4X0BA

Structure of trna-processing enzyme complex 7
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
381
structure length
367
Chain Sequence
MVGQIAKEMGLRAYIVGGVVRDILLGKEVWDVDFVVEGNAIELAKELARRHGVNVHPFPEFGTAHLKIGKLKLEFATARRETEPASLKEDLIRRDFTINAMAISVNLEDYGTLIDYFGGLRDLKDKVIRVLHPVSFIEDPVRILRALRFAGRLNFKLSRSTEKLLKQAVNLGLLKEAPRGRLINEIKLALREDRFLEILELYRKYRVLEEIIEGFQWNEKVLQKLYALRKVVDWHALEFSEERIDYGWLYLLILISNLDYERGKHFLEEMSAPSWVRETYKFMKFKLGSLKEELKKAKENYEVYRLLKPLHTSVLLLLMLEEELKEKIKLYLEKLRKVKLPKEKIEELