA 1ZQMA 1R8CA 4EEYA 1JUDA 1JI7A 2ISOA 8ICUA 3ETLA 5CP2A 1SB3C 2KHQA 2W7OA 4C4SA 4F5PA 3MR5A 1A76A 4IG8A 4Z6EA 5DB8A 2Y9UA 3RR8A 1KEJA 4NXWA 4PH5A 1ZJMA 2KKVA 1JX4A 2JZBA 2KSOA 1S97A 5KG3A 4DFJA 1AROP 2PFQA 4JV2A 2V4RA 2UVWA 1TE2A 2MUTA 4X0AA 5JTIA 1DK3A 3H7IA 3AQFA 2RRDA 4Y2YA 4DSFA 2XVTA 1ZD3A 2XO7A 8ICMA 4KMUA 1DK2A 4QZHA 5KFOA 1SL0A 2O6KA 4B9VA 4WBYA 2M0NA 2JH1A 3H8JA 2P6RA 2PKEA 1XSLA 3C5FA 2V4QA 5KTQA 1RXWA 2KEYA 3WK7A 5KAIU 3OVBA 1NZPA 2HHQA 4NLGA 2QB0A 2LHTA 5J2HA 3QNMA 2FI1A 4FFDA 4QWEA 5KT7A 1B0XA 2K4EA 5ALIA 4Y2SA 4YD2A 1UPHA 3M9MB 4G9BA 2I5HA 4QWDA 4ED7A 4DFPA 3AL0B 3G6XA 1PVQA 3WK5A 4B9TA 4C7YA 3KHRA 4X4QA 5J2IA 1ZQAA 4B9SA 1ZQVA 4LT6A 4C4RA 2DGZA 3A0BU 1V4AA 4EBKA 4FZMA 3SQIA 4RT2A 5EOZA 3WFPA 3EUB2 2EWRA 4NKTA 2F8LA 2ZUBA
chains in the Genus database with same CATH topology
3H37A 3TARA 1L5UA 4R65A 3PW7A 4ECYA 4UAYA 4X5VA 4DFMA 7ICUA 5KFNA 3RJHA 4RUAA 5KFJA 3IHQB 4Q45A 4I2GA 5KFGA 5DBCA 2NRXA 2ZTCA 4J9PA 4B9NA 2PXIA 1LB2B 1Z3EB 5L9XA 2HHTA 2KZZA 4M5DA 4IRDA 5L1JA 4WC7A 2XGPA 4GC6A 1BPBA 4EBCA 2NRKA 4DL2A 2BQRA 2IHNA 2KN7A 1VJ7A 3GQCA 3PR4A 2R8KA 3TI0A 4PHDA 5KG6A 4QZFA 4M47A 1IM4A 4C8MA 1ZQGA 2PFPA 5HRGA 2M9NA 1K1SA 4Z6FA 3EZ5A 1XSPA 2I9GA 3RJGA 8ICWA 4I2HA 3AQKA 1BGXT 4ATBB 1SZPA 5DB6A 7ICOA 2F1IA 9ICXA 4S3NA 5HR9A 3AU2A 3PW5A 1U47A 2W9BA 2RDJA 5HRLA 1X2IA 2W8KA 3UPSA 1RXVA 4DWIA 5KFZA 4PGXA 4Q44A 9ICLA 3L9DA 4RQ0A 4BGDA 3RB4A 5J2GA 3V6KA 4Z6DA 9ICUA 3BJYA 3LDAA 1NKCA 5J2FA 3C2LA 3RJEA 3RJFA 1JMSA 4KITB 1MQ3A 4ED8A 1ZQQA 4F91B 3H4DA 3N4MB 5HRFA 4NM1A 2RFFA 4IQWA 4YXJA 4AT8B 2ATLA 1BNOA 2FMSA 4PHPA 3G6YA 3KHLA 4PHAA 4DEZA 1UA1A 5J0TA 2IA6A 1HUOA 4IR9A 1MIVA 1UT5A 1DOQA 3RB0A 4Q8EA 4ED6A 3GDXA 5DLFA 2BQ3A 2XY5A 3MDCA 5BPCA 4ED2A 2RDIA 4QW9A 4I2EA 4DQPA 4BWMA 4ELUA 5EWGA 4Z6CA 2GWSA 1NOMA 4C8OA 5KG4A 1NK0A 5KFHA 4DOAA 4R64A 1C7YA 1L3SA 2ASJA 3HJ1A 4E0DA 1HUZA 4QZ9A 4R63A 1XC9A 4X4VA 4RQ6A 4DS5A 5D4BA 2OWOA 2NRZA 4FS1A 4I28A 3BQ1A 3RRGA 4WC0A 4YR3A 4EBKA 4I2FA 5CB1A 8ICOA 1K1QA 3AQNA 3MDAA 4CCHA 2ZH3A 9ICVA 2BPCA 1XO1A 3UXOA 4DL5A 3RB6A 4DSIA 2BKEA 2BE3A 5IIJA 3MFHA 3NYBA 1Z00B 1BPEA 2BPGA 2R8GA 8ICQA 1WOTA 4KLGA 2HHXA 1ZQLA 4XUSA 4DSEA 2JEJA 2ZJAA 5IIMA 2KFZA 1MIWA 3WFQE 4UB5A 5DBAA 4GLXA 2J6TA 4RQ5A 5F9LA 4EZ6A 9ICEA 1ZQSA 3PY8A 3PX0A 4DQIA 8ICXA 1S9FA 3H8WA 2AQ4A 1F5AA 9ICMA 4F4ZA 2ZH6A 1ZQDA 2J6SA 5IIOA 4KLOA 1ZQUA 4RZRA 4MF8A 5C5JA 5J2BA 5D46A 4EYIB 2BHNA 2MAXA 3C1YA 4TQSA 3V7JA 2FLLA 9ICFA 4KLMA 5HHHA 2BQUA 3MBYA 3C1ZA 2ZJ5A 3Q8RB 2DR9A 1BPZA 4J9LA 1RPLA 4ECXA 4FHVA 3WFRE 4DS4A 1UEVA 4JWMA 4WC2A 8ICTA 2UVVA 4UAWA 4HYKA 3OVSA 4UB4A 1NJZA 4F93B 3H38A 1B22A 1NKBA 3GV7B 4BXOB 5HC9A 1HJPA 3N97B 3V7LA 4F2SA 8ICGA 1LV5A 4X4PA 2DR5A 4RWQA 4RWPA 4ECQA 3RBDA 4WC5A 5DQGA 3ORYA 1ZQZA 4DQRA 3T5KA 5EWFA 1KRPA 4K4HA 1Q78A 3ZD9A 4DLGA 3PR5B 3T3FA 1Z00A 1ZQJA 4KLQA 2I1QA 4G3IA 4YXMA 5EWEA 4R8UA 3PVXA 3THVA 7ICRA 4MEXA 4PGQA 1S77D 4KLUA 4YQWA 1ZQEA 3BQ0A 4KLSA 4X4SA 5KFTA 4IQUA 3ISBA 4TUSA 4UBBA 3ISCA 4DQQA 3JPSA 4ED0A 1ZQFA 4Q8FA 2W9AA 4MFFA 4X0BA 2DRAA 4TURA 4BWJA 3RH4A 2C22A 4RWOA 2ZUDA 2AGQA 4XQ8A 4QZEA 4TQRA 3JYYA 1D9DA 4YP3A 4J9OA 3RJIA 4YMOA 3SV3A 2FPMA 3TAQA 1TAUA 1ZQYA 9ICKA 3H3AA 5J0RA 3HT3A 4F2RA 2XY6A 1Y88A 4DL7A 4UB1A 2KTQA 3BDPA 3BQTA 4RUCA 2DR7A 4YFKA 4X4TA 4YG2A 3JPNA 4UD4A 3Q8PB 7ICJA 1ZQHA 5BOLA 3ZDBA 4FH5A 4DLEA 2C28A 1EXNA 4YR2A 4QWCA 5J0WA 4BXOA 5KG1A 4ELVA 1CEZA 3IM1A 7ICTA 1WCNA 4M6WB 1TK8A 1NK9A 8ICEA 2HHSA 8ICJA 4P4PA 1UETA 4O3RA 1TKDA 3C2MA 4M9LA 4ZH4A 5KFRA 4F4KA 1RZTA 1H38A 5J0OA 2ZH2A 5L1LA 3OJSA 1JIHA 1ZETA 2DR8A 4EBJA 1JN3A 5IIKA 5HRDA 3QE9Y 1ZQTA 8ICNA 4FHWA 4QZ8A 2ID1A 5KFLA 5KG2A 4E7XA 2XCPA 5J2CA 2R8IA 2PBEA 1ZQWA 4O3OA 1ZQOA 2C2EA 3RTVA 4IRKA 4AT9A 4KLIA 3WFSC 4RNMA 1U49A 4QZAA 4O5EA 3RAXA 3ZDEA 2XC9A 4XQ7A 4F5NA 1QTMA 4M0AA 4I2BA 3AU6A 7ICNA 1BPDA 5DQIA 5CWRA 2ZTEA 4M9HA 4ECRA 2BGWA 3GV5B 9ICGA 1R89A 2VANA 4DL4A 2ZH5A 2BDPA 3MGIA 3OSNA 2ZHAA 4FH3A 1L3TA 4DSLA 4M04A 4MEYA 4PGYA 2ASDA 2JZBB 5KFEA 3T5JA 2JEFA 3JPPA 4O5KA 1S76D 1UEUA 3RR7A 4RT3A 1ZQNA 2FLPA 4WC3A 1UA0A 4EBDA 2NRWA 4O0IA 4ECSA 2P6UA 4XRHA 4FS2A 1NJYA 3H39A 2MUTB 1YLQA 4NXZA 4Q43A 1QSSA 4M6WA 5HMLA 4NM2A 4QZDA 1ZQPA 3QEAZ 3PX4A 2ZH4A 1NKEA 1NK5A 3GIJA 1MQ2A 3PV8A 4XA5A 4DSKA 8ICLA 1S0NA 3AQMA 4AT9B 5J0UA 4QZIA 4I2JA 3OHAA 1IXRA 5J0YA 1X9WA 4RQ8A 2B21A 1ZQXA 4J9QA 4KLFA 2W8LA 4DL3A 4MFAA 4F4WA 4DSJA 3H4BA 1T8EA 4ATBA 1RYSA 5CHGA 1TV9A 4F5QA 1SKSA 3RBEA 1KSPA 4E80A 5KFMA 4FHYA 2IMWP 4F8RA 1XSNA 2V9WA 7ICMA 9ICHA 1TFRA 7ICQA 5KT2A 4DF8A 4QWAA 4ED3A 4ECWA 2FLNA 4B9UA 9ICSA 3FYHA 4J9RA 3PO5A 4DFKA 3MR2A 4FO6A 4F5OA 2HVIA 4GXKA 3V7KA 4LVSA 1UT8A 4AT8A 2NRTA 5IINA 4JV0A 2HW3A 5CR0A 7ICFA 3K4GA 5KT4A 5J2JA 3PW4A 4M9GA 7ICGA 1PX5A 4F5RA 5DG8A 3OSPA 4KLHA 5KFVA 4QZGA 1NK7A 2JEGA 3UXNA 9ICCA 3M9OB 3H40A 5KFDA 2HHUA 2DFLA 4P2HA 3OUYA 1MIYA 1KLNA 3V72A 4J9SA 7ICSA 9ICWA 4BDPA 2KP7A 4KLTA 4QW8A 3ISDA 4AT7B 4ECVA 1BPYA 1R8BA 3M9NB 3UXPA 5L1KA 1XS9D 2PFNA 4NY8A 3NTUA 8ICBA 7ICIA 1QLNA 2H5XA 1V9PA 4YR0A 5J0SA 1ZJNA 1TVAA 4B9MA 5KFIA 4F92B 1JQRA 5DGAA 9ICJA 2O5AA 3MGHA 4YVZA 4EBEA 3B0XA 3EYZA 4NLZA 4TUPA 4KLLA 4RNNA 1ZQKA 2UVUA 2M2TA 3EW9A 2BCUA 1JXLA 5CA7A 3ZD8A 1T4GA 4UQGA 1L3VA 4RU9A 4QWBA 4QZCA 2ASLA 4KLEA 2HVHA 3AUOA 3MFIA 2BCSA 5HRHA 2KZ3A 1KFTA 4K4GA 4WCWA 4E8FA 1D8LA 1SKWA 3QZ8A 3Q8LA 3OGUA 4RPZA 2DPJA 2VA3A 3GIKA 5DG7A 1BPXA 4JWNA 4KLJA 2R8JA 4I2DA 2M2VA 4R66A 1OU5A 2LYHA 4UAZA 3JZ0A 1TFWA 4RQ1A 1S0OA 3PMNA 5DECA 9ICNA 4TUQA 1JXEA 2AGOA 4YMMA 4LZGA 2F1JA 2J6UA 1MSWD 1BVSA 5HREA 3M8SA 4RPXA 1R8AA 2BPFA 5F2VO 5DGBA 8ICIA 4C8KA 2O1PA 4M2YA 1KNYA 3KHHA 4F4YA 4M9JA 2DVIA 4J9NA 2VA2A 4I27A 3ZDAA 2KZMA 4YD1A 4P4MA 3GILA 8ICYA 5KFFA 2W9BB 3JPQA 3T5HA 4DF4A 3C21A 4AT7A 1X9MA 5J2AA 2W9CB 4X4UA 4X4NA 1XU4A 3JPRA 4PPXA 2ZH7A 1SL2A 2ZJ8A 5D49A 3BQ2A 2PI4A 2HHWA 3RJJA 3H8SA 2R8HA 7ICHA 2BCRA 4RPYA 3GFKB 3HPOA 3HJ4A 4JUZA 4WC6A 4RQ4A 8ICHA 4O5CA 3K75D 2C2DA 4RWNA 4RQ7A 3RB3A 9ICPA 1XWLA 1TK0A 2F1HA 2W9MA 5KFKA 4F4XA 4C8NA 4GXJA 5DBBA 3Q8SB 3PX6A 3Q8MA 1ZQCA 4JK1A 2UVRA 3TQ1A 9ICBA 1Q79A 1S10A 3RH6A 3RJKA 7ICLA 3B0YA 4MFCA 4ELTA 5J2KA 4NLKA 3MR3A 1QSLA 5KFQA 1KTQA 5KFBA 5BOMA 3OJUA 4O3QA 4DOCA 3RRHA 5HP4A 3Q8QB 1U45A 8ICVA 2ZH9A 2ZUCA 5KFSA 3OUYB 3MR6A 4P4OA 3QZ7A 1X9SA 2WTFA 2ALZA 4IQTA 1N48A 3SI8A 5J0XA 3T5LA 5HRIA 3RAQA 3JPTA 3E2EA 7ICEA 5DEDA 3UQ0A 1T3NA 3AQLA 1COOA 1RYRA 8ICCA 3C66A 4UD5A 2BR0A 1KDHA 1TFYA 1ZYQA 3WFOA 3M8RA 2FMPA 3ZDDA 5KFPA 4YMNA 2W9CA 5IILA 1ZQRA 4KTQA 4GC7A 4O9MA 3EWAA 3UPQA 1FA0A 2ZH1A 1ZQMA 5KFAA 1SL1A 5KFYA 2DPIA 8ICPA 4EEYA 1R8CA 1DGSA 3QEBZ 2ISOA 2XCAA 4WBZA 3NGDA 3C18A 4IQVA 8ICUA 2M2WA 1TAQA 3C23A 4O3PA 4EYHB 3HW8A 4ED1A 2AJQA 3ETLA 2FPLA 1QSYA 4GXIA 5CP2A 5HRKA 1VFGA 4WC1A 5KFXA 1WCLA 5KFUA 4K4IA 9ICIA 4YCXA 3PNCA 4KN7A 4F5PA 3SV4A 3MR5A 1N56A 1A76A 4IG8A 2AU0A 1U4BA 3FDSA 2ZTDA 4Z6EA 4FBUA 5DB8A 2C2RA 4F3OA 2IHMA 4I2AA 2FMQA 7ICPA 1TK5A 1KEJA 2IBKA 3RR8A 4PH5A 5L1IA 9ICOA 1ZJMA 1NK6A 2ZHBA 2VA8A 5IIIA 4X4RA 3PW2A 3LWMA 1JX4A 8ICKA 2JZBA 3KHGA 3HIYA 1KFDA 1S97A 3HWTA 1U48A 4NLNA 5J2EA 3HX0A 4ECUA 5KG3A 4RQ3A 4DFJA 5TZVA 2JEIA 1AROP 5KT6A 2PFQA 4JV2A 2V4RA 2UVWA 3OVAA 5HHIA 2MUTA 3V6HA 1NJXA 8ICSA 4DL6A 3EPGA 4EP7A 4X0AA 3RH5A 5KG7A 1KFSA 4I29A 7ICVA 4O3NA 3UQ2A 4R8UB 2Y1JA 2XY7A 1DK3A 3H7IA 5CJ7A 4DO9A 2Y1IA 2Q66A 3KTQA 3EPIA 4DSFA 5DQHA 2XO7A 3G6VA 1NK8A 8ICMA 4KMUA 5KT3A 3LQCB 4IRCA 4QZHA 5KFOA 1SL0A 1T7PA 4B9VA 1DK2A 3OHBA 4WBYA 3GIMA 4NKUA 4J9KA 3H8JA 5DB7A 5DB9A 2P6RA 3PMLA 3SZ2A 2A1JB 5KFCA 1V4AA 2PFOA 5KFWA 5F9NA 3GV8B 1NJWA 1L3UA 4WC4A 1S0MA 2FPKA 3C5FA 2V4QA 4RNOA 1XSLA 4PHEA 3PO4A 4I2CA 4KLDA 8ICZA 4O3SA 5KTQA 5KG5A 1RXWA 5J0QA 4ECTA 2PI5A 1NZPA 2HHQA 5HRBA 3OVBA 3ZDCA 4NLGA 5J0PA 9ICQA 1D9FA 2KFNA 2ISPA 4J9MA 7ICKA 2M2UA 5DDYA 3OV7A 2BCVA 5J2HA 4RQ2A 4UB2A 3MABA 4QWEA 5KT7A 4QZBA 3LWLA 4DOBA 3Q8KA 5J2DA 9ICTA 4YD2A 1SKRA 2DRBA 4UBCA 5JUMA 1A77A 3M9MB 4FHXA 4QWDA 4ED7A 2P66A 4YN4A 2NRVA 4DFPA 1MC8A 4FHPA 3TANA 2XGQA 1NK4A 4M9NA 3G6XA 4DQSA 4B9TA 4EZ9A 9ICAA 3LK9A 4C8LA 3KHRA 2Q0ZX 4X4QA 4I2IA 5J2IA 8ICAA 5DLGA 1ZQAA 1ZQBA 2ZH8A 5DG9A 5DKWA 4B9SA 3HP6A 3C2KA 1S0VA 8ICRA 8ICFA 9ICRA 2AGPA 1ZQIA 5DDMA 1ZQVA 4LT6A 4X4OA 1BNPA 1PZNA 4ECZA 5HMMA 4KN4A 4UB3A 4F50A 3TFRA 3JPOA 4LZDA 1D8YA 4B9LA 2A1JA 1U9LA 5KT5A 3V6JA 3TAPA 4FBTA 5J29A 2AQ0A 2BCQA 2HHVA 1B43A 4RT2A 5EOZA 1JAJA 2HHPA 3WFPA 3GIIA 1CUKA 4IR1A 4MF2A 4JV1A 1NO5A 3PW0A 3C5GA 5KG0A 4NKTA 5HNKA 3SYZA 3TFSA 2ZUBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H37 A;  3TAR A;  1L5U A;  4R65 A;  3PW7 A;  4ECY A;  4UAY A;  4X5V A;  4DFM A;  7ICU A;  5KFN A;  3RJH A;  4RUA A;  5KFJ A;  3IHQ B;  4Q45 A;  4I2G A;  5KFG A;  5DBC A;  2NRX A;  2ZTC A;  4J9P A;  4B9N A;  2PXI A;  1LB2 B;  1Z3E B;  5L9X A;  2HHT A;  2KZZ A;  4M5D A;  4IRD A;  5L1J A;  4WC7 A;  2XGP A;  4GC6 A;  1BPB A;  4EBC A;  2NRK A;  4DL2 A;  2BQR A;  2IHN A;  2KN7 A;  1VJ7 A;  3GQC A;  3PR4 A;  2R8K A;  3TI0 A;  4PHD A;  5KG6 A;  4QZF A;  4M47 A;  1IM4 A;  4C8M A;  1ZQG A;  2PFP A;  5HRG A;  2M9N A;  1K1S A;  4Z6F A;  3EZ5 A;  1XSP A;  2I9G A;  3RJG A;  8ICW A;  4I2H A;  3AQK A;  1BGX T;  4ATB B;  1SZP A;  5DB6 A;  7ICO A;  2F1I A;  9ICX A;  4S3N A;  5HR9 A;  3AU2 A;  3PW5 A;  1U47 A;  2W9B A;  2RDJ A;  5HRL A;  1X2I A;  2W8K A;  3UPS A;  1RXV A;  4DWI A;  5KFZ A;  4PGX A;  4Q44 A;  9ICL A;  3L9D A;  4RQ0 A;  4BGD A;  3RB4 A;  5J2G A;  3V6K A;  4Z6D A;  9ICU A;  3BJY A;  3LDA A;  1NKC A;  5J2F A;  3C2L A;  3RJE A;  3RJF A;  1JMS A;  4KIT B;  1MQ3 A;  4ED8 A;  1ZQQ A;  4F91 B;  3H4D A;  3N4M B;  5HRF A;  4NM1 A;  2RFF A;  4IQW A;  4YXJ A;  4AT8 B;  2ATL A;  1BNO A;  2FMS A;  4PHP A;  3G6Y A;  3KHL A;  4PHA A;  4DEZ A;  1UA1 A;  5J0T A;  2IA6 A;  1HUO A;  4IR9 A;  1MIV A;  1UT5 A;  1DOQ A;  3RB0 A;  4Q8E A;  4ED6 A;  3GDX A;  5DLF A;  2BQ3 A;  2XY5 A;  3MDC A;  5BPC A;  4ED2 A;  2RDI A;  4QW9 A;  4I2E A;  4DQP A;  4BWM A;  4ELU A;  5EWG A;  4Z6C A;  2GWS A;  1NOM A;  4C8O A;  5KG4 A;  1NK0 A;  5KFH A;  4DOA A;  4R64 A;  1C7Y A;  1L3S A;  2ASJ A;  3HJ1 A;  4E0D A;  1HUZ A;  4QZ9 A;  4R63 A;  1XC9 A;  4X4V A;  4RQ6 A;  4DS5 A;  5D4B A;  2OWO A;  2NRZ A;  4FS1 A;  4I28 A;  3BQ1 A;  3RRG A;  4WC0 A;  4YR3 A;  4EBK A;  4I2F A;  5CB1 A;  8ICO A;  1K1Q A;  3AQN A;  3MDA A;  4CCH A;  2ZH3 A;  9ICV A;  2BPC A;  1XO1 A;  3UXO A;  4DL5 A;  3RB6 A;  4DSI A;  2BKE A;  2BE3 A;  5IIJ A;  3MFH A;  3NYB A;  1Z00 B;  1BPE A;  2BPG A;  2R8G A;  8ICQ A;  1WOT A;  4KLG A;  2HHX A;  1ZQL A;  4XUS A;  4DSE A;  2JEJ A;  2ZJA A;  5IIM A;  2KFZ A;  1MIW A;  3WFQ E;  4UB5 A;  5DBA A;  4GLX A;  2J6T A;  4RQ5 A;  5F9L A;  4EZ6 A;  9ICE A;  1ZQS A;  3PY8 A;  3PX0 A;  4DQI A;  8ICX A;  1S9F A;  3H8W A;  2AQ4 A;  1F5A A;  9ICM A;  4F4Z A;  2ZH6 A;  1ZQD A;  2J6S A;  5IIO A;  4KLO A;  1ZQU A;  4RZR A;  4MF8 A;  5C5J A;  5J2B A;  5D46 A;  4EYI B;  2BHN A;  2MAX A;  3C1Y A;  4TQS A;  3V7J A;  2FLL A;  9ICF A;  4KLM A;  5HHH A;  2BQU A;  3MBY A;  3C1Z A;  2ZJ5 A;  3Q8R B;  2DR9 A;  1BPZ A;  4J9L A;  1RPL A;  4ECX A;  4FHV A;  3WFR E;  4DS4 A;  1UEV A;  4JWM A;  4WC2 A;  8ICT A;  2UVV A;  4UAW A;  4HYK A;  3OVS A;  4UB4 A;  1NJZ A;  4F93 B;  3H38 A;  1B22 A;  1NKB A;  3GV7 B;  4BXO B;  5HC9 A;  1HJP A;  3N97 B;  3V7L A;  4F2S A;  8ICG A;  1LV5 A;  4X4P A;  2DR5 A;  4RWQ A;  4RWP A;  4ECQ A;  3RBD A;  4WC5 A;  5DQG A;  3ORY A;  1ZQZ A;  4DQR A;  3T5K A;  5EWF A;  1KRP A;  4K4H A;  1Q78 A;  3ZD9 A;  4DLG A;  3PR5 B;  3T3F A;  1Z00 A;  1ZQJ A;  4KLQ A;  2I1Q A;  4G3I A;  4YXM A;  5EWE A;  4R8U A;  3PVX A;  3THV A;  7ICR A;  4MEX A;  4PGQ A;  1S77 D;  4KLU A;  4YQW A;  1ZQE A;  3BQ0 A;  4KLS A;  4X4S A;  5KFT A;  4IQU A;  3ISB A;  4TUS A;  4UBB A;  3ISC A;  4DQQ A;  3JPS A;  4ED0 A;  1ZQF A;  4Q8F A;  2W9A A;  4MFF A;  4X0B A;  2DRA A;  4TUR A;  4BWJ A;  3RH4 A;  2C22 A;  4RWO A;  2ZUD A;  2AGQ A;  4XQ8 A;  4QZE A;  4TQR A;  3JYY A;  1D9D A;  4YP3 A;  4J9O A;  3RJI A;  4YMO A;  3SV3 A;  2FPM A;  3TAQ A;  1TAU A;  1ZQY A;  9ICK A;  3H3A A;  5J0R A;  3HT3 A;  4F2R A;  2XY6 A;  1Y88 A;  4DL7 A;  4UB1 A;  2KTQ A;  3BDP A;  3BQT A;  4RUC A;  2DR7 A;  4YFK A;  4X4T A;  4YG2 A;  3JPN A;  4UD4 A;  3Q8P B;  7ICJ A;  1ZQH A;  5BOL A;  3ZDB A;  4FH5 A;  4DLE A;  2C28 A;  1EXN A;  4YR2 A;  4QWC A;  5J0W A;  4BXO A;  5KG1 A;  4ELV A;  1CEZ A;  3IM1 A;  7ICT A;  1WCN A;  4M6W B;  1TK8 A;  1NK9 A;  8ICE A;  2HHS A;  8ICJ A;  4P4P A;  1UET A;  4O3R A;  1TKD A;  3C2M A;  4M9L A;  4ZH4 A;  5KFR A;  4F4K A;  1RZT A;  1H38 A;  5J0O A;  2ZH2 A;  5L1L A;  3OJS A;  1JIH A;  1ZET A;  2DR8 A;  4EBJ A;  1JN3 A;  5IIK A;  5HRD A;  3QE9 Y;  1ZQT A;  8ICN A;  4FHW