4X0BA

Structure of trna-processing enzyme complex 7
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
381
structure length
367
Chain Sequence
MVGQIAKEMGLRAYIVGGVVRDILLGKEVWDVDFVVEGNAIELAKELARRHGVNVHPFPEFGTAHLKIGKLKLEFATARRETEPASLKEDLIRRDFTINAMAISVNLEDYGTLIDYFGGLRDLKDKVIRVLHPVSFIEDPVRILRALRFAGRLNFKLSRSTEKLLKQAVNLGLLKEAPRGRLINEIKLALREDRFLEILELYRKYRVLEEIIEGFQWNEKVLQKLYALRKVVDWHALEFSEERIDYGWLYLLILISNLDYERGKHFLEEMSAPSWVRETYKFMKFKLGSLKEELKKAKENYEVYRLLKPLHTSVLLLLMLEEELKEKIKLYLEKLRKVKLPKEKIEELKKGKELGERIEELKREIMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Poly A polymerase
publication title Measurement of Acceptor-T Psi C Helix Length of tRNA for Terminal A76-Addition by A-Adding Enzyme.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transferase/rna
total genus 114
structure length 367
sequence length 381
ec nomenclature
pdb deposition date 2014-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01743 PolyA_pol Poly A polymerase head domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3090.10 Mainly Alpha Orthogonal Bundle cca-adding enzyme, domain 2 cca-adding enzyme, domain 2 4x0bA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4x0bA01
4PHAA 4QZAA 2ID1A 1ZQLA 3AU2A 4GXJA 1ZJNA 5TZVA 4UB3A 3UQ2A 1ZQFA 7ICGA 5CHGA 1R8AA 1VFGA 4RQ8A 3GDXA 1R8CA 1MIVA 2O5AA 4E8FA 5DB9A 3HJ1A 3RH6A 1FA0A 2DRAA 4QZEA 4I2BA 4LVSA 1XSNA 4X4RA 4XQ8A 5DBAA 5DECA 4KLGA 3OV7A 9ICXA 4KLTA 4KLQA 1ZQDA 4EBJA 3L9DA 5CB1A 4JWMA 4QZHA 5J0TA 4KLLA 4M9GA 2BCSA 2ZH2A 3OVSA 5J2CA 4FHWA 4FHVA 4TURA 4MF8A 4NLNA 1MQ3A 4TUPA 4YN4A 2ZH8A 1UETA 2ZH3A 4TUQA 3JYYA 5DBBA 9ICBA 2DVIA 3HIYA 5HRBA 4DOCA 1MIWA 4DOAA 4I2DA 4I2CA 4Z6DA 3B0YA 4X4TA 1ZQNA 8ICLA 7ICPA 2W9MA 7ICNA 5DDYA 5J0XA 4F5PA 2M2VA 5J2AA 7ICTA 1Q78A 9ICRA 5J29A 4WC4A 4XQ7A 5J0OA 2HHPA 1BPZA 9ICVA 4PGQA 4RWNA 9ICSA 2BCUA 1NOMA 1JAJA 4RT3A 5J2BA 3ISCA 8ICRA 5IINA 8ICQA 4QZ9A 9ICEA 3JPNA 5J2KA 4KLJA 4AT9A 3AUOA 2P66A 4P4PA 9ICHA 1BPBA 1ZQQA 4O5CA 4QZIA 5DB7A 5BPCA 3JPOA 8ICPA 7ICVA 1ZQTA 2Q66A 4WBYA 1ZQOA 1TV9A 4YCXA 4RPYA 5J0PA 4X4NA 4WC6A 4AT9B 9ICGA 3WFQE 4M2YA 3MGIA 2PBEA 3LK9A 1R89A 4QZFA 4XA5A 5F2VO 4XUSA 3MBYA 3JPPA 1ZQZA 3HWTA 3RH5A 2BCRA 4R63A 8ICHA 4P4OA 4FHXA 4IQWA 3H39A 3HX0A 2PXIA 1ZQUA 4NLZA 2DR8A 8ICVA 3TFSA 4KLMA 4FH5A 4Z6FA 4RQ7A 4E7XA 4LT6A 1ZQWA 8ICJA 4WC5A 7ICHA 5IIIA 4YMMA 5J2JA 8ICNA 5J0WA 2DR9A 4EP7A 1JN3A 2ISOA 8ICGA 8ICFA 3UQ0A 4IQVA 5HREA 3PNCA 1ZQKA 5IIKA 4X0BA 4X4OA 4NLKA 4M04A 1ZQBA 3PMNA 5DEDA 2M2WA 2GWSA 3ISBA 4K4IA 1HUOA 4FO6A 5HHHA 3WFSC 7ICFA 4ATBA 2ZHAA 5HRDA 5EOZA 7ICKA 4UD4A 5HC9A 4UAZA 3AQLA 9ICNA 5HRIA 3AU6A 1NO5A 4X4VA 9ICAA 4KLHA 1Q79A 9ICMA 4PHPA 3UXOA 3MDAA 4QZDA 4UB2A 5HRLA 3RH4A 4FHPA 4X5VA 5J2FA 4NKUA 3C2LA 3H37A 4RQ6A 3AQMA 3K75D 5HRHA 1V4AA 4S3NA 1BPXA 4I2GA 4O5EA 4RPZA 4DO9A 4I28A 3ISDA 1ZQYA 7ICUA 4NXZA 4EBKA 5D4BA 4RWQA 2BE3A 9ICWA 1ZQVA 8ICKA 4UAYA 8ICSA 5DB6A 3C2MA 4WC3A 4RQ2A 5HRGA 4E80A 3RJIA 5J0UA 4RWPA 5J0RA 5J0QA 5D46A 4UD5A 9ICPA 7ICRA 7ICIA 3NYBA 2PFOA 1OU5A 3V72A 3H3AA 4M9NA 2FMSA 5CWRA 9ICUA 5HR9A 4R66A 4UB1A 4F5QA 4WC1A 3RJKA 4O5KA 4YMOA 5J2DA 4DOBA 7ICQA 4NKTA 4X4QA 2NRKA 3MDCA 3UPQA 3RJHA 4R64A 5DKWA 3RJJA 3RJGA 4RT2A 4MF2A 4WCWA 1MIYA 8ICWA 4YD2A 3WFOA 1RZTA 3RJEA 3WFRE 4RQ3A 2FMPA 4I27A 4UB5A 2O1PA 4FHYA 2ZH5A 2PFPA 1ZQGA 4RQ0A 4M9HA 1ZQIA 1UEUA 2BCQA 4PHEA 3OVAA 8ICBA 4M5DA 2VANA 5J2EA 4Z6CA 4PHDA 5CP2A 1ZQJA 2ZH7A 4I2FA 1XSLA 7ICMA 8ICZA 4FH3A 2ZH1A 3V7KA 1ZQCA 3JPRA 4UB4A 2ZH6A 4F5NA 4I2IA 5IIJA 7ICJA 1YLQA 2ZH4A 1ZQXA 3UPSA 4LZDA 4I2HA 4WC7A 4AT7A 4MFCA 4RQ4A 1ZQRA 4K4GA 4P2HA 4QZGA 4AT8A 4RWOA 8ICMA 4O9MA 5IIOA 3JPQA 4RQ5A 4KLUA 5CJ7A 4YMNA 5IILA 2BPGA 8ICEA 3OVBA 8ICCA 1F5AA 5DBCA 8ICAA 3OGUA 4TUSA 1UEVA 4R65A 3MGHA 4X4UA 4AT7B 4NM1A 5J0YA 4PPXA 1MQ2A 8ICXA 4IQUA 8ICOA 4AT8B 3RJFA 1BPYA 7ICOA 1ZQAA 4ATBB 3UXPA 1TFYA 7ICLA 8ICIA 9ICLA 4UBBA 1ZQMA 2ISPA 2IHMA 3C18A 4WBZA 1VJ7A 2BCVA 4GXKA 4P4MA 4Z6EA 3OUYA 1TVAA 2DRBA 3JZ0A 9ICFA 1KDHA 4I2EA 5IIMA 7ICEA 3HJ4A 4QZ8A 4NY8A 1KNYA 4X0AA 5D49A 5J2IA 4PH5A 9ICIA 5J2GA 1HUZA 3PMLA 4KLEA 4QZBA 4K4HA 9ICTA 4IG8A 2I9GA 2PFQA 5J2HA 1ZQPA 4X4PA 4KLSA 3WFPA 5DDMA 5HRFA 8ICYA 4PGYA 4M9JA 4IQTA 3OUYB 3AQNA 7ICSA 4F5OA 3JPSA 2ZH9A 3C2KA 1ZQSA 3C66A 4KLOA 8ICUA 1JMSA 4RPXA 1XSPA 4XRHA 1WOTA 4M0AA 3H38A 3B0XA 3HW8A 2M2TA 3TFRA 1ZQEA 4M47A 4KLIA 2BPFA 9ICJA 4RQ1A 3UXNA 4MFAA 8ICTA 1RPLA 1R8BA 2BPCA 3LQCB 4WC0A 4WC2A 1BPDA 2PFNA 4M9LA 4NM2A 4UBCA 4JWNA 2FMQA 9ICQA 1TFWA 5BOMA 5CR0A 1KEJA 2ZHBA 4X4SA 3V7JA 5DB8A 1ZQHA 4I29A 4I2AA 4GXIA 1ZJMA 5HRKA 2DR5A 9ICOA 5CA7A 2RFFA 9ICCA 5HHIA 4MFFA 4QZCA 1BPEA 2M2UA 1PX5A 4KLFA 2DR7A 5J0SA 3JPTA 1JQRA 3V7LA 5BOLA 4UAWA 9ICKA 3C5GA 4I2JA 4YD1A 3C5FA 4F5RA 4KLDA 4PGXA 4LZGA 3AQKA
chains in the Genus database with same CATH superfamily
4PHAA 4QZAA 2ID1A 1ZQLA 4K97A 3AU2A 4GXJA 1ZJNA 5TZVA 4UB3A 3UQ2A 1ZQFA 7ICGA 5CHGA 1R8AA 2BBJA 1VFGA 4RQ8A 3GDXA 1R8CA 4O6AA 1MIVA 2O5AA 4E8FA 5DB9A 3HJ1A 3RH6A 1FA0A 2DRAA 4QZEA 4I2BA 4LVSA 1XSNA 4X4RA 4XQ8A 2IHOA 4WQLA 5DBAA 5DECA 4KLGA 3OV7A 3CK6A 9ICXA 4KLTA 4KLQA 1ZQDA 4EBJA 3L9DA 5CB1A 4JWMA 4QZHA 5J0TA 4KLLA 3EF2A 4M9GA 2BCSA 2ZH2A 3OVSA 5J2CA 4FHWA 4FHVA 4TURA 2IUBA 4MF8A 1MQ3A 4TUPA 4NLNA 4YN4A 2ZH8A 1UETA 2ZH3A 4TUQA 3JYYA 5DBBA 9ICBA 2DVIA 3HIYA 5HRBA 4N7RA 4DOCA 1MIWA 4EEBA 4I2DA 4DOAA 4I2CA 4Z6DA 3B0YA 4X4TA 1ZQNA 8ICLA 5D62A 2W9MA 7ICPA 7ICNA 5DDYA 5J0XA 4F5PA 2M2VA 3PHZA 5J2AA 7ICTA 1Q78A 4K98A 9ICRA 5J29A 4WC4A 4XQ7A 5J0OA 2HHPA 1BPZA 9ICVA 4LEVA 4PGQA 4RWNA 9ICSA 2BCUA 1NOMA 1JAJA 4RT3A 5J2BA 2B56A 3ISCA 8ICRA 5IINA 8ICQA 4QZ9A 9ICEA 3JPNA 5J2KA 4KLJA 5CHEA 4AT9A 3AUOA 2P66A 4P4PA 9ICHA 1BPBA 1ZQQA 4O5CA 4QZIA 5DB7A 5BPCA 3JPOA 8ICPA 7ICVA 1ZQTA 2Q66A 4WBYA 1ZQOA 1TV9A 4YCXA 4RPYA 4HX0A 5J0PA 4X4NA 4WC6A 4NXXA 4AT9B 9ICGA 3WFQE 4M2YA 3MGIA 4O69A 2PBEA 3LK9A 1R89A 4QZFA 4XA5A 5F2VO 4XUSA 3MBYA 3JPPA 1ZQZA 3HWTA 3RH5A 2BCRA 4R63A 8ICHA 4P4OA 4FHXA 4IQWA 3H39A 3HX0A 2PXIA 1ZQUA 4NLZA 3ERCC 1GPJA 2DR8A 2GA9D 8ICVA 4KB6A 3TFSA 4KLMA 4FH5A 4Z6FA 4RQ7A 4E7XA 4LT6A 1ZQWA 8ICJA 4WC5A 4EEDA 7ICHA 5IIIA 4YMMA 5J2JA 8ICNA 5J0WA 2DR9A 4EP7A 1JN3A 4OAIZ 2ISOA 8ICGA 8ICFA 3UQ0A 4IQVA 5CFTA 5HREA 3PNCA 1ZQKA 5IIKA 4X0BA 4X4OA 4NLKA 4M04A 1ZQBA 3PMNA 2HN2A 5DEDA 2M2WA 2GWSA 3ISBA 4K4IA 1HUOA 4FO6A 5HHHA 3WFSC 7ICFA 4ATBA 2ZHAA 5HRDA 5EOZA 7ICKA 4UD4A 4O68A 5HC9A 4K8VA 4UAZA 3AQLA 3MCRA 9ICNA 5HRIA 4WH5A 3AU6A 1NO5A 4X4VA 9ICAA 4KLHA 4LZGA 1Q79A 9ICMA 4PHPA 3UXOA 3MDAA 4QZDA 4UB2A 5HRLA 3RH4A 4FHPA 4X5VA 5J2FA 4NKUA 2B51A 3C2LA 3H37A 5CFSA 4RQ6A 3AQMA 3K75D 4EV6A 1V4AA 5HRHA 4I0UA 4S3NA 1BPXA 4I2GA 4O5EA 4RPZA 4DO9A 4KM5A 4I28A 3ISDA 1ZQYA 4FO1A 7ICUA 4NXZA 4K99A 4EBKA 5D4BA 4RWQA 2BE3A 9ICWA 1ZQVA 8ICKA 4UAYA 8ICSA 4NXWA 5DB6A 3C2MA 4WC3A 4RQ2A 5HRGA 4E80A 3RJIA 5J0UA 4RWPA 5J0RA 3K7DA 5J0QA 5D46A 4UD5A 9ICPA 7ICRA 2FCLA 7ICIA 3NYBA 2PFOA 1OU5A 3V72A 3H3AA 4M9NA 2FMSA 5CWRA 9ICUA 5HR9A 4R66A 3ER9B 4LEZA 4UB1A 4NXUA 4F5QA 4WC1A 3RJKA 2EWRA 4O5KA 2GAFD 4YMOA 5J2DA 4DOBA 7ICQA 4NKTA 4O67A 2NRKA 4X4QA 3MDCA 3UPQA 3RJHA 4NXTA 4R64A 3JCFA 5DKWA 3RJJA 3RJGA 4RT2A 4MF2A 4WCWA 1MIYA 8ICWA 4YD2A 3WFOA 4K9BA 1RZTA 3RJEA 3WFRE 4RQ3A 2FMPA 4I27A 4UB5A 2O1PA 4FHYA 4OAFA 2ZH5A 2PFPA 4OAGA 1ZQGA 4RQ0A 4M9HA 3ER8C 5D63A 5CFUA 1ZQIA 2HN1A 1UEUA 2BCQA 4PHEA 3OVAA 8ICBA 4M5DA 5J2EA 2VANA 4Z6CA 4PHDA 5CP2A 1ZQJA 2ZH7A 4I2FA 1XSLA 7ICMA 8ICZA 4FH3A 2ZH1A 3V7KA 1ZQCA 3JPRA 4UB4A 2ZH6A 4F5NA 4I2IA 5IIJA 7ICJA 1YLQA 2ZH4A 1ZQXA 3UPSA 4LZDA 4I2HA 4WC7A 4AT7A 4MFCA 4RQ4A 1ZQRA 4K4GA 4P2HA 4QZGA 4AT8A 4RWOA 8ICMA 4O9MA 5IIOA 3JPQA 4RQ5A 4KLUA 5CJ7A 4YMNA 5IILA 2BPGA 4JLZA 8ICEA 3OVBA 8ICCA 1F5AA 5DBCA 8ICAA 5D61A 3OGUA 4TUSA 1UEVA 4R65A 3MGHA 4EGWA 4X4UA 4AT7B 4NM1A 5J0YA 4PPXA 1MQ2A 8ICXA 4IQUA 8ICOA 4AT8B 3RJFA 1BPYA 7ICOA 1ZQAA 4ATBB 3UXPA 1TFYA 7ICLA 8ICIA 9ICLA 4UBBA 1ZQMA 2ISPA 2IHMA 3C18A 4WBZA 1VJ7A 2BCVA 4GXKA 4P4MA 4Z6EA 3OUYA 1TVAA 2DRBA 3JZ0A 9ICFA 1KDHA 4I2EA 5IIMA 7ICEA 3HJ4A 4QZ8A 2BBHA 4NY8A 1KNYA 4X0AA 5D49A 5J2IA 4PH5A 9ICIA 5J2GA 4MKPA 1HUZA 3PMLA 4KLEA 4QZBA 4K4HA 9ICTA 4IG8A 2I9GA 3NWIA 3OWGA 4WOYA 5J2HA 2PFQA 1ZQPA 4X4PA 4KLSA 3WFPA 5DDMA 4WQKA 5HRFA 8ICYA 4PGYA 4M9JA 4IQTA 3OUYB 3NVOA 3AQNA 7ICSA 4F5OA 4OAHA 3JPSA 4NXVA 2ZH9A 3C2KA 1ZQSA 3C66A 4KLOA 8ICUA 1JMSA 4RPXA 1XSPA 4XRHA 1WOTA 4M0AA 3H38A 3B0XA 2B4VA 3HW8A 3NKUA 2M2TA 3TFRA 1ZQEA 5JTGA 4M47A 4KLIA 2BPFA 9ICJA 4RQ1A 3UXNA 4MFAA 8ICTA 1RPLA 1R8BA 2BPCA 3LQCB 4WC0A 4WC2A 1BPDA 2PFNA 4M9LA 4NM2A 4UBCA 4JWNA 4K96A 2FMQA 9ICQA 1TFWA 5BOMA 5CR0A 1KEJA 4JLXA 2ZHBA 4X4SA 3V7JA 4K9AA 5DB8A 1ZQHA 4I29A 4I2AA 4GXIA 1ZJMA 5HRKA 2DR5A 9ICOA 5CA7A 2RFFA 9ICCA 5HHIA 4MFFA 4QZCA 5B3PA 1BPEA 2M2UA 1PX5A 4KLFA 4LEWA 2DR7A 5J0SA 3JPTA 1JQRA 4LEYA 3V7LA 5B3QA 5BOLA 4UAWA 9ICKA 3C5GA 4I2JA 4YD1A 3C5FA 4F5RA 4KLDA 4PGXA 4XJEA 3AQKA
chains in the Genus database with same CATH topology
4PHAA 4QZAA 2ID1A 1ZQLA 3AU2A 4GXJA 1ZJNA 5TZVA 4UB3A 3UQ2A 1ZQFA 7ICGA 5CHGA 1R8AA 1VFGA 4RQ8A 3GDXA 1R8CA 1MIVA 2O5AA 4E8FA 5DB9A 3HJ1A 3RH6A 1FA0A 2DRAA 4QZEA 4I2BA 4LVSA 1XSNA 4X4RA 4XQ8A 5DBAA 5DECA 4KLGA 3OV7A 9ICXA 4KLTA 4KLQA 1ZQDA 4EBJA 3L9DA 5CB1A 4JWMA 4QZHA 5J0TA 4KLLA 4M9GA 2BCSA 2ZH2A 3OVSA 5J2CA 4FHWA 4FHVA 4TURA 4MF8A 4NLNA 1MQ3A 4TUPA 4YN4A 2ZH8A 1UETA 2ZH3A 4TUQA 3JYYA 5DBBA 9ICBA 2DVIA 3HIYA 5HRBA 4DOCA 1MIWA 4DOAA 4I2DA 4I2CA 4Z6DA 3B0YA 4X4TA 1ZQNA 8ICLA 7ICPA 2W9MA 7ICNA 5DDYA 5J0XA 4F5PA 2M2VA 5J2AA 7ICTA 1Q78A 9ICRA 5J29A 4WC4A 4XQ7A 5J0OA 2HHPA 1BPZA 9ICVA 4PGQA 4RWNA 9ICSA 2BCUA 1NOMA 1JAJA 4RT3A 5J2BA 3ISCA 8ICRA 5IINA 8ICQA 4QZ9A 9ICEA 3JPNA 5J2KA 4KLJA 4AT9A 3AUOA 2P66A 4P4PA 9ICHA 1BPBA 1ZQQA 4O5CA 4QZIA 5DB7A 5BPCA 3JPOA 8ICPA 7ICVA 1ZQTA 2Q66A 4WBYA 1ZQOA 1TV9A 4YCXA 4RPYA 5J0PA 4X4NA 4WC6A 4AT9B 9ICGA 3WFQE 4M2YA 3MGIA 2PBEA 3LK9A 1R89A 4QZFA 4XA5A 5F2VO 4XUSA 3MBYA 3JPPA 1ZQZA 3HWTA 3RH5A 2BCRA 4R63A 8ICHA 4P4OA 4FHXA 4IQWA 3H39A 3HX0A 2PXIA 1ZQUA 4NLZA 2DR8A 8ICVA 3TFSA 4KLMA 4FH5A 4Z6FA 4RQ7A 4E7XA 4LT6A 1ZQWA 8ICJA 4WC5A 7ICHA 5IIIA 4YMMA 5J2JA 8ICNA 5J0WA 2DR9A 4EP7A 1JN3A 2ISOA 8ICGA 8ICFA 3UQ0A 4IQVA 5HREA 3PNCA 1ZQKA 5IIKA 4X0BA 4X4OA 4NLKA 4M04A 1ZQBA 3PMNA 5DEDA 2M2WA 2GWSA 3ISBA 4K4IA 1HUOA 4FO6A 5HHHA 3WFSC 7ICFA 4ATBA 2ZHAA 5HRDA 5EOZA 7ICKA 4UD4A 5HC9A 4UAZA 3AQLA 9ICNA 5HRIA 3AU6A 1NO5A 4X4VA 9ICAA 4KLHA 1Q79A 9ICMA 4PHPA 3UXOA 3MDAA 4QZDA 4UB2A 5HRLA 3RH4A 4FHPA 4X5VA 5J2FA 4NKUA 3C2LA 3H37A 4RQ6A 3AQMA 3K75D 5HRHA 1V4AA 4S3NA 1BPXA 4I2GA 4O5EA 4RPZA 4DO9A 4I28A 3ISDA 1ZQYA 7ICUA 4NXZA 4EBKA 5D4BA 4RWQA 2BE3A 9ICWA 1ZQVA 8ICKA 4UAYA 8ICSA 5DB6A 3C2MA 4WC3A 4RQ2A 5HRGA 4E80A 3RJIA 5J0UA 4RWPA 5J0RA 5J0QA 5D46A 4UD5A 9ICPA 7ICRA 7ICIA 3NYBA 2PFOA 1OU5A 3V72A 3H3AA 4M9NA 2FMSA 5CWRA 9ICUA 5HR9A 4R66A 4UB1A 4F5QA 4WC1A 3RJKA 4O5KA 4YMOA 5J2DA 4DOBA 7ICQA 4NKTA 4X4QA 2NRKA 3MDCA 3UPQA 3RJHA 4R64A 5DKWA 3RJJA 3RJGA 4RT2A 4MF2A 4WCWA 1MIYA 8ICWA 4YD2A 3WFOA 1RZTA 3RJEA 3WFRE 4RQ3A 2FMPA 4I27A 4UB5A 2O1PA 4FHYA 2ZH5A 2PFPA 1ZQGA 4RQ0A 4M9HA 1ZQIA 1UEUA 2BCQA 4PHEA 3OVAA 8ICBA 4M5DA 2VANA 5J2EA 4Z6CA 4PHDA 5CP2A 1ZQJA 2ZH7A 4I2FA 1XSLA 7ICMA 8ICZA 4FH3A 2ZH1A 3V7KA 1ZQCA 3JPRA 4UB4A 2ZH6A 4F5NA 4I2IA 5IIJA 7ICJA 1YLQA 2ZH4A 1ZQXA 3UPSA 4LZDA 4I2HA 4WC7A 4AT7A 4MFCA 4RQ4A 1ZQRA 4K4GA 4P2HA 4QZGA 4AT8A 4RWOA 8ICMA 4O9MA 5IIOA 3JPQA 4RQ5A 4KLUA 5CJ7A 4YMNA 5IILA 2BPGA 8ICEA 3OVBA 8ICCA 1F5AA 5DBCA 8ICAA 3OGUA 4TUSA 1UEVA 4R65A 3MGHA 4X4UA 4AT7B 4NM1A 5J0YA 4PPXA 1MQ2A 8ICXA 4IQUA 8ICOA 4AT8B 3RJFA 1BPYA 7ICOA 1ZQAA 4ATBB 3UXPA 1TFYA 7ICLA 8ICIA 9ICLA 4UBBA 1ZQMA 2ISPA 2IHMA 3C18A 4WBZA 1VJ7A 2BCVA 4GXKA 4P4MA 4Z6EA 3OUYA 1TVAA 2DRBA 3JZ0A 9ICFA 1KDHA 4I2EA 5IIMA 7ICEA 3HJ4A 4QZ8A 4NY8A 1KNYA 4X0AA 5D49A 5J2IA 4PH5A 9ICIA 5J2GA 1HUZA 3PMLA 4KLEA 4QZBA 4K4HA 9ICTA 4IG8A 2I9GA 2PFQA 5J2HA 1ZQPA 4X4PA 4KLSA 3WFPA 5DDMA 5HRFA 8ICYA 4PGYA 4M9JA 4IQTA 3OUYB 3AQNA 7ICSA 4F5OA 3JPSA 2ZH9A 3C2KA 1ZQSA 3C66A 4KLOA 8ICUA 1JMSA 4RPXA 1XSPA 4XRHA 1WOTA 4M0AA 3H38A 3B0XA 3HW8A 2M2TA 3TFRA 1ZQEA 4M47A 4KLIA 2BPFA 9ICJA 4RQ1A 3UXNA 4MFAA 8ICTA 1RPLA 1R8BA 2BPCA 3LQCB 4WC0A 4WC2A 1BPDA 2PFNA 4M9LA 4NM2A 4UBCA 4JWNA 2FMQA 9ICQA 1TFWA 5BOMA 5CR0A 1KEJA 2ZHBA 4X4SA 3V7JA 5DB8A 1ZQHA 4I29A 4I2AA 4GXIA 1ZJMA 5HRKA 2DR5A 9ICOA 5CA7A 2RFFA 9ICCA 5HHIA 4MFFA 4QZCA 1BPEA 2M2UA 1PX5A 4KLFA 2DR7A 5J0SA 3JPTA 1JQRA 3V7LA 5BOLA 4UAWA 9ICKA 3C5GA 4I2JA 4YD1A 3C5FA 4F5RA 4KLDA 4PGXA 4LZGA 3AQKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PHA A;  4QZA A;  2ID1 A;  1ZQL A;  3AU2 A;  4GXJ A;  1ZJN A;  5TZV A;  4UB3 A;  3UQ2 A;  1ZQF A;  7ICG A;  5CHG A;  1R8A A;  1VFG A;  4RQ8 A;  3GDX A;  1R8C A;  1MIV A;  2O5A A;  4E8F A;  5DB9 A;  3HJ1 A;  3RH6 A;  1FA0 A;  2DRA A;  4QZE A;  4I2B A;  4LVS A;  1XSN A;  4X4R A;  4XQ8 A;  5DBA A;  5DEC A;  4KLG A;  3OV7 A;  9ICX A;  4KLT A;  4KLQ A;  1ZQD A;  4EBJ A;  3L9D A;  5CB1 A;  4JWM A;  4QZH A;  5J0T A;  4KLL A;  4M9G A;  2BCS A;  2ZH2 A;  3OVS A;  5J2C A;  4FHW A;  4FHV A;  4TUR A;  4MF8 A;  4NLN A;  1MQ3 A;  4TUP A;  4YN4 A;  2ZH8 A;  1UET A;  2ZH3 A;  4TUQ A;  3JYY A;  5DBB A;  9ICB A;  2DVI A;  3HIY A;  5HRB A;  4DOC A;  1MIW A;  4DOA A;  4I2D A;  4I2C A;  4Z6D A;  3B0Y A;  4X4T A;  1ZQN A;  8ICL A;  7ICP A;  2W9M A;  7ICN A;  5DDY A;  5J0X A;  4F5P A;  2M2V A;  5J2A A;  7ICT A;  1Q78 A;  9ICR A;  5J29 A;  4WC4 A;  4XQ7 A;  5J0O A;  2HHP A;  1BPZ A;  9ICV A;  4PGQ A;  4RWN A;  9ICS A;  2BCU A;  1NOM A;  1JAJ A;  4RT3 A;  5J2B A;  3ISC A;  8ICR A;  5IIN A;  8ICQ A;  4QZ9 A;  9ICE A;  3JPN A;  5J2K A;  4KLJ A;  4AT9 A;  3AUO A;  2P66 A;  4P4P A;  9ICH A;  1BPB A;  1ZQQ A;  4O5C A;  4QZI A;  5DB7 A;  5BPC A;  3JPO A;  8ICP A;  7ICV A;  1ZQT A;  2Q66 A;  4WBY A;  1ZQO A;  1TV9 A;  4YCX A;  4RPY A;  5J0P A;  4X4N A;  4WC6 A;  4AT9 B;  9ICG A;  3WFQ E;  4M2Y A;  3MGI A;  2PBE A;  3LK9 A;  1R89 A;  4QZF A;  4XA5 A;  5F2V O;  4XUS A;  3MBY A;  3JPP A;  1ZQZ A;  3HWT A;  3RH5 A;  2BCR A;  4R63 A;  8ICH A;  4P4O A;  4FHX A;  4IQW A;  3H39 A;  3HX0 A;  2PXI A;  1ZQU A;  4NLZ A;  2DR8 A;  8ICV A;  3TFS A;  4KLM A;  4FH5 A;  4Z6F A;  4RQ7 A;  4E7X A;  4LT6 A;  1ZQW A;  8ICJ A;  4WC5 A;  7ICH A;  5III A;  4YMM A;  5J2J A;  8ICN A;  5J0W A;  2DR9 A;  4EP7 A;  1JN3 A;  2ISO A;  8ICG A;  8ICF A;  3UQ0 A;  4IQV A;  5HRE A;  3PNC A;  1ZQK A;  5IIK A;  4X0B A;  4X4O A;  4NLK A;  4M04 A;  1ZQB A;  3PMN A;  5DED A;  2M2W A;  2GWS A;  3ISB A;  4K4I A;  1HUO A;  4FO6 A;  5HHH A;  3WFS C;  7ICF A;  4ATB A;  2ZHA A;  5HRD A;  5EOZ A;  7ICK A;  4UD4 A;  5HC9 A;  4UAZ A;  3AQL A;  9ICN A;  5HRI A;  3AU6 A;  1NO5 A;  4X4V A;  9ICA A;  4KLH A;  1Q79 A;  9ICM A;  4PHP A;  3UXO A;  3MDA A;  4QZD A;  4UB2 A;  5HRL A;  3RH4 A;  4FHP A;  4X5V A;  5J2F A;  4NKU A;  3C2L A;  3H37 A;  4RQ6 A;  3AQM A;  3K75 D;  5HRH A;  1V4A A;  4S3N A;  1BPX A;  4I2G A;  4O5E A;  4RPZ A;  4DO9 A;  4I28 A;  3ISD A;  1ZQY A;  7ICU A;  4NXZ A;  4EBK A;  5D4B A;  4RWQ A;  2BE3 A;  9ICW A;  1ZQV A;  8ICK A;  4UAY A;  8ICS A;  5DB6 A;  3C2M A;  4WC3 A;  4RQ2 A;  5HRG A;  4E80 A;  3RJI A;  5J0U A;  4RWP A;  5J0R A;  5J0Q A;  5D46 A;  4UD5 A;  9ICP A;  7ICR A;  7ICI A;  3NYB A;  2PFO A;  1OU5 A;  3V72 A;  3H3A A;  4M9N A;  2FMS A;  5CWR A;  9ICU A;  5HR9 A;  4R66 A;  4UB1 A;  4F5Q A;  4WC1 A;  3RJK A;  4O5K A;  4YMO A;  5J2D A;  4DOB A;  7ICQ A;  4NKT A;  4X4Q A;  2NRK A;  3MDC A;  3UPQ A;  3RJH A;  4R64 A;  5DKW A;  3RJJ A;  3RJG A;  4RT2 A;  4MF2 A;  4WCW A;  1MIY A;  8ICW A;  4YD2 A;  3WFO A;  1RZT A;  3RJE A;  3WFR E;  4RQ3 A;  2FMP A;  4I27 A;  4UB5 A;  2O1P A;  4FHY A;  2ZH5 A;  2PFP A;  1ZQG A;  4RQ0 A;  4M9H A;  1ZQI A;  1UEU A;  2BCQ A;  4PHE A;  3OVA A;  8ICB A;  4M5D A;  2VAN A;  5J2E A;  4Z6C A;  4PHD A;  5CP2 A;  1ZQJ A;  2ZH7 A;  4I2F A;  1XSL A;  7ICM A;  8ICZ A;  4FH3 A;  2ZH1 A;  3V7K A;  1ZQC A;  3JPR A;  4UB4 A;  2ZH6 A;  4F5N A;  4I2I A;  5IIJ A;  7ICJ A;  1YLQ A;  2ZH4 A;  1ZQX A;  3UPS A;  4LZD A;  4I2H A;  4WC7 A;  4AT7 A;  4MFC A;  4RQ4 A;  1ZQR A;  4K4G A;  4P2H A;  4QZG A;  4AT8 A;  4RWO A;  8ICM A;  4O9M A;  5IIO A;  3JPQ A;  4RQ5 A;  4KLU A;  5CJ7 A;  4YMN A;  5IIL A;  2BPG A;  8ICE A;  3OVB A;  8ICC A;  1F5A A;  5DBC A;  8ICA A;  3OGU A;  4TUS A;  1UEV A;  4R65 A;  3MGH A;  4X4U A;  4AT7 B;  4NM1 A;  5J0Y A;  4PPX A;  1MQ2 A;  8ICX A;  4IQU A;  8ICO A;  4AT8 B;  3RJF A;  1BPY A;  7ICO A;  1ZQA A;  4ATB B;  3UXP A;  1TFY A;  7ICL A;  8ICI A;  9ICL A;  4UBB A;  1ZQM A;  2ISP A;  2IHM A;  3C18 A;  4WBZ A;  1VJ7 A;  2BCV A;  4GXK A;  4P4M A;  4Z6E A;  3OUY A;  1TVA A;  2DRB A;  3JZ0 A;  9ICF A;  1KDH A;  4I2E A;  5IIM A;  7ICE A;  3HJ4 A;  4QZ8 A;  4NY8 A;  1KNY A;  4X0A A;  5D49 A;  5J2I A;  4PH5 A;  9ICI A;  5J2G A;  1HUZ A;  3PML A;  4KLE A;  4QZB A;  4K4H A;  9ICT A;  4IG8 A;  2I9G A;  2PFQ A;  5J2H A;  1ZQP A;  4X4P A;  4KLS A;  3WFP A;  5DDM A;  5HRF A;  8ICY A;  4PGY A;  4M9J A;  4IQT A;  3OUY B;  3AQN A;  7ICS A;  4F5O A;  3JPS A;  2ZH9 A;  3C2K A;  1ZQS A;  3C66 A;  4KLO A;  8ICU A;  1JMS A;  4RPX A;  1XSP A;  4XRH A;  1WOT A;  4M0A A;  3H38 A;  3B0X A;  3HW8 A;  2M2T A;  3TFR A;  1ZQE A;  4M47 A;  4KLI A;  2BPF A;  9ICJ A;  4RQ1 A;  3UXN A;  4MFA A;  8ICT A;  1RPL A;  1R8B A;  2BPC A;  3LQC B;  4WC0 A;  4WC2 A;  1BPD A;  2PFN A;  4M9L A;  4NM2 A;  4UBC A;  4JWN A;  2FMQ A;  9ICQ A;  1TFW A;  5BOM A;  5CR0 A;  1KEJ A;  2ZHB A;  4X4S A;  3V7J A;  5DB8 A;  1ZQH A;  4I29 A;  4I2A A;  4GXI A;  1ZJM A;  5HRK A;  2DR5 A;  9ICO A;  5CA7 A;  2RFF A;  9ICC A;  5HHI A;  4MFF A;  4QZC A;  1BPE A;  2M2U A;  1PX5 A;  4KLF A;  2DR7 A;  5J0S A;  3JPT A;  1JQR A;  3V7L A;  5BOL A;  4UAW A;  9ICK A;  3C5G A;  4I2J A;  4YD1 A;  3C5F A;  4F5R A;  4KLD A;  4PGX A;  4LZG A;  3AQK A; 
#chains in the Genus database with same CATH topology
 4PHA A;  4QZA A;  2ID1 A;  1ZQL A;  4K97 A;  3AU2 A;  4GXJ A;  1ZJN A;  5TZV A;  4UB3 A;  3UQ2 A;  1ZQF A;  7ICG A;  5CHG A;  1R8A A;  2BBJ A;  1VFG A;  4RQ8 A;  3GDX A;  1R8C A;  4O6A A;  1MIV A;  2O5A A;  4E8F A;  5DB9 A;  3HJ1 A;  3RH6 A;  1FA0 A;  2DRA A;  4QZE A;  4I2B A;  4LVS A;  1XSN A;  4X4R A;  4XQ8 A;  2IHO A;  4WQL A;  5DBA A;  5DEC A;  4KLG A;  3OV7 A;  3CK6 A;  9ICX A;  4KLT A;  4KLQ A;  1ZQD A;  4EBJ A;  3L9D A;  5CB1 A;  4JWM A;  4QZH A;  5J0T A;  4KLL A;  3EF2 A;  4M9G A;  2BCS A;  2ZH2 A;  3OVS A;  5J2C A;  4FHW A;  4FHV A;  4TUR A;  2IUB A;  4MF8 A;  1MQ3 A;  4TUP A;  4NLN A;  4YN4 A;  2ZH8 A;  1UET A;  2ZH3 A;  4TUQ A;  3JYY A;  5DBB A;  9ICB A;  2DVI A;  3HIY A;  5HRB A;  4N7R A;  4DOC A;  1MIW A;  4EEB A;  4I2D A;  4DOA A;  4I2C A;  4Z6D A;  3B0Y A;  4X4T A;  1ZQN A;  8ICL A;  5D62 A;  2W9M A;  7ICP A;  7ICN A;  5DDY A;  5J0X A;  4F5P A;  2M2V A;  3PHZ A;  5J2A A;  7ICT A;  1Q78 A;  4K98 A;  9ICR A;  5J29 A;  4WC4 A;  4XQ7 A;  5J0O A;  2HHP A;  1BPZ A;  9ICV A;  4LEV A;  4PGQ A;  4RWN A;  9ICS A;  2BCU A;  1NOM A;  1JAJ A;  4RT3 A;  5J2B A;  2B56 A;  3ISC A;  8ICR A;  5IIN A;  8ICQ A;  4QZ9 A;  9ICE A;  3JPN A;  5J2K A;  4KLJ A;  5CHE A;  4AT9 A;  3AUO A;  2P66 A;  4P4P A;  9ICH A;  1BPB A;  1ZQQ A;  4O5C A;  4QZI A;  5DB7 A;  5BPC A;  3JPO A;  8ICP A;  7ICV A;  1ZQT A;  2Q66 A;  4WBY A;  1ZQO A;  1TV9 A;  4YCX A;  4RPY A;  4HX0 A;  5J0P A;  4X4N A;  4WC6 A;  4NXX A;  4AT9 B;  9ICG A;  3WFQ E;  4M2Y A;  3MGI A;  4O69 A;  2PBE A;  3LK9 A;  1R89 A;  4QZF A;  4XA5 A;  5F2V O;  4XUS A;  3MBY A;  3JPP A;  1ZQZ A;  3HWT A;  3RH5 A;  2BCR A;  4R63 A;  8ICH A;  4P4O A;  4FHX A;  4IQW A;  3H39 A;  3HX0 A;  2PXI A;  1ZQU A;  4NLZ A;  3ERC C;  1GPJ A;  2DR8 A;  2GA9 D;  8ICV A;  4KB6 A;  3TFS A;  4KLM A;  4FH5 A;  4Z6F A;  4RQ7 A;  4E7X A;  4LT6 A;  1ZQW A;  8ICJ A;  4WC5 A;  4EED A;  7ICH A;  5III A;  4YMM A;  5J2J A;  8ICN A;  5J0W A;  2DR9 A;  4EP7 A;  1JN3 A;  4OAI Z;  2ISO A;  8ICG A;  8ICF A;  3UQ0 A;  4IQV A;  5CFT A;  5HRE A;  3PNC A;  1ZQK A;  5IIK A;  4X0B A;  4X4O A;  4NLK A;  4M04 A;  1ZQB A;  3PMN A;  2HN2 A;  5DED A;  2M2W A;  2GWS A;  3ISB A;  4K4I A;  1HUO A;  4FO6 A;  5HHH A;  3WFS C;  7ICF A;  4ATB A;  2ZHA A;  5HRD A;  5EOZ A;  7ICK A;  4UD4 A;  4O68 A;  5HC9 A;  4K8V A;  4UAZ A;  3AQL A;  3MCR A;  9ICN A;  5HRI A;  4WH5 A;  3AU6 A;  1NO5 A;  4X4V A;  9ICA A;  4KLH A;  4LZG A;  1Q79 A;  9ICM A;  4PHP A;  3UXO A;  3MDA A;  4QZD A;  4UB2 A;  5HRL A;  3RH4 A;  4FHP A;  4X5V A;  5J2F A;  4NKU A;  2B51 A;  3C2L A;  3H37 A;  5CFS A;  4RQ6 A;  3AQM A;  3K75 D;  4EV6 A;  1V4A A;  5HRH A;  4I0U A;  4S3N A;  1BPX A;  4I2G A;  4O5E A;  4RPZ A;  4DO9 A;  4KM5 A;  4I28 A;  3ISD A;  1ZQY A;  4FO1 A;  7ICU A;  4NXZ A;  4K99 A;  4EBK A;  5D4B A;  4RWQ A;  2BE3 A;  9ICW A;  1ZQV A;  8ICK A;  4UAY A;  8ICS A;  4NXW A;  5DB6 A;  3C2M A;  4WC3 A;  4RQ2 A;  5HRG A;  4E80 A;  3RJI A;  5J0U A;  4RWP A;  5J0R A;  3K7D A;  5J0Q A;  5D46 A;  4UD5 A;  9ICP A;  7ICR A;  2FCL A;  7ICI A;  3NYB A;  2PFO A;  1OU5 A;  3V72 A;  3H3A A;  4M9N A;  2FMS A;  5CWR A;  9ICU A;  5HR9 A;  4R66 A;  3ER9 B;  4LEZ A;  4UB1 A;  4NXU A;  4F5Q A;  4WC1 A;  3RJK A;  2EWR A;  4O5K A;  2GAF D;  4YMO A;  5J2D A;  4DOB A;  7ICQ A;  4NKT A;  4O67 A;  2NRK A;  4X4Q A;  3MDC A;  3UPQ A;  3RJH A;  4NXT A;  4R64 A;  3JCF A;  5DKW A;  3RJJ A;  3RJG A;  4RT2 A;  4MF2 A;  4WCW A;  1MIY A;  8ICW A;  4YD2 A;  3WFO A;  4K9B A;  1RZT A;  3RJE A;  3WFR E;  4RQ3 A;  2FMP A;  4I27 A;  4UB5 A;  2O1P A;  4FHY A;  4OAF A;  2ZH5 A;  2PFP A;  4OAG A;  1ZQG A;  4RQ0 A;  4M9H A;  3ER8 C;  5D63 A;  5CFU A;  1ZQI A;  2HN1 A;  1UEU A;  2BCQ A;  4PHE A;  3OVA A;  8ICB A;  4M5D A;  5J2E A;  2VAN A;  4Z6C A;  4PHD A;  5CP2 A;  1ZQJ A;  2ZH7 A;  4I2F A;  1XSL A;  7ICM A;  8ICZ A;  4FH3 A;  2ZH1 A;  3V7K A;  1ZQC A;  3JPR A;  4UB4 A;  2ZH6 A;  4F5N A;  4I2I A;  5IIJ A;  7ICJ A;  1YLQ A;  2ZH4 A;  1ZQX A;  3UPS A;  4LZD A;  4I2H A;  4WC7 A;  4AT7 A;  4MFC A;  4RQ4 A;  1ZQR A;  4K4G A;  4P2H A;  4QZG A;  4AT8 A;  4RWO A;  8ICM A;  4O9M A;  5IIO A;  3JPQ A;  4RQ5 A;  4KLU A;  5CJ7 A;  4YMN A;  5IIL A;  2BPG A;  4JLZ A;  8ICE A;  3OVB A;  8ICC A;  1F5A A;  5DBC A;  8ICA A;  5D61 A;  3OGU A;  4TUS A;  1UEV A;  4R65 A;  3MGH A;  4EGW A;  4X4U A;  4AT7 B;  4NM1 A;  5J0Y A;  4PPX A;  1MQ2 A;  8ICX A;  4IQU A;  8ICO A;  4AT8 B;  3RJF A;  1BPY A;  7ICO A;  1ZQA A;  4ATB B;  3UXP A;  1TFY A;  7ICL A;  8ICI A;  9ICL A;  4UBB A;  1ZQM A;  2ISP A;  2IHM A;  3C18 A;  4WBZ A;  1VJ7 A;  2BCV A;  4GXK A;  4P4M A;  4Z6E A;  3OUY A;  1TVA A;  2DRB A;  3JZ0 A;  9ICF A;  1KDH A;  4I2E A;  5IIM A;  7ICE A;  3HJ4 A;  4QZ8 A;  2BBH A;  4NY8 A;  1KNY A;  4X0A A;  5D49 A;  5J2I A;  4PH5 A;  9ICI A;  5J2G A;  4MKP A;  1HUZ A;  3PML A;  4KLE A;  4QZB A;  4K4H A;  9ICT A;  4IG8 A;  2I9G A;  3NWI A;  3OWG A;  4WOY A;  5J2H A;  2PFQ A;  1ZQP A;  4X4P A;  4KLS A;  3WFP A;  5DDM A;  4WQK A;  5HRF A;  8ICY A;  4PGY A;  4M9J A;  4IQT A;  3OUY B;  3NVO A;  3AQN A;  7ICS A;  4F5O A;  4OAH A;  3JPS A;  4NXV A;  2ZH9 A;  3C2K A;  1ZQS A;  3C66 A;  4KLO A;  8ICU A;  1JMS A;  4RPX A;  1XSP A;  4XRH A;  1WOT A;  4M0A A;  3H38 A;  3B0X A;  2B4V A;  3HW8 A;  3NKU A;  2M2T A;  3TFR A;  1ZQE A;  5JTG A;  4M47 A;  4KLI A;  2BPF A;  9ICJ A;  4RQ1 A;  3UXN A;  4MFA A;  8ICT A;  1RPL A;  1R8B A;  2BPC A;  3LQC B;  4WC0 A;  4WC2 A;  1BPD A;  2PFN A;  4M9L A;  4NM2 A;  4UBC A;  4JWN A;  4K96 A;  2FMQ A;  9ICQ A;  1TFW A;  5BOM A;  5CR0 A;  1KEJ A;  4JLX A;  2ZHB A;  4X4S A;  3V7J A;  4K9A A;  5DB8 A;  1ZQH A;  4I29 A;  4I2A A;  4GXI A;  1ZJM A;  5HRK A;  2DR5 A;  9ICO A;  5CA7 A;  2RFF A;  9ICC A;  5HHI A;  4MFF A;  4QZC A;  5B3P A;  1BPE A;  2M2U A;  1PX5 A;  4KLF A;  4LEW A;  2DR7 A;  5J0S A;  3JPT A;  1JQR A;  4LEY A;  3V7L A;  5B3Q A;  5BOL A;  4UAW A;  9ICK A;  3C5G A;  4I2J A;  4YD1 A;  3C5F A;  4F5R A;  4KLD A;  4PGX A;  4XJE A;  3AQK A; 
#chains in the Genus database with same CATH homology
 4PHA A;  4QZA A;  2ID1 A;  1ZQL A;  3AU2 A;  4GXJ A;  1ZJN A;  5TZV A;  4UB3 A;  3UQ2 A;  1ZQF A;  7ICG A;  5CHG A;  1R8A A;  1VFG A;  4RQ8 A;  3GDX A;  1R8C A;  1MIV A;  2O5A A;  4E8F A;  5DB9 A;  3HJ1 A;  3RH6 A;  1FA0 A;  2DRA A;  4QZE A;  4I2B A;  4LVS A;  1XSN A;  4X4R A;  4XQ8 A;  5DBA A;  5DEC A;  4KLG A;  3OV7 A;  9ICX A;  4KLT A;  4KLQ A;  1ZQD A;  4EBJ A;  3L9D A;  5CB1 A;  4JWM A;  4QZH A;  5J0T A;  4KLL A;  4M9G A;  2BCS A;  2ZH2 A;  3OVS A;  5J2C A;  4FHW A;  4FHV A;  4TUR A;  4MF8 A;  4NLN A;  1MQ3 A;  4TUP A;  4YN4 A;  2ZH8 A;  1UET A;  2ZH3 A;  4TUQ A;  3JYY A;  5DBB A;  9ICB A;  2DVI A;  3HIY A;  5HRB A;  4DOC A;  1MIW A;  4DOA A;  4I2D A;  4I2C A;  4Z6D A;  3B0Y A;  4X4T A;  1ZQN A;  8ICL A;  7ICP A;  2W9M A;  7ICN A;  5DDY A;  5J0X A;  4F5P A;  2M2V A;  5J2A A;  7ICT A;  1Q78 A;  9ICR A;  5J29 A;  4WC4 A;  4XQ7 A;  5J0O A;  2HHP A;  1BPZ A;  9ICV A;  4PGQ A;  4RWN A;  9ICS A;  2BCU A;  1NOM A;  1JAJ A;  4RT3 A;  5J2B A;  3ISC A;  8ICR A;  5IIN A;  8ICQ A;  4QZ9 A;  9ICE A;  3JPN A;  5J2K A;  4KLJ A;  4AT9 A;  3AUO A;  2P66 A;  4P4P A;  9ICH A;  1BPB A;  1ZQQ A;  4O5C A;  4QZI A;  5DB7 A;  5BPC A;  3JPO A;  8ICP A;  7ICV A;  1ZQT A;  2Q66 A;  4WBY A;  1ZQO A;  1TV9 A;  4YCX A;  4RPY A;  5J0P A;  4X4N A;  4WC6 A;  4AT9 B;  9ICG A;  3WFQ E;  4M2Y A;  3MGI A;  2PBE A;  3LK9 A;  1R89 A;  4QZF A;  4XA5 A;  5F2V O;  4XUS A;  3MBY A;  3JPP A;  1ZQZ A;  3HWT A;  3RH5 A;  2BCR A;  4R63 A;  8ICH A;  4P4O A;  4FHX A;  4IQW A;  3H39 A;  3HX0 A;  2PXI A;  1ZQU A;  4NLZ A;  2DR8 A;  8ICV A;  3TFS A;  4KLM A;  4FH5 A;  4Z6F A;  4RQ7 A;  4E7X A;  4LT6 A;  1ZQW A;  8ICJ A;  4WC5 A;  7ICH A;  5III A;  4YMM A;  5J2J A;  8ICN A;  5J0W A;  2DR9 A;  4EP7 A;  1JN3 A;  2ISO A;  8ICG A;  8ICF A;  3UQ0 A;  4IQV A;  5HRE A;  3PNC A;  1ZQK A;  5IIK A;  4X0B A;  4X4O A;  4NLK A;  4M04 A;  1ZQB A;  3PMN A;  5DED A;  2M2W A;  2GWS A;  3ISB A;  4K4I A;  1HUO A;  4FO6 A;  5HHH A;  3WFS C;  7ICF A;  4ATB A;  2ZHA A;  5HRD A;  5EOZ A;  7ICK A;  4UD4 A;  5HC9 A;  4UAZ A;  3AQL A;  9ICN A;  5HRI A;  3AU6 A;  1NO5 A;  4X4V A;  9ICA A;  4KLH A;  1Q79 A;  9ICM A;  4PHP A;  3UXO A;  3MDA A;  4QZD A;  4UB2 A;  5HRL A;  3RH4 A;  4FHP A;  4X5V A;  5J2F A;  4NKU A;  3C2L A;  3H37 A;  4RQ6 A;  3AQM A;  3K75 D;  5HRH A;  1V4A A;  4S3N A;  1BPX A;  4I2G A;  4O5E A;  4RPZ A;  4DO9 A;  4I28 A;  3ISD A;  1ZQY A;  7ICU A;  4NXZ A;  4EBK A;  5D4B A;  4RWQ A;  2BE3 A;  9ICW A;  1ZQV A;  8ICK A;  4UAY A;  8ICS A;  5DB6 A;  3C2M A;  4WC3 A;  4RQ2 A;  5HRG A;  4E80 A;  3RJI A;  5J0U A;  4RWP A;  5J0R A;  5J0Q A;  5D46 A;  4UD5 A;  9ICP A;  7ICR A;  7ICI A;  3NYB A;  2PFO A;  1OU5 A;  3V72 A;  3H3A A;  4M9N A;  2FMS A;  5CWR A;  9ICU A;  5HR9 A;  4R66 A;  4UB1 A;  4F5Q A;  4WC1 A;  3RJK A;  4O5K A;  4YMO A;  5J2D A;  4DOB A;  7ICQ A;  4NKT A;  4X4Q A;  2NRK A;  3MDC A;  3UPQ A;  3RJH A;  4R64 A;  5DKW A;  3RJJ A;  3RJG A;  4RT2 A;  4MF2 A;  4WCW A;  1MIY A;  8ICW A;  4YD2 A;  3WFO A;  1RZT A;  3RJE A;  3WFR E;  4RQ3 A;  2FMP A;  4I27 A;  4UB5 A;  2O1P A;  4FHY A;  2ZH5 A;  2PFP A;  1ZQG A;  4RQ0 A;  4M9H A;  1ZQI A;  1UEU A;  2BCQ A;  4PHE A;  3OVA A;  8ICB A;  4M5D A;  2VAN A;  5J2E A;  4Z6C A;  4PHD A;  5CP2 A;  1ZQJ A;  2ZH7 A;  4I2F A;  1XSL A;  7ICM A;  8ICZ A;  4FH3 A;  2ZH1 A;  3V7K A;  1ZQC A;  3JPR A;  4UB4 A;  2ZH6 A;  4F5N A;  4I2I A;  5IIJ A;  7ICJ A;  1YLQ A;  2ZH4 A;  1ZQX A;  3UPS A;  4LZD A;  4I2H A;  4WC7 A;  4AT7 A;  4MFC A;  4RQ4 A;  1ZQR A;  4K4G A;  4P2H A;  4QZG A;  4AT8 A;  4RWO A;  8ICM A;  4O9M A;  5IIO A;  3JPQ A;  4RQ5 A;  4KLU A;  5CJ7 A;  4YMN A;  5IIL A;  2BPG A;  8ICE A;  3OVB A;  8ICC A;  1F5A A;  5DBC A;  8ICA A;  3OGU A;  4TUS A;  1UEV A;  4R65 A;  3MGH A;  4X4U A;  4AT7 B;  4NM1 A;  5J0Y A;  4PPX A;  1MQ2 A;  8ICX A;  4IQU A;  8ICO A;  4AT8 B;  3RJF A;  1BPY A;  7ICO A;  1ZQA A;  4ATB B;  3UXP A;  1TFY A;  7ICL A;  8ICI A;  9ICL A;  4UBB A;  1ZQM A;  2ISP A;  2IHM A;  3C18 A;  4WBZ A;  1VJ7 A;  2BCV A;  4GXK A;  4P4M A;  4Z6E A;  3OUY A;  1TVA A;  2DRB A;  3JZ0 A;  9ICF A;  1KDH A;  4I2E A;  5IIM A;  7ICE A;  3HJ4 A;  4QZ8 A;  4NY8 A;  1KNY A;  4X0A A;  5D49 A;  5J2I A;  4PH5 A;  9ICI A;  5J2G A;  1HUZ A;  3PML A;  4KLE A;  4QZB A;  4K4H A;  9ICT A;  4IG8 A;  2I9G A;  2PFQ A;  5J2H A;  1ZQP A;  4X4P A;  4KLS A;  3WFP A;  5DDM A;  5HRF A;  8ICY A;  4PGY A;  4M9J A;  4IQT A;  3OUY B;  3AQN A;  7ICS A;  4F5O A;  3JPS A;  2ZH9 A;  3C2K A;  1ZQS A;  3C66 A;  4KLO A;  8ICU A;  1JMS A;  4RPX A;  1XSP A;  4XRH A;  1WOT A;  4M0A A;  3H38 A;  3B0X A;  3HW8 A;  2M2T A;  3TFR A;  1ZQE A;  4M47 A;  4KLI A;  2BPF A;  9ICJ A;  4RQ1 A;  3UXN A;  4MFA A;  8ICT A;  1RPL A;  1R8B A;  2BPC A;  3LQC B;  4WC0 A;  4WC2 A;  1BPD A;  2PFN A;  4M9L A;  4NM2 A;  4UBC A;  4JWN A;  2FMQ A;  9ICQ A;  1TFW A;  5BOM A;  5CR0 A;  1KEJ A;  2ZHB A;  4X4S A;  3V7J A;  5DB8 A;  1ZQH A;  4I29 A;  4I2A A;  4GXI A;  1ZJM A;  5HRK A;  2DR5 A;  9ICO A;  5CA7 A;  2RFF A;  9ICC A;  5HHI A;  4MFF A;  4QZC A;  1BPE A;  2M2U A;  1PX5 A;  4KLF A;  2DR7 A;  5J0S A;  3JPT A;  1JQR A;  3V7L A;  5BOL A;  4UAW A;  9ICK A;  3C5G A;  4I2J A;  4YD1 A;  3C5F A;  4F5R A;  4KLD A;  4PGX A;  4LZG A;  3AQK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...