A;  4QZ8 A;  2ID1 A;  5KFL A;  5KG2 A;  4E7X A;  2XCP A;  5J2C A;  2R8I A;  2PBE A;  1ZQW A;  4O3O A;  1ZQO A;  2C2E A;  3RTV A;  4IRK A;  4AT9 A;  4KLI A;  3WFS C;  4RNM A;  1U49 A;  4QZA A;  4O5E A;  3RAX A;  3ZDE A;  2XC9 A;  4XQ7 A;  4F5N A;  1QTM A;  4M0A A;  4I2B A;  3AU6 A;  7ICN A;  1BPD A;  5DQI A;  5CWR A;  2ZTE A;  4M9H A;  4ECR A;  2BGW A;  3GV5 B;  9ICG A;  1R89 A;  2VAN A;  4DL4 A;  2ZH5 A;  2BDP A;  3MGI A;  3OSN A;  2ZHA A;  4FH3 A;  1L3T A;  4DSL A;  4M04 A;  4MEY A;  4PGY A;  2ASD A;  2JZB B;  5KFE A;  3T5J A;  2JEF A;  3JPP A;  4O5K A;  1S76 D;  1UEU A;  3RR7 A;  4RT3 A;  1ZQN A;  2FLP A;  4WC3 A;  1UA0 A;  4EBD A;  2NRW A;  4O0I A;  4ECS A;  2P6U A;  4XRH A;  4FS2 A;  1NJY A;  3H39 A;  2MUT B;  1YLQ A;  4NXZ A;  4Q43 A;  1QSS A;  4M6W A;  5HML A;  4NM2 A;  4QZD A;  1ZQP A;  3QEA Z;  3PX4 A;  2ZH4 A;  1NKE A;  1NK5 A;  3GIJ A;  1MQ2 A;  3PV8 A;  4XA5 A;  4DSK A;  8ICL A;  1S0N A;  3AQM A;  4AT9 B;  5J0U A;  4QZI A;  4I2J A;  3OHA A;  1IXR A;  5J0Y A;  1X9W A;  4RQ8 A;  2B21 A;  1ZQX A;  4J9Q A;  4KLF A;  2W8L A;  4DL3 A;  4MFA A;  4F4W A;  4DSJ A;  3H4B A;  1T8E A;  4ATB A;  1RYS A;  5CHG A;  1TV9 A;  4F5Q A;  1SKS A;  3RBE A;  1KSP A;  4E80 A;  5KFM A;  4FHY A;  2IMW P;  4F8R A;  1XSN A;  2V9W A;  7ICM A;  9ICH A;  1TFR A;  7ICQ A;  5KT2 A;  4DF8 A;  4QWA A;  4ED3 A;  4ECW A;  2FLN A;  4B9U A;  9ICS A;  3FYH A;  4J9R A;  3PO5 A;  4DFK A;  3MR2 A;  4FO6 A;  4F5O A;  2HVI A;  4GXK A;  3V7K A;  4LVS A;  1UT8 A;  4AT8 A;  2NRT A;  5IIN A;  4JV0 A;  2HW3 A;  5CR0 A;  7ICF A;  3K4G A;  5KT4 A;  5J2J A;  3PW4 A;  4M9G A;  7ICG A;  1PX5 A;  4F5R A;  5DG8 A;  3OSP A;  4KLH A;  5KFV A;  4QZG A;  1NK7 A;  2JEG A;  3UXN A;  9ICC A;  3M9O B;  3H40 A;  5KFD A;  2HHU A;  2DFL A;  4P2H A;  3OUY A;  1MIY A;  1KLN A;  3V72 A;  4J9S A;  7ICS A;  9ICW A;  4BDP A;  2KP7 A;  4KLT A;  4QW8 A;  3ISD A;  4AT7 B;  4ECV A;  1BPY A;  1R8B A;  3M9N B;  3UXP A;  5L1K A;  1XS9 D;  2PFN A;  4NY8 A;  3NTU A;  8ICB A;  7ICI A;  1QLN A;  2H5X A;  1V9P A;  4YR0 A;  5J0S A;  1ZJN A;  1TVA A;  4B9M A;  5KFI A;  4F92 B;  1JQR A;  5DGA A;  9ICJ A;  2O5A A;  3MGH A;  4YVZ A;  4EBE A;  3B0X A;  3EYZ A;  4NLZ A;  4TUP A;  4KLL A;  4RNN A;  1ZQK A;  2UVU A;  2M2T A;  3EW9 A;  2BCU A;  1JXL A;  5CA7 A;  3ZD8 A;  1T4G A;  4UQG A;  1L3V A;  4RU9 A;  4QWB A;  4QZC A;  2ASL A;  4KLE A;  2HVH A;  3AUO A;  3MFI A;  2BCS A;  5HRH A;  2KZ3 A;  1KFT A;  4K4G A;  4WCW A;  4E8F A;  1D8L A;  1SKW A;  3QZ8 A;  3Q8L A;  3OGU A;  4RPZ A;  2DPJ A;  2VA3 A;  3GIK A;  5DG7 A;  1BPX A;  4JWN A;  4KLJ A;  2R8J A;  4I2D A;  2M2V A;  4R66 A;  1OU5 A;  2LYH A;  4UAZ A;  3JZ0 A;  1TFW A;  4RQ1 A;  1S0O A;  3PMN A;  5DEC A;  9ICN A;  4TUQ A;  1JXE A;  2AGO A;  4YMM A;  4LZG A;  2F1J A;  2J6U A;  1MSW D;  1BVS A;  5HRE A;  3M8S A;  4RPX A;  1R8A A;  2BPF A;  5F2V O;  5DGB A;  8ICI A;  4C8K A;  2O1P A;  4M2Y A;  1KNY A;  3KHH A;  4F4Y A;  4M9J A;  2DVI A;  4J9N A;  2VA2 A;  4I27 A;  3ZDA A;  2KZM A;  4YD1 A;  4P4M A;  3GIL A;  8ICY A;  5KFF A;  2W9B B;  3JPQ A;  3T5H A;  4DF4 A;  3C21 A;  4AT7 A;  1X9M A;  5J2A A;  2W9C B;  4X4U A;  4X4N A;  1XU4 A;  3JPR A;  4PPX A;  2ZH7 A;  1SL2 A;  2ZJ8 A;  5D49 A;  3BQ2 A;  2PI4 A;  2HHW A;  3RJJ A;  3H8S A;  2R8H A;  7ICH A;  2BCR A;  4RPY A;  3GFK B;  3HPO A;  3HJ4 A;  4JUZ A;  4WC6 A;  4RQ4 A;  8ICH A;  4O5C A;  3K75 D;  2C2D A;  4RWN A;  4RQ7 A;  3RB3 A;  9ICP A;  1XWL A;  1TK0 A;  2F1H A;  2W9M A;  5KFK A;  4F4X A;  4C8N A;  4GXJ A;  5DBB A;  3Q8S B;  3PX6 A;  3Q8M A;  1ZQC A;  4JK1 A;  2UVR A;  3TQ1 A;  9ICB A;  1Q79 A;  1S10 A;  3RH6 A;  3RJK A;  7ICL A;  3B0Y A;  4MFC A;  4ELT A;  5J2K A;  4NLK A;  3MR3 A;  1QSL A;  5KFQ A;  1KTQ A;  5KFB A;  5BOM A;  3OJU A;  4O3Q A;  4DOC A;  3RRH A;  5HP4 A;  3Q8Q B;  1U45 A;  8ICV A;  2ZH9 A;  2ZUC A;  5KFS A;  3OUY B;  3MR6 A;  4P4O A;  3QZ7 A;  1X9S A;  2WTF A;  2ALZ A;  4IQT A;  1N48 A;  3SI8 A;  5J0X A;  3T5L A;  5HRI A;  3RAQ A;  3JPT A;  3E2E A;  7ICE A;  5DED A;  3UQ0 A;  1T3N A;  3AQL A;  1COO A;  1RYR A;  8ICC A;  3C66 A;  4UD5 A;  2BR0 A;  1KDH A;  1TFY A;  1ZYQ A;  3WFO A;  3M8R A;  2FMP A;  3ZDD A;  5KFP A;  4YMN A;  2W9C A;  5IIL A;  1ZQR A;  4KTQ A;  4GC7 A;  4O9M A;  3EWA A;  3UPQ A;  1FA0 A;  2ZH1 A;  1ZQM A;  5KFA A;  1SL1 A;  5KFY A;  2DPI A;  8ICP A;  4EEY A;  1R8C A;  1DGS A;  3QEB Z;  2ISO A;  2XCA A;  4WBZ A;  3NGD A;  3C18 A;  4IQV A;  8ICU A;  2M2W A;  1TAQ A;  3C23 A;  4O3P A;  4EYH B;  3HW8 A;  4ED1 A;  2AJQ A;  3ETL A;  2FPL A;  1QSY A;  4GXI A;  5CP2 A;  5HRK A;  1VFG A;  4WC1 A;  5KFX A;  1WCL A;  5KFU A;  4K4I A;  9ICI A;  4YCX A;  3PNC A;  4KN7 A;  4F5P A;  3SV4 A;  3MR5 A;  1N56 A;  1A76 A;  4IG8 A;  2AU0 A;  1U4B A;  3FDS A;  2ZTD A;  4Z6E A;  4FBU A;  5DB8 A;  2C2R A;  4F3O A;  2IHM A;  4I2A A;  2FMQ A;  7ICP A;  1TK5 A;  1KEJ A;  2IBK A;  3RR8 A;  4PH5 A;  5L1I A;  9ICO A;  1ZJM A;  1NK6 A;  2ZHB A;  2VA8 A;  5III A;  4X4R A;  3PW2 A;  3LWM A;  1JX4 A;  8ICK A;  2JZB A;  3KHG A;  3HIY A;  1KFD A;  1S97 A;  3HWT A;  1U48 A;  4NLN A;  5J2E A;  3HX0 A;  4ECU A;  5KG3 A;  4RQ3 A;  4DFJ A;  5TZV A;  2JEI A;  1ARO P;  5KT6 A;  2PFQ A;  4JV2 A;  2V4R A;  2UVW A;  3OVA A;  5HHI A;  2MUT A;  3V6H A;  1NJX A;  8ICS A;  4DL6 A;  3EPG A;  4EP7 A;  4X0A A;  3RH5 A;  5KG7 A;  1KFS A;  4I29 A;  7ICV A;  4O3N A;  3UQ2 A;  4R8U B;  2Y1J A;  2XY7 A;  1DK3 A;  3H7I A;  5CJ7 A;  4DO9 A;  2Y1I A;  2Q66 A;  3KTQ A;  3EPI A;  4DSF A;  5DQH A;  2XO7 A;  3G6V A;  1NK8 A;  8ICM A;  4KMU A;  5KT3 A;  3LQC B;  4IRC A;  4QZH A;  5KFO A;  1SL0 A;  1T7P A;  4B9V A;  1DK2 A;  3OHB A;  4WBY A;  3GIM A;  4NKU A;  4J9K A;  3H8J A;  5DB7 A;  5DB9 A;  2P6R A;  3PML A;  3SZ2 A;  2A1J B;  5KFC A;  1V4A A;  2PFO A;  5KFW A;  5F9N A;  3GV8 B;  1NJW A;  1L3U A;  4WC4 A;  1S0M A;  2FPK A;  3C5F A;  2V4Q A;  4RNO A;  1XSL A;  4PHE A;  3PO4 A;  4I2C A;  4KLD A;  8ICZ A;  4O3S A;  5KTQ A;  5KG5 A;  1RXW A;  5J0Q A;  4ECT A;  2PI5 A;  1NZP A;  2HHQ A;  5HRB A;  3OVB A;  3ZDC A;  4NLG A;  5J0P A;  9ICQ A;  1D9F A;  2KFN A;  2ISP A;  4J9M A;  7ICK A;  2M2U A;  5DDY A;  3OV7 A;  2BCV A;  5J2H A;  4RQ2 A;  4UB2 A;  3MAB A;  4QWE A;  5KT7 A;  4QZB A;  3LWL A;  4DOB A;  3Q8K A;  5J2D A;  9ICT A;  4YD2 A;  1SKR A;  2DRB A;  4UBC A;  5JUM A;  1A77 A;  3M9M B;  4FHX A;  4QWD A;  4ED7 A;  2P66 A;  4YN4 A;  2NRV A;  4DFP A;  1MC8 A;  4FHP A;  3TAN A;  2XGQ A;  1NK4 A;  4M9N A;  3G6X A;  4DQS A;  4B9T A;  4EZ9 A;  9ICA A;  3LK9 A;  4C8L A;  3KHR A;  2Q0Z X;  4X4Q A;  4I2I A;  5J2I A;  8ICA A;  5DLG A;  1ZQA A;  1ZQB A;  2ZH8 A;  5DG9 A;  5DKW A;  4B9S A;  3HP6 A;  3C2K A;  1S0V A;  8ICR A;  8ICF A;  9ICR A;  2AGP A;  1ZQI A;  5DDM A;  1ZQV A;  4LT6 A;  4X4O A;  1BNP A;  1PZN A;  4ECZ A;  5HMM A;  4KN4 A;  4UB3 A;  4F50 A;  3TFR A;  3JPO A;  4LZD A;  1D8Y A;  4B9L A;  2A1J A;  1U9L A;  5KT5 A;  3V6J A;  3TAP A;  4FBT A;  5J29 A;  2AQ0 A;  2BCQ A;  2HHV A;  1B43 A;  4RT2 A;  5EOZ A;  1JAJ A;  2HHP A;  3WFP A;  3GII A;  1CUK A;  4IR1 A;  4MF2 A;  4JV1 A;  1NO5 A;  3PW0 A;  3C5G A;  5KG0 A;  4NKT A;  5HNK A;  3SYZ A;  3TFS A;  2ZUB A; 
#chains in the Genus database with same CATH topology
 3F5E A;  1L5U A;  4R65 A;  4UAY A;  4X5V A;  4DFM A;  3PST A;  3KOO A;  1SWV A;  2DKZ A;  3RJH A;  5KFJ A;  4LEZ A;  4Q45 A;  5KFG A;  4J9P A;  2HHT A;  3VC8 A;  4NLB A;  5L1J A;  2XGP A;  1BPB A;  2NRK A;  2H3Z A;  2R8K A;  3OPX A;  5CHE A;  4PHD A;  3EF2 A;  5KG6 A;  1ZQG A;  4O6A A;  1QH9 A;  3RJG A;  1XSP A;  1Q46 A;  4ATB B;  5ALS A;  2OEH A;  2NO4 A;  4S3N A;  3UPS A;  4N7R A;  4K96 A;  3L3F X;  4DWI A;  5KFZ A;  1L7P A;  4PGX A;  3RB4 A;  3BJY A;  5J2F A;  3RJF A;  4KIT B;  1ZQQ A;  4NM1 A;  2RFF A;  4AT8 B;  2RQ5 A;  4PHP A;  3MCR A;  2AH5 A;  4DEZ A;  1HUO A;  3RB0 A;  5AK3 A;  4Q8E A;  2BQ3 A;  4ED2 A;  3PSI A;  4DQP A;  2GAF D;  4C8O A;  1SGG A;  2HBJ A;  4NJ8 A;  5KFH A;  4DOA A;  4E0D A;  1HUZ A;  4QZ9 A;  1L8O A;  4RQ6 A;  1X9X A;  5D4B A;  4WC0 A;  5CB1 A;  3F5A A;  1K1Q A;  3QUB A;  3MDA A;  4JMU A;  1XO1 A;  4CE6 A;  1Z00 B;  1BPE A;  3SEI A;  4KLG A;  1IV8 A;  2ZJA A;  1NI3 A;  1WWV A;  4UB5 A;  2J6T A;  5K4L A;  4RQ5 A;  5F9L A;  2RLT A;  2WF9 A;  3H8W A;  4Y2T A;  2LM4 A;  1ZQU A;  4HAI A;  4MF8 A;  5C5J A;  2BHN A;  3V7J A;  5ALW A;  4DS4 A;  4JWM A;  4F72 A;  5AM3 A;  1PK3 A;  1NJZ A;  1B22 A;  3N97 B;  3OTQ A;  1LV5 A;  1PUZ A;  4X4P A;  2LKY A;  4WC5 A;  2YMM A;  1KRP A;  3T5K A;  1Q78 A;  4LEY A;  4G3I A;  3T3F A;  1L8L A;  4R8U A;  1S77 D;  2NYV A;  1ZQE A;  3BQ0 A;  4OAF A;  5KFT A;  4ED0 A;  4UBB A;  1Q3U A;  2C22 A;  2E8O A;  2ZUD A;  2AGQ A;  4TQR A;  1FEZ A;  3RJI A;  3TAQ A;  3H3A A;  1ZQY A;  3HT3 A;  4F2R A;  3KD3 A;  4DL7 A;  2KMD A;  3BDP A;  4YFK A;  4X4T A;  1IIP A;  3QUQ A;  7ICJ A;  2DWQ A;  2WFA A;  2D8C A;  4BXO A;  1CEZ A;  9ICQ A;  1TK8 A;  8ICJ A;  3C2M A;  1ZET A;  4EBJ A;  1JN3 A;  5IIK A;  3WU2 U;  8ICN A;  4QZ8 A;  2ID1 A;  5KFL A;  2YB4 A;  2R8I A;  2PBE A;  2WB1 F;  3RTV A;  1FIQ A;  4RNM A;  3VCB A;  1U49 A;  4NWI A;  3RAX A;  3ZDE A;  4M9H A;  4ECR A;  2BGW A;  9ICG A;  4DL4 A;  3OSN A;  2W11 A;  1L3T A;  4DSL A;  1RM6 C;  1AQ6 A;  4PGY A;  1UEU A;  3RR7 A;  4RT3 A;  4WC3 A;  4FO1 A;  2F2A B;  2NRW A;  1NJY A;  3B9J A;  5HML A;  4QZD A;  3KKA C;  1NKE A;  2GA9 D;  2IOH A;  1MQ2 A;  3PV8 A;  3D2S A;  3K7D A;  2B21 A;  1ZQX A;  2EAN A;  4KLF A;  4MFA A;  4DSJ A;  1T8E A;  1KL9 A;  4UW9 A;  5CEH A;  4F5Q A;  1SKS A;  5CRX A;  3RBE A;  1KSP A;  4E80 A;  3KZI U;  1YT3 A;  2ZXI A;  9ICH A;  2B0C A;  4J9R A;  4K97 A;  2WHE A;  1O03 A;  4AP9 A;  3MR2 A;  4RQM A;  4GXK A;  1Q3V A;  5JTG A;  5CR0 A;  1QQ6 A;  1ZOL A;  2VJ4 A;  1PX5 A;  5AM4 A;  1NK7 A;  1Q8K A;  2HHU A;  3M7D A;  2OM6 A;  5AHX A;  5ALZ A;  4FZN A;  3ISD A;  4AT7 B;  1P7D A;  5EE9 A;  4F71 A;  1ZXI A;  2QAR B;  3NTU A;  2JR5 A;  3CK6 A;  3T79 A;  4F92 B;  2O5A A;  1JRO A;  3B0X A;  3EYZ A;  4RNN A;  1ZQK A;  2HOQ A;  3BZK A;  5CA7 A;  2DQN B;  2H3F A;  3MFI A;  3AN1 A;  1N5X A;  1D8L A;  2H3V A;  1SKW A;  3OGU A;  2B4V A;  2DF4 B;  3NKU A;  4ACO A;  2W43 A;  2Y0S C;  1GPJ A;  1TFW A;  4RQ1 A;  1S0O A;  5KAF U;  9ICN A;  4LZG A;  4YMM A;  5FP0 A;  5HRE A;  1XO0 A;  3QYP A;  4WQL A;  4RPX A;  1R8A A;  2YY6 A;  4Y2J A;  2O1P A;  4M2Y A;  2DKX A;  3SAH A;  5ALE A;  4I27 A;  3ZDA A;  4YD1 A;  3T5H A;  4DF4 A;  2KHV A;  5D62 A;  4PPX A;  2HHW A;  3H8S A;  4RPY A;  3HPO A;  2FE9 A;  4WC6 A;  4O5C A;  3RF9 A;  3I76 A;  1OXJ A;  4OD0 A;  4RQ7 A;  1TK0 A;  4F4X A;  5AK6 A;  1Z19 A;  4P0Q B;  2UVR A;  1S10 A;  3ER8 C;  3RJK A;  4ELT A;  4FZL A;  5J2K A;  3MR3 A;  1QSL A;  2K8B B;  3BS7 A;  4DOC A;  2ZH9 A;  4NXT A;  3ER9 B;  2ALZ A;  3TAD A;  2KVS A;  3SI8 A;  3T5L A;  4UAT A;  7ICE A;  5DED A;  3UQ0 A;  3AQL A;  2F77 X;  1MA7 A;  8ICC A;  1FFU A;  1DXS A;  1KDH A;  2FMP A;  4LEW A;  4NXX A;  4YMN A;  5KFP A;  4KTQ A;  3UPQ A;  1FA0 A;  1LKY A;  8ICP A;  4WBZ A;  3NGD A;  4IQV A;  3C23 A;  4EYH B;  2HI0 A;  1QSY A;  4EED A;  5B3Q A;  5A0L A;  2HCF A;  3QU5 A;  3QU9 A;  4K4I A;  2HMX A;  4YCX A;  3PNC A;  9ICI A;  3SV4 A;  1SIJ A;  1N56 A;  4J03 A;  4OJL A;  1U4B A;  3FDS A;  2ZTD A;  2KZZ A;  3OUY A;  9ICO A;  5AKJ A;  3KKA A;  3LWM A;  3HWT A;  4NLN A;  5J2E A;  2ZIW B;  3U26 A;  5TZV A;  4U6P A;  3OVA A;  4KM5 A;  2K4I A;  5HHI A;  3V6H A;  8ICS A;  4EP7 A;  4Y2U A;  4I29 A;  4O3N A;  2Y1J A;  2XY7 A;  2A1A A;  3FC4 A;  3KTQ A;  2YX8 A;  1T94 A;  3HRD D;  1NK8 A;  3L5K A;  5AIB A;  2W7P A;  2D3D A;  3OHB A;  4J9K A;  5AI8 A;  4K98 A;  3QUC A;  3PML A;  3SZ2 A;  5KFC A;  2PFO A;  1L3U A;  1S0M A;  2FPK A;  4RNO A;  4KLD A;  3BQ7 A;  8ICZ A;  5KG5 A;  4ECT A;  2KFN A;  4JLX A;  2WAQ C;  3OV7 A;  4UB2 A;  4P0P B;  5KNI A;  4DOB A;  3Q8K A;  5J2D A;  3TKA A;  5D61 A;  2DRB A;  5JUM A;  2P66 A;  2KK0 A;  2NRV A;  1JRP A;  3TAN A;  1UQV A;  1NK4 A;  9ICA A;  2Q0Z X;  5AKL A;  4KB6 A;  2HBL A;  2JV3 A;  1ZQB A;  3H0R B;  5ALX A;  1VDV A;  5DKW A;  3C2K A;  8ICR A;  4AT9 B;  9ICR A;  4UB6 U;  3IV6 A;  4IL6 U;  4B9L A;  4FBT A;  3TAP A;  2HHV A;  2BCQ A;  2HHP A;  4MF2 A;  5AK5 A;  4IC9 A;  1D8B A;  3TAR A;  3IHQ B;  2GLE A;  2NRX A;  4B9N A;  2OHF A;  5L9X A;  4IRD A;  3NRZ A;  5JU5 A;  1F5S A;  2KN7 A;  5HRG A;  3AQK A;  4Z6F A;  3F2C A;  1BGX T;  5DB6 A;  7ICO A;  1RQL A;  2F1I A;  5HRL A;  2RDJ A;  1RXV A;  3L9D A;  2LMR A;  9ICU A;  4IS7 A;  3C2L A;  4F91 B;  4YXJ A;  1L7O A;  3LVV A;  5D63 A;  4PHA A;  1MIV A;  4IR9 A;  2HDO A;  2XY5 A;  5AIC A;  4GIB A;  4Y2R A;  3F53 A;  2GWS A;  1NOM A;  5KG4 A;  4ICA A;  4B6J A;  4R64 A;  1L3S A;  5CFT A;  5AM5 A;  4R63 A;  4K8V A;  2OWO A;  4I28 A;  3BQ1 A;  4YR3 A;  5G5H A;  4I2F A;  2DUY A;  8ICO A;  2ZH3 A;  2E5S A;  4DSI A;  2CN1 A;  3MFH A;  2R8G A;  2BPG A;  8ICQ A;  2HHX A;  2ZIX B;  2Y9T A;  5DBA A;  8ICX A;  1F5A A;  3TAC B;  4U7C A;  4F4Z A;  1ZQD A;  5KL8 B;  4RZR A;  4TQS A;  5HHH A;  5ALR A;  3ICX A;  3MBY A;  2ZJ5 A;  2DR9 A;  4J9L A;  1RPL A;  2DL0 A;  5KL1 B;  4HYK A;  3GU3 A;  4WJ3 B;  3H38 A;  2XID A;  4F2S A;  8ICG A;  3RFA A;  4ECQ A;  2OXO A;  1ZQZ A;  2EZY A;  2FJ6 A;  5E79 U;  5EWF A;  4DQR A;  3PR5 B;  1Z00 A;  1ZQJ A;  5EWE A;  4PGQ A;  4KLU A;  4WOY A;  2WF5 A;  4YQW A;  4QIW C;  3IG8 A;  4IQU A;  3ISB A;  4DQQ A;  3JPS A;  4X0B A;  4MFF A;  2EH9 A;  4TUR A;  3NVW A;  4XQ8 A;  2RHF A;  4J9O A;  4YMO A;  4Y2X A;  5J0R A;  2XY6 A;  3M6Z A;  3BQT A;  5GTI U;  4CRX A;  3JPN A;  1ZQH A;  4DLE A;  1EXN A;  3LYS A;  8ICE A;  4P4P A;  4M9L A;  4F4K A;  1RZT A;  4JLZ A;  2ZH2 A;  2DR8 A;  1ZQT A;  5HR7 A;  5AI5 A;  5KG2 A;  2XCP A;  2YMP A;  4OJP A;  5H2F U;  4IRK A;  4OJ5 A;  5ALU A;  1M6Y A;  1F0M A;  5L1M A;  3ONN A;  4XJE A;  1QTM A;  7ICN A;  4I2B A;  3AU6 A;  2LM1 A;  3GV5 B;  2VAN A;  3MGI A;  4FH3 A;  1ZD4 A;  2G5I B;  4M04 A;  2JZB B;  2KSO B;  3T5J A;  2Y0S F;  3WK4 A;  1ZQN A;  1UA0 A;  4EBD A;  2OCE A;  4ECS A;  3H39 A;  2MUT B;  3KFU F;  4NXZ A;  4Q43 A;  5J8Y A;  4NM2 A;  2ZH4 A;  1NK5 A;  3GIJ A;  2G07 A;  5AKX A;  4I2J A;  3OHA A;  5J0Y A;  1B4F A;  5B3P A;  4K9B A;  3QXG A;  5EE1 A;  3WKA A;  4J9Q A;  2W8L A;  5CFU A;  3SMV A;  1RYS A;  3N7P D;  2IOF A;  5KFM A;  2I6X A;  2W03 A;  1TFR A;  5AI9 A;  4B9U A;  2EAO A;  4F5O A;  2F3N A;  2F8K A;  4LVS A;  4EX7 A;  2HW3 A;  3D6J A;  2E1E A;  2W3R A;  5J2J A;  4F5R A;  4KLH A;  3OSP A;  1QQ7 A;  5KFV A;  4QZG A;  1RDF A;  5KFD A;  2F76 X;  2K4H A;  2EZZ A;  4BDP A;  2KP7 A;  1DRG A;  2KJ9 A;  2CPR A;  4QW8 A;  2ZIV A;  3F2B A;  3NRW A;  1BPY A;  4QNL A;  1QLN A;  2K89 A;  1V9P A;  2H5X A;  2YB1 A;  3R9K A;  5F3X B;  1PVR A;  1TVA A;  4B9M A;  5KFI A;  9ICJ A;  2UVU A;  2M2T A;  2BCU A;  1L3V A;  2E8M A;  1RG6 A;  2ASL A;  4QZC A;  4KLE A;  2BCS A;  2VKQ A;  4WCW A;  2QB1 A;  3GIK A;  5DG7 A;  1BPX A;  4I2D A;  2LYH A;  3PMN A;  2AGO A;  2BZF A;  1BVS A;  1URJ A;  1MSW D;  3M8S A;  2BPF A;  2EDU A;  5DGB A;  4C8K A;  2XIC A;  4J9N A;  2VA2 A;  2KZM A;  1YZ7 A;  3GIL A;  2HSZ A;  4AT7 A;  3DV9 A;  2ZIU B;  3TAD C;  2W9C B;  2QAR A;  1XU4 A;  4X4N A;  3JPR A;  2ZH7 A;  5D49 A;  3RJJ A;  3D2N A;  2BCR A;  3GFK B;  4PL1 A;  2VJ5 A;  1N63 A;  3K75 D;  4US8 A;  1RQN A;  4GXJ A;  2F1H A;  2KNJ A;  5DBB A;  3Q8M A;  9ICB A;  2E3T A;  5AM1 A;  4MFC A;  5ALP A;  5KFQ A;  1U45 A;  4O3Q A;  1V97 A;  1GO3 F;  5AKI A;  8ICV A;  2WAQ F;  3MR6 A;  3QZ7 A;  1X9S A;  2WTF A;  5AI0 A;  1Z1V A;  3JPT A;  3SD7 A;  3E2E A;  3DDH A;  5EE3 A;  3HIL A;  3M8R A;  3HKZ C;  1ZQR A;  1SL1 A;  2JGA A;  1DGS A;  3QEB Z;  3C18 A;  2M2W A;  4O3P A;  3HW8 A;  2AJQ A;  2FPL A;  1Z4O A;  4PZO A;  4P0Q A;  1WCL A;  5KFU A;  4K99 A;  4KN7 A;  2AU0 A;  4FBU A;  2ZH6 A;  2C2R A;  4F3O A;  3QU2 A;  4I2A A;  2FMQ A;  5L1I A;  2ZHB A;  5ALJ A;  2VA8 A;  2PMZ F;  8ICK A;  2JH7 A;  3HIY A;  1KFD A;  3HX0 A;  4RQ3 A;  4PZN A;  1KBU A;  3RH5 A;  1SXE A;  7ICV A;  4R8U B;  2Q66 A;  4DO9 A;  5CJ7 A;  2Y1I A;  1L7M A;  5DQH A;  3LQC B;  1T7P A;  3GIM A;  4KX3 A;  2HOI A;  2A1J B;  5F9N A;  3GV8 B;  1NJW A;  4WC4 A;  1XNS A;  3PO4 A;  5G5G A;  5J0Q A;  3ZDC A;  5J0P A;  7ICK A;  4J9M A;  4QZB A;  3LWL A;  2ZXH A;  5T14 A;  9ICT A;  2ZIW A;  3PSP A;  2W04 A;  1SKR A;  4UBC A;  3N7R C;  4YN4 A;  1J2M A;  1MC8 A;  4FHP A;  3H0L B;  4M9N A;  3LK9 A;  4C8L A;  2ZH8 A;  3HP6 A;  2HBM A;  1S0V A;  4FHW A;  2AGP A;  3N28 A;  1KQQ A;  3NVO A;  4X4O A;  1BNP A;  1PZN A;  4BJQ A;  5HMM A;  4UB3 A;  4F50 A;  3TFR A;  4CF4 A;  5ALT A;  3FM9 A;  5KT5 A;  1FO4 A;  1ED1 A;  5J29 A;  2AQ0 A;  2EQY A;  1B43 A;  3GII A;  4JV1 A;  3L4P A;  3AM9 A;  5HNK A;  5AKE A;  3PW7 A;  3PHZ A;  2RP5 A;  5KFN A;  4RUA A;  5DBC A;  4CF3 A;  4OCZ A;  4WC7 A;  2QKQ A;  4EBC A;  4DL2 A;  2KIW A;  2BQR A;  2IHN A;  2LBO A;  3GQC A;  3PR4 A;  2KE7 A;  3TI0 A;  4M47 A;  4C8M A;  2PFP A;  2M9N A;  1K1S A;  2I9G A;  8ICW A;  5ALD A;  1WG8 A;  2EAP A;  9ICX A;  2W9B A;  3F2D A;  9ICL A;  4NLC A;  2YQE A;  4QIW F;  4BGD A;  1NKC A;  5AKZ A;  3RJE A;  1MQ3 A;  4ED8 A;  5HRF A;  1SWW A;  3N4M B;  2KV2 A;  2OYY A;  2ATL A;  3CW2 C;  4AYB C;  2LI6 A;  2FMS A;  3G6Y A;  3KHL A;  4GFJ A;  1X42 A;  2GH1 A;  1UT5 A;  1DOQ A;  4ED6 A;  3GDX A;  5DLF A;  4I2E A;  5BPC A;  4BWM A;  3MGV A;  4ELU A;  4Z6C A;  1NK0 A;  1S8O A;  1SZH A;  1COK A;  3HJ1 A;  4LEV A;  4RQN A;  2KJ8 A;  4DS5 A;  4JB3 A;  2NRZ A;  3RRG A;  2ZG6 A;  3AQN A;  4CCH A;  9ICV A;  3UXO A;  2NV3 A;  3RB6 A;  4DCC A;  2BKE A;  3NYB A;  5IIJ A;  1WOT A;  5AM2 A;  4DSE A;  2KFZ A;  3WFQ E;  1ZQS A;  3SAF A;  3PY8 A;  2AQ4 A;  3AEV A;  2AXT U;  2H3I A;  2J6S A;  5IIO A;  4KLO A;  3M1Y A;  2W3S A;  5D46 A;  5J2B A;  4EYI B;  2MAX A;  3C1Y A;  3Q8R B;  3WFR E;  1BPZ A;  4ECX A;  5AK4 A;  1UEV A;  8ICT A;  2UVV A;  3OVS A;  2B56 A;  1NKB A;  3AQE A;  1HJP A;  4CGZ A;  2DR5 A;  4RWQ A;  4NV0 A;  4RWP A;  2HBK A;  4EV6 A;  3ORY A;  3HJE A;  4USA A;  1N5W A;  4KLQ A;  2I1Q A;  4YXM A;  3PVX A;  2R18 A;  3D2Q A;  7ICR A;  4MEX A;  2ZIX A;  4MKP A;  4KLS A;  4TUS A;  3UMG A;  3ISC A;  1ZQF A;  2W9A A;  4BWJ A;  4QZE A;  4DFD A;  3S6J A;  3SV3 A;  2FPM A;  1K5O A;  3ETR A;  1Y88 A;  4UB1 A;  2KTQ A;  4RUC A;  2MA1 A;  3IN5 A;  4UD4 A;  4QJF B;  4FH5 A;  5EE0 A;  2C28 A;  1WYG A;  4YR2 A;  4QWC A;  5J0W A;  5KG1 A;  4ELV A;  7ICT A;  3IM1 A;  4M6W B;  1UET A;  5HR6 A;  1N61 A;  2KIC A;  1V85 A;  4ZH4 A;  1H38 A;  1Z4N A;  3IRU A;  3BS5 B;  3OJS A;  1JIH A;  5ALM A;  4NL9 A;  3QE9 Y;  2W55 A;  4C0Z A;  4O3M A;  5J2C A;  3NAS A;  1ZQW A;  4KX5 A;  5J8Y C;  1ZQO A;  2C2E A;  1ECW A;  2E1F A;  3WKD A;  3WFS C;  4EEB A;  2XC9 A;  2N1R A;  4M0A A;  1BPD A;  5DQI A;  5CWR A;  2ZTE A;  4WQK A;  1R89 A;  2YML A;  2ZH5 A;  2BDP A;  3ALR A;  4O67 A;  3ERC C;  4MEY A;  2ASD A;  2JEF A;  3JPP A;  1S76 D;  2KJ5 A;  3WK6 A;  2ESE A;  4OJO A;  2FLP A;  3NVY A;  4FS2 A;  1YLQ A;  1VJ5 A;  1QSS A;  2MSN A;  1FFV A;  1ZQP A;  3PX4 A;  4DSK A;  4QZI A;  1IXR A;  3I1Y A;  3IG5 A;  3WKC A;  4RQ8 A;  1X9W A;  3WK8 A;  2YTU A;  5CFS A;  3H4B A;  4ATB A;  2CRX A;  2KIV A;  4OAI Z;  2V9W A;  1X66 A;  4PL2 A;  3I28 A;  7ICQ A;  4ED3 A;  3FYH A;  2E8P A;  2HVI A;  4AT8 A;  3WKE A;  2K8C B;  5IIN A;  4HX0 A;  3PW4 A;  7ICG A;  3A0H U;  5DG8 A;  3UXN A;  4P2H A;  1CRX A;  1MIY A;  3V72 A;  1NZB A;  7ICS A;  3NVZ A;  3H0M B;  3HKZ F;  4EEL A;  3M9N B;  3UXP A;  4NY8 A;  2P35 A;  4YR0 A;  5J0S A;  1ZJN A;  5DGA A;  4EBE A;  4YVZ A;  4TUP A;  5AIA A;  3ZD8 A;  1T4G A;  2HVH A;  4RU9 A;  4QWB A;  2DRA A;  2KZ3 A;  1KFT A;  4E8F A;  4K9A A;  3Q8L A;  4JWN A;  4KLJ A;  1PK1 B;  2VA3 A;  2R8J A;  2M2V A;  4O69 A;  4R66 A;  4UAZ A;  3N7S C;  4TUQ A;  2B51 A;  3CP8 A;  1MN8 A;  5ALK A;  3LVW A;  3NUQ A;  1KKX A;  4NXV A;  4F4Y A;  4CF5 A;  3JPQ A;  1TAM A;  3C21 A;  5J2A A;  4X4U A;  4BX9 C;  1SL2 A;  3NVV A;  2PI4 A;  3BQ2 A;  3E58 A;  7ICH A;  3HJ4 A;  4JUZ A;  4RQ4 A;  2C2D A;  9ICP A;  1J97 A;  1TKD A;  2W9M A;  5KFK A;  4C8N A;  3PX6 A;  1ZQC A;  4JK1 A;  1X6I A;  7ICL A;  3B0Y A;  4C4T A;  4OAH A;  4EGW A;  5BOM A;  2ZUC A;  2D6F C;  5KFS A;  4P4O A;  1N48 A;  5J0X A;  3QU7 A;  3RAQ A;  2JMG A;  1RYR A;  1HEK A;  2W54 A;  3PSF A;  1ZYQ A;  2ZIU A;  3ZDD A;  2A19 A;  5IIL A;  2W9C A;  5KFA A;  5KFY A;  2DPI A;  1L6N A;  2XCA A;  2MRL A;  4NXU A;  1TAQ A;  2MU2 A;  4ED1 A;  4KMO B;  4GXI A;  5HRK A;  1VFG A;  4WC1 A;  5KFX A;  1OW5 A;  3PZP A;  7ICP A;  2QB0 B;  2IHM A;  3FAH A;  2LYB A;  4Y2P A;  1TK5 A;  2IBK A;  1NK6 A;  4CDG A;  4US9 A;  5III A;  4X4R A;  3PW2 A;  3KHG A;  4ZOH C;  5ALH A;  1U48 A;  4ECU A;  4WH5 A;  2JEI A;  5AM0 A;  2G08 A;  5KT6 A;  2FCL A;  2F44 A;  3NWI A;  1NJX A;  4Y2V A;  4DL6 A;  3EPG A;  3E0F A;  5KG7 A;  1KFS A;  3UQ2 A;  3EPI A;  3G6V A;  1N2X A;  4XQ7 A;  4X4V A;  5KT3 A;  4IRC A;  4NKU A;  1VLB A;  5DB7 A;  5DB9 A;  2KOB A;  5KFW A;  5B66 U;  2IHO A;  5AKG A;  4PHE A;  4I2C A;  4AYB F;  4O3S A;  1IG6 A;  2PI5 A;  5HRB A;  1D9F A;  2ISP A;  2XI9 A;  2M2U A;  5DDY A;  2BCV A;  1N62 A;  4RQ2 A;  3IDW A;  3MAB A;  5C0Y A;  1LVH A;  1A77 A;  4UAR A;  4FHX A;  2EAM A;  2XGQ A;  4DQS A;  4EZ9 A;  4I2I A;  2FDR A;  4C80 A;  8ICA A;  5DLG A;  1UCV A;  4UB8 U;  5DG9 A;  8ICF A;  1X6J A;  1ZQI A;  5DDM A;  4ECZ A;  4CNQ A;  2K8A A;  2GOL A;  3M6K A;  4KN4 A;  4UAU A;  3JPO A;  4LZD A;  1D8Y A;  2A1J A;  1U9L A;  5AI4 A;  3V6J A;  1JAJ A;  1CUK A;  5ALV A;  4IR1 A;  1NO5 A;  3PW0 A;  3C5G A;  5KG0 A;  3SYZ A;  3TFS A;  1BNO A;  2KD1 A;  3H37 A;  2Z7J A;  4ECY A;  7ICU A;  4I2G A;  5ALQ A;  2ZTC A;  2PXI A;  1LB2 B;  1Z3E B;  3GZF A;  4M5D A;  3NS1 A;  4GC6 A;  3KBB A;  4PJ0 U;  1VJ7 A;  1KN5 A;  3K1R B;  4QZF A;  1IM4 A;  3EZ5 A;  2BBJ A;  3J81 j;  1F44 A;  1X40 A;  4I2H A;  1SZP A;  3QX7 A;  5HR9 A;  3AU2 A;  5ALN A;  3PW5 A;  1U47 A;  2EZX A;  1X2I A;  3WKB A;  2W8K A;  2NO5 A;  4Q44 A;  4RQ0 A;  5J2G A;  3V6K A;  4Z6D A;  3LDA A;  1JMS A;  3H4D A;  3C29 A;  4IQW A;  2ODG A;  2YN4 A;  1UA1 A;  5J0T A;  2IA6 A;  1ZQ1 C;  3C28 A;  2Q4T A;  2IOF K;  3H8M A;  4C7Z A;  2G5H B;  2VIX A;  3MDC A;  2RDI A;  4QW9 A;  5EWG A;  1Z1B A;  2BBH A;  1C7Y A;  2ASJ A;  2ZIV B;  1XC9 A;  2B6G A;  2K60 A;  4FS1 A;  2GO7 A;  1ZD5 A;  2BPC A;  4DL5 A;  4Y2Q A;  2BE3 A;  2HOF A;  1HIW A;  1ZQL A;  3SR6 A;  4XUS A;  2WF6 A;  2JEJ A;  5IIM A;  1UHU A;  1MIW A;  3ED5 A;  2E8N A;  4GLX A;  2G06 A;  4EZ6 A;  2WF7 A;  9ICE A;  4DQI A;  3PX0 A;  1S9F A;  9ICM A;  1SXD A;  4OO1 J;  3IP4 B;  9ICF A;  2FLL A;  4KLM A;  2KVC A;  2BQU A;  3C1Z A;  2WF8 A;  2ES6 A;  4FHV A;  2JXJ A;  4WC2 A;  4UAW A;  4UB4 A;  1ZD2 P;  4F93 B;  5HC9 A;  3GV7 B;  4EEN A;  4BXO B;  3V7L A;  5ALF A;  5ALG A;  2G0A A;  3SEN A;  1O08 A;  3RBD A;  5DQG A;  5TIS U;  4K4H A;  3ZD9 A;  4DLG A;  2BDU A;  3THV A;  3OWG A;  3UMB A;  4OJ6 A;  2AHO B;  4X4S A;  4Q8F A;  2K4P A;  3RH4 A;  4RWO A;  4NL9 C;  1OUQ A;  2G09 A;  3JYY A;  1D9D A;  4YP3 A;  4EEK A;  1TAU A;  9ICK A;  3JCF A;  2LYA A;  2DR7 A;  4YG2 A;  3Q8P B;  5BOL A;  3ZDB A;  1SV0 C;  4UAV A;  4P0P A;  1WCN A;  1NK9 A;  5ALY A;  2HHS A;  1QQ5 A;  4O3R A;  5KFR A;  5J0O A;  5L1L A;  5HRD A;  4O68 A;  4E7X A;  2H3Q A;  4O3O A;  4FE3 A;  2QLT A;  4AT9 A;  4KLI A;  2A3V A;  1KW4 A;  4QZA A;  1V38 A;  4O5E A;  3UMC A;  4F5N A;  1N60 A;  2ZHA A;  1ZRN A;  5KFE A;  2LPE A;  1NNL A;  4O5K A;  4O0I A;  2P6U A;  4XRH A;  4BUG A;  4M6W A;  3WK9 A;  3AMZ A;  1WWU A;  3QEA Z;  3BS5 A;  4XA5 A;  8ICL A;  1S0N A;  3AQM A;  5J0U A;  4OAG A;  3ZI4 A;  4DL3 A;  4F4W A;  5CHG A;  1TV9 A;  1S5L U;  1QCK A;  4EX6 A;  4FHY A;  2IMW P;  4F8R A;  1XSN A;  7ICM A;  1T3Q A;  2YMQ A;  5KT2 A;  4DF8 A;  4QWA A;  2L5Y A;  4I0U A;  5AKY A;  3CYM A;  4ECW A;  2FLN A;  2OH2 A;  9ICS A;  5GTH U;  3PO5 A;  4DFK A;  4FO6 A;  3V7K A;  1UT8 A;  2NRT A;  4JV0 A;  2DBY A;  7ICF A;  3K4G A;  5KT4 A;  4M9G A;  4LJX A;  1WUD A;  5JRT A;  9ICC A;  2JEG A;  2CXY A;  3M9O B;  3H40 A;  1ZRM A;  2DFL A;  1KLN A;  1PVP A;  4J9S A;  3KZX A;  1C20 A;  3DEE A;  9ICW A;  4KLT A;  4ECV A;  1R8B A;  4A8E A;  2PFN A;  5L1K A;  1XS9 D;  8ICB A;  7ICI A;  5AKH A;  2HN1 A;  5AKK A;  2KKP A;  2WB1 C;  3CNH A;  1SV4 A;  1JQR A;  2IUB A;  3MGH A;  4NLZ A;  4KLL A;  3EW9 A;  4MHV A;  1JXL A;  4UQG A;  3AUO A;  5HRH A;  4K4G A;  3MC1 A;  3QZ8 A;  3QUT A;  4RPZ A;  2DPJ A;  3CRX A;  1CI4 A;  1OU5 A;  3SAG A;  3JZ0 A;  5DEC A;  1JXE A;  1RYU A;  2F1J A;  2J6U A;  5F2V O;  1JAL A;  8ICI A;  2JRZ A;  1KNY A;  3KHH A;  4M9J A;  5AI6 A;  2DVI A;  4P4M A;  8ICY A;  5KFF A;  2W9B B;  1X9M A;  3BZC A;  1J2N A;  4UAS A;  2ZJ8 A;  1LKY B;  2HN2 A;  3QU4 A;  2R8H A;  5B5E U;  8ICH A;  4RWN A;  3RB3 A;  1XWL A;  1L7N A;  5ALO A;  1DGJ A;  3K1Z A;  3Q8S B;  3TQ1 A;  1Q79 A;  3RH6 A;  5ALL A;  1A6S A;  3O0F A;  4NLK A;  5KFB A;  3OJU A;  1KTQ A;  3RRH A;  2PMZ C;  5HP4 A;  1SV0 A;  1PK1 A;  3UM9 A;  3Q8Q B;  3OUY B;  1YZ6 A;  4IQT A;  5HRI A;  2KG5 A;  1T3N A;  1COO A;  2JHD A;  3C66 A;  4UD5 A;  2BR0 A;  1TFY A;  3WFO A;  4O9M A;  2ZH1 A;  4GC7 A;  3EWA A;  1A0P A;  1ZQM A;  1R8C A;  4EEY A;  1JUD A;  1JI7 A;  2ISO A;  8ICU A;  3ETL A;  5CP2 A;  1SB3 C;  2KHQ A;  2W7O A;  4C4S A;  4F5P A;  3MR5 A;  1A76 A;  4IG8 A;  4Z6E A;  5DB8 A;  2Y9U A;  3RR8 A;  1KEJ A;  4NXW A;  4PH5 A;  1ZJM A;  2KKV A;  1JX4 A;  2JZB A;  2KSO A;  1S97 A;  5KG3 A;  4DFJ A;  1ARO P;  2PFQ A;  4JV2 A;  2V4R A;  2UVW A;  1TE2 A;  2MUT A;  4X0A A;  5JTI A;  1DK3 A;  3H7I A;  3AQF A;  2RRD A;  4Y2Y A;  4DSF A;  2XVT A;  1ZD3 A;  2XO7 A;  8ICM A;  4KMU A;  1DK2 A;  4QZH A;  5KFO A;  1SL0 A;  2O6K A;  4B9V A;  4WBY A;  2M0N A;  2JH1 A;  3H8J A;  2P6R A;  2PKE A;  1XSL A;  3C5F A;  2V4Q A;  5KTQ A;  1RXW A;  2KEY A;  3WK7 A;  5KAI U;  3OVB A;  1NZP A;  2HHQ A;  4NLG A;  2QB0 A;  2LHT A;  5J2H A;  3QNM A;  2FI1 A;  4FFD A;  4QWE A;  5KT7 A;  1B0X A;  2K4E A;  5ALI A;  4Y2S A;  4YD2 A;  1UPH A;  3M9M B;  4G9B A;  2I5H A;  4QWD A;  4ED7 A;  4DFP A;  3AL0 B;  3G6X A;  1PVQ A;  3WK5 A;  4B9T A;  4C7Y A;  3KHR A;  4X4Q A;  5J2I A;  1ZQA A;  4B9S A;  1ZQV A;  4LT6 A;  4C4R A;  2DGZ A;  3A0B U;  1V4A A;  4EBK A;  4FZM A;  3SQI A;  4RT2 A;  5EOZ A;  3WFP A;  3EUB 2;  2EWR A;  4NKT A;  2F8L A;  2ZUB A; 
#chains in the Genus database with same CATH homology
 3H37 A;  3TAR A;  1L5U A;  4R65 A;  3PW7 A;  4ECY A;  4UAY A;  4X5V A;  4DFM A;  7ICU A;  5KFN A;  3RJH A;  4RUA A;  5KFJ A;  3IHQ B;  4Q45 A;  4I2G A;  5KFG A;  5DBC A;  2NRX A;  2ZTC A;  4J9P A;  4B9N A;  2PXI A;  1LB2 B;  1Z3E B;  5L9X A;  2HHT A;  2KZZ A;  4M5D A;  4IRD A;  5L1J A;  4WC7 A;  2XGP A;  4GC6 A;  1BPB A;  4EBC A;  2NRK A;  4DL2 A;  2BQR A;  2IHN A;  2KN7 A;  1VJ7 A;  3GQC A;  3PR4 A;  2R8K A;  3TI0 A;  4PHD A;  5KG6 A;  4QZF A;  4M47 A;  1IM4 A;  4C8M A;  1ZQG A;  2PFP A;  5HRG A;  2M9N A;  1K1S A;  4Z6F A;  3EZ5 A;  1XSP A;  2I9G A;  3RJG A;  8ICW A;  4I2H A;  3AQK A;  1BGX T;  4ATB B;  1SZP A;  5DB6 A;  7ICO A;  2F1I A;  9ICX A;  4S3N A;  5HR9 A;  3AU2 A;  3PW5 A;  1U47 A;  2W9B A;  2RDJ A;  5HRL A;  1X2I A;  2W8K A;  3UPS A;  1RXV A;  4DWI A;  5KFZ A;  4PGX A;  4Q44 A;  9ICL A;  3L9D A;  4RQ0 A;  4BGD A;  3RB4 A;  5J2G A;  3V6K A;  4Z6D A;  9ICU A;  3BJY A;  3LDA A;  1NKC A;  5J2F A;  3C2L A;  3RJE A;  3RJF A;  1JMS A;  4KIT B;  1MQ3 A;  4ED8 A;  1ZQQ A;  4F91 B;  3H4D A;  3N4M B;  5HRF A;  4NM1 A;  2RFF A;  4IQW A;  4YXJ A;  4AT8 B;  2ATL A;  1BNO A;  2FMS A;  4PHP A;  3G6Y A;  3KHL A;  4PHA A;  4DEZ A;  1UA1 A;  5J0T A;  2IA6 A;  1HUO A;  4IR9 A;  1MIV A;  1UT5 A;  1DOQ A;  3RB0 A;  4Q8E A;  4ED6 A;  3GDX A;  5DLF A;  2BQ3 A;  2XY5 A;  3MDC A;  5BPC A;  4ED2 A;  2RDI A;  4QW9 A;  4I2E A;  4DQP A;  4BWM A;  4ELU A;  5EWG A;  4Z6C A;  2GWS A;  1NOM A;  4C8O A;  5KG4 A;  1NK0 A;  5KFH A;  4DOA A;  4R64 A;  1C7Y A;  1L3S A;  2ASJ A;  3HJ1 A;  4E0D A;  1HUZ A;  4QZ9 A;  4R63 A;  1XC9 A;  4X4V A;  4RQ6 A;  4DS5 A;  5D4B A;  2OWO A;  2NRZ A;  4FS1 A;  4I28 A;  3BQ1 A;  3RRG A;  4WC0 A;  4YR3 A;  4EBK A;  4I2F A;  5CB1 A;  8ICO A;  1K1Q A;  3AQN A;  3MDA A;  4CCH A;  2ZH3 A;  9ICV A;  2BPC A;  1XO1 A;  3UXO A;  4DL5 A;  3RB6 A;  4DSI A;  2BKE A;  2BE3 A;  5IIJ A;  3MFH A;  3NYB A;  1Z00 B;  1BPE A;  2BPG A;  2R8G A;  8ICQ A;  1WOT A;  4KLG A;  2HHX A;  1ZQL A;  4XUS A;  4DSE A;  2JEJ A;  2ZJA A;  5IIM A;  2KFZ A;  1MIW A;  3WFQ E;  4UB5 A;  5DBA A;  4GLX A;  2J6T A;  4RQ5 A;  5F9L A;  4EZ6 A;  9ICE A;  1ZQS A;  3PY8 A;  3PX0 A;  4DQI A;  8ICX A;  1S9F A;  3H8W A;  2AQ4 A;  1F5A A;  9ICM A;  4F4Z A;  2ZH6 A;  1ZQD A;  2J6S A;  5IIO A;  4KLO A;  1ZQU A;  4RZR A;  4MF8 A;  5C5J A;  5J2B A;  5D46 A;  4EYI B;  2BHN A;  2MAX A;  3C1Y A;  4TQS A;  3V7J A;  2FLL A;  9ICF A;  4KLM A;  5HHH A;  2BQU A;  3MBY A;  3C1Z A;  2ZJ5 A;  3Q8R B;  2DR9 A;  1BPZ A;  4J9L A;  1RPL A;  4ECX A;  4FHV A;  3WFR E;  4DS4 A;  1UEV A;  4JWM A;  4WC2 A;  8ICT A;  2UVV A;  4UAW A;  4HYK A;  3OVS A;  4UB4 A;  1NJZ A;  4F93 B;  3H38 A;  1B22 A;  1NKB A;  3GV7 B;  4BXO B;  5HC9 A;  1HJP A;  3N97 B;  3V7L A;  4F2S A;  8ICG A;  1LV5 A;  4X4P A;  2DR5 A;  4RWQ A;  4RWP A;  4ECQ A;  3RBD A;  4WC5 A;  5DQG A;  3ORY A;  1ZQZ A;  4DQR A;  3T5K A;  5EWF A;  1KRP A;  4K4H A;  1Q78 A;  3ZD9 A;  4DLG A;  3PR5 B;  3T3F A;  1Z00 A;  1ZQJ A;  4KLQ A;  2I1Q A;  4G3I A;  4YXM A;  5EWE A;  4R8U A;  3PVX A;  3THV A;  7ICR A;  4MEX A;  4PGQ A;  1S77 D;  4KLU A;  4YQW A;  1ZQE A;  3BQ0 A;  4KLS A;  4X4S A;  5KFT A;  4IQU A;  3ISB A;  4TUS A;  4UBB A;  3ISC A;  4DQQ A;  3JPS A;  4ED0 A;  1ZQF A;  4Q8F A;  2W9A A;  4MFF A;  4X0B A;  2DRA A;  4TUR A;  4BWJ A;  3RH4 A;  2C22 A;  4RWO A;  2ZUD A;  2AGQ A;  4XQ8 A;  4QZE A;  4TQR A;  3JYY A;  1D9D A;  4YP3 A;  4J9O A;  3RJI A;  4YMO A;  3SV3 A;  2FPM A;  3TAQ A;  1TAU A;  1ZQY A;  9ICK A;  3H3A A;  5J0R A;  3HT3 A;  4F2R A;  2XY6 A;  1Y88 A;  4DL7 A;  4UB1 A;  2KTQ A;  3BDP A;  3BQT A;  4RUC A;  2DR7 A;  4YFK A;  4X4T A;  4YG2 A;  3JPN A;  4UD4 A;  3Q8P B;  7ICJ A;  1ZQH A;  5BOL A;  3ZDB A;  4FH5 A;  4DLE A;  2C28 A;  1EXN A;  4YR2 A;  4QWC A;  5J0W A;  4BXO A;  5KG1 A;  4ELV A;  1CEZ A;  3IM1 A;  7ICT A;  1WCN A;  4M6W B;  1TK8 A;  1NK9 A;  8ICE A;  2HHS A;  8ICJ A;  4P4P A;  1UET A;  4O3R A;  1TKD A;  3C2M A;  4M9L A;  4ZH4 A;  5KFR A;  4F4K A;  1RZT A;  1H38 A;  5J0O A;  2ZH2 A;  5L1L A;  3OJS A;  1JIH A;  1ZET A;  2DR8 A;  4EBJ A;  1JN3 A;  5IIK A;  5HRD A;  3QE9 Y;  1ZQT A;  8ICN A;  4FHW A;  4QZ8 A;  2ID1 A;  5KFL A;  5KG2 A;  4E7X A;  2XCP A;  5J2C A;  2R8I A;  2PBE A;  1ZQW A;  4O3O A;  1ZQO A;  2C2E A;  3RTV A;  4IRK A;  4AT9 A;  4KLI A;  3WFS C;  4RNM A;  1U49 A;  4QZA A;  4O5E A;  3RAX A;  3ZDE A;  2XC9 A;  4XQ7 A;  4F5N A;  1QTM A;  4M0A A;  4I2B A;  3AU6 A;  7ICN A;  1BPD A;  5DQI A;  5CWR A;  2ZTE A;  4M9H A;  4ECR A;  2BGW A;  3GV5 B;  9ICG A;  1R89 A;  2VAN A;  4DL4 A;  2ZH5 A;  2BDP A;  3MGI A;  3OSN A;  2ZHA A;  4FH3 A;  1L3T A;  4DSL A;  4M04 A;  4MEY A;  4PGY A;  2ASD A;  2JZB B;  5KFE A;  3T5J A;  2JEF A;  3JPP A;  4O5K A;  1S76 D;  1UEU A;  3RR7 A;  4RT3 A;  1ZQN A;  2FLP A;  4WC3 A;  1UA0 A;  4EBD A;  2NRW A;  4O0I A;  4ECS A;  2P6U A;  4XRH A;  4FS2 A;  1NJY A;  3H39 A;  2MUT B;  1YLQ A;  4NXZ A;  4Q43 A;  1QSS A;  4M6W A;  5HML A;  4NM2 A;  4QZD A;  1ZQP A;  3QEA Z;  3PX4 A;  2ZH4 A;  1NKE A;  1NK5 A;  3GIJ A;  1MQ2 A;  3PV8 A;  4XA5 A;  4DSK A;  8ICL A;  1S0N A;  3AQM A;  4AT9 B;  5J0U A;  4QZI A;  4I2J A;  3OHA A;  1IXR A;  5J0Y A;  1X9W A;  4RQ8 A;  2B21 A;  1ZQX A;  4J9Q A;  4KLF A;  2W8L A;  4DL3 A;  4MFA A;  4F4W A;  4DSJ A;  3H4B A;  1T8E A;  4ATB A;  1RYS A;  5CHG A;  1TV9 A;  4F5Q A;  1SKS A;  3RBE A;  1KSP A;  4E80 A;  5KFM A;  4FHY A;  2IMW P;  4F8R A;  1XSN A;  2V9W A;  7ICM A;  9ICH A;  1TFR A;  7ICQ A;  5KT2 A;  4DF8 A;  4QWA A;  4ED3 A;  4ECW A;  2FLN A;  4B9U A;  9ICS A;  3FYH A;  4J9R A;  3PO5 A;  4DFK A;  3MR2 A;  4FO6 A;  4F5O A;  2HVI A;  4GXK A;  3V7K A;  4LVS A;  1UT8 A;  4AT8 A;  2NRT A;  5IIN A;  4JV0 A;  2HW3 A;  5CR0 A;  7ICF A;  3K4G A;  5KT4 A;  5J2J A;  3PW4 A;  4M9G A;  7ICG A;  1PX5 A;  4F5R A;  5DG8 A;  3OSP A;  4KLH A;  5KFV A;  4QZG A;  1NK7 A;  2JEG A;  3UXN A;  9ICC A;  3M9O B;  3H40 A;  5KFD A;  2HHU A;  2DFL A;  4P2H A;  3OUY A;  1MIY A;  1KLN A;  3V72 A;  4J9S A;  7ICS A;  9ICW A;  4BDP A;  2KP7 A;  4KLT A;  4QW8 A;  3ISD A;  4AT7 B;  4ECV A;  1BPY A;  1R8B A;  3M9N B;  3UXP A;  5L1K A;  1XS9 D;  2PFN A;  4NY8 A;  3NTU A;  8ICB A;  7ICI A;  1QLN A;  2H5X A;  1V9P A;  4YR0 A;  5J0S A;  1ZJN A;  1TVA A;  4B9M A;  5KFI A;  4F92 B;  1JQR A;  5DGA A;  9ICJ A;  2O5A A;  3MGH A;  4YVZ A;  4EBE A;  3B0X A;  3EYZ A;  4NLZ A;  4TUP A;  4KLL A;  4RNN A;  1ZQK A;  2UVU A;  2M2T A;  3EW9 A;  2BCU A;  1JXL A;  5CA7 A;  3ZD8 A;  1T4G A;  4UQG A;  1L3V A;  4RU9 A;  4QWB A;  4QZC A;  2ASL A;  4KLE A;  2HVH A;  3AUO A;  3MFI A;  2BCS A;  5HRH A;  2KZ3 A;  1KFT A;  4K4G A;  4WCW A;  4E8F A;  1D8L A;  1SKW A;  3QZ8 A;  3Q8L A;  3OGU A;  4RPZ A;  2DPJ A;  2VA3 A;  3GIK A;  5DG7 A;  1BPX A;  4JWN A;  4KLJ A;  2R8J A;  4I2D A;  2M2V A;  4R66 A;  1OU5 A;  2LYH A;  4UAZ A;  3JZ0 A;  1TFW A;  4RQ1 A;  1S0O A;  3PMN A;  5DEC A;  9ICN A;  4TUQ A;  1JXE A;  2AGO A;  4YMM A;  4LZG A;  2F1J A;  2J6U A;  1MSW D;  1BVS A;  5HRE A;  3M8S A;  4RPX A;  1R8A A;  2BPF A;  5F2V O;  5DGB A;  8ICI A;  4C8K A;  2O1P A;  4M2Y A;  1KNY A;  3KHH A;  4F4Y A;  4M9J A;  2DVI A;  4J9N A;  2VA2 A;  4I27 A;  3ZDA A;  2KZM A;  4YD1 A;  4P4M A;  3GIL A;  8ICY A;  5KFF A;  2W9B B;  3JPQ A;  3T5H A;  4DF4 A;  3C21 A;  4AT7 A;  1X9M A;  5J2A A;  2W9C B;  4X4U A;  4X4N A;  1XU4 A;  3JPR A;  4PPX A;  2ZH7 A;  1SL2 A;  2ZJ8 A;  5D49 A;  3BQ2 A;  2PI4 A;  2HHW A;  3RJJ A;  3H8S A;  2R8H A;  7ICH A;  2BCR A;  4RPY A;  3GFK B;  3HPO A;  3HJ4 A;  4JUZ A;  4WC6 A;  4RQ4 A;  8ICH A;  4O5C A;  3K75 D;  2C2D A;  4RWN A;  4RQ7 A;  3RB3 A;  9ICP A;  1XWL A;  1TK0 A;  2F1H A;  2W9M A;  5KFK A;  4F4X A;  4C8N A;  4GXJ A;  5DBB A;  3Q8S B;  3PX6 A;  3Q8M A;  1ZQC A;  4JK1 A;  2UVR A;  3TQ1 A;  9ICB A;  1Q79 A;  1S10 A;  3RH6 A;  3RJK A;  7ICL A;  3B0Y A;  4MFC A;  4ELT A;  5J2K A;  4NLK A;  3MR3 A;  1QSL A;  5KFQ A;  1KTQ A;  5KFB A;  5BOM A;  3OJU A;  4O3Q A;  4DOC A;  3RRH A;  5HP4 A;  3Q8Q B;  1U45 A;  8ICV A;  2ZH9 A;  2ZUC A;  5KFS A;  3OUY B;  3MR6 A;  4P4O A;  3QZ7 A;  1X9S A;  2WTF A;  2ALZ A;  4IQT A;  1N48 A;  3SI8 A;  5J0X A;  3T5L A;  5HRI A;  3RAQ A;  3JPT A;  3E2E A;  7ICE A;  5DED A;  3UQ0 A;  1T3N A;  3AQL A;  1COO A;  1RYR A;  8ICC A;  3C66 A;  4UD5 A;  2BR0 A;  1KDH A;  1TFY A;  1ZYQ A;  3WFO A;  3M8R A;  2FMP A;  3ZDD A;  5KFP A;  4YMN A;  2W9C A;  5IIL A;  1ZQR A;  4KTQ A;  4GC7 A;  4O9M A;  3EWA A;  3UPQ A;  1FA0 A;  2ZH1 A;  1ZQM A;  5KFA A;  1SL1 A;  5KFY A;  2DPI A;  8ICP A;  4EEY A;  1R8C A;  1DGS A;  3QEB Z;  2ISO A;  2XCA A;  4WBZ A;  3NGD A;  3C18 A;  4IQV A;  8ICU A;  2M2W A;  1TAQ A;  3C23 A;  4O3P A;  4EYH B;  3HW8 A;  4ED1 A;  2AJQ A;  3ETL A;  2FPL A;  1QSY A;  4GXI A;  5CP2 A;  5HRK A;  1VFG A;  4WC1 A;  5KFX A;  1WCL A;  5KFU A;  4K4I A;  9ICI A;  4YCX A;  3PNC A;  4KN7 A;  4F5P A;  3SV4 A;  3MR5 A;  1N56 A;  1A76 A;  4IG8 A;  2AU0 A;  1U4B A;  3FDS A;  2ZTD A;  4Z6E A;  4FBU A;  5DB8 A;  2C2R A;  4F3O A;  2IHM A;  4I2A A;  2FMQ A;  7ICP A;  1TK5 A;  1KEJ A;  2IBK A;  3RR8 A;  4PH5 A;  5L1I A;  9ICO A;  1ZJM A;  1NK6 A;  2ZHB A;  2VA8 A;  5III A;  4X4R A;  3PW2 A;  3LWM A;  1JX4 A;  8ICK A;  2JZB A;  3KHG A;  3HIY A;  1KFD A;  1S97 A;  3HWT A;  1U48 A;  4NLN A;  5J2E A;  3HX0 A;  4ECU A;  5KG3 A;  4RQ3 A;  4DFJ A;  5TZV A;  2JEI A;  1ARO P;  5KT6 A;  2PFQ A;  4JV2 A;  2V4R A;  2UVW A;  3OVA A;  5HHI A;  2MUT A;  3V6H A;  1NJX A;  8ICS A;  4DL6 A;  3EPG A;  4EP7 A;  4X0A A;  3RH5 A;  5KG7 A;  1KFS A;  4I29 A;  7ICV A;  4O3N A;  3UQ2 A;  4R8U B;  2Y1J A;  2XY7 A;  1DK3 A;  3H7I A;  5CJ7 A;  4DO9 A;  2Y1I A;  2Q66 A;  3KTQ A;  3EPI A;  4DSF A;  5DQH A;  2XO7 A;  3G6V A;  1NK8 A;  8ICM A;  4KMU A;  5KT3 A;  3LQC B;  4IRC A;  4QZH A;  5KFO A;  1SL0 A;  1T7P A;  4B9V A;  1DK2 A;  3OHB A;  4WBY A;  3GIM A;  4NKU A;  4J9K A;  3H8J A;  5DB7 A;  5DB9 A;  2P6R A;  3PML A;  3SZ2 A;  2A1J B;  5KFC A;  1V4A A;  2PFO A;  5KFW A;  5F9N A;  3GV8 B;  1NJW A;  1L3U A;  4WC4 A;  1S0M A;  2FPK A;  3C5F A;  2V4Q A;  4RNO A;  1XSL A;  4PHE A;  3PO4 A;  4I2C A;  4KLD A;  8ICZ A;  4O3S A;  5KTQ A;  5KG5 A;  1RXW A;  5J0Q A;  4ECT A;  2PI5 A;  1NZP A;  2HHQ A;  5HRB A;  3OVB A;  3ZDC A;  4NLG A;  5J0P A;  9ICQ A;  1D9F A;  2KFN A;  2ISP A;  4J9M A;  7ICK A;  2M2U A;  5DDY A;  3OV7 A;  2BCV A;  5J2H A;  4RQ2 A;  4UB2 A;  3MAB A;  4QWE A;  5KT7 A;  4QZB A;  3LWL A;  4DOB A;  3Q8K A;  5J2D A;  9ICT A;  4YD2 A;  1SKR A;  2DRB A;  4UBC A;  5JUM A;  1A77 A;  3M9M B;  4FHX A;  4QWD A;  4ED7 A;  2P66 A;  4YN4 A;  2NRV A;  4DFP A;  1MC8 A;  4FHP A;  3TAN A;  2XGQ A;  1NK4 A;  4M9N A;  3G6X A;  4DQS A;  4B9T A;  4EZ9 A;  9ICA A;  3LK9 A;  4C8L A;  3KHR A;  2Q0Z X;  4X4Q A;  4I2I A;  5J2I A;  8ICA A;  5DLG A;  1ZQA A;  1ZQB A;  2ZH8 A;  5DG9 A;  5DKW A;  4B9S A;  3HP6 A;  3C2K A;  1S0V A;  8ICR A;  8ICF A;  9ICR A;  2AGP A;  1ZQI A;  5DDM A;  1ZQV A;  4LT6 A;  4X4O A;  1BNP A;  1PZN A;  4ECZ A;  5HMM A;  4KN4 A;  4UB3 A;  4F50 A;  3TFR A;  3JPO A;  4LZD A;  1D8Y A;  4B9L A;  2A1J A;  1U9L A;  5KT5 A;  3V6J A;  3TAP A;  4FBT A;  5J29 A;  2AQ0 A;  2BCQ A;  2HHV A;  1B43 A;  4RT2 A;  5EOZ A;  1JAJ A;  2HHP A;  3WFP A;  3GII A;  1CUK A;  4IR1 A;  4MF2 A;  4JV1 A;  1NO5 A;  3PW0 A;  3C5G A;  5KG0 A;  4NKT A;  5HNK A;  3SYZ A;  3TFS A;  2ZUB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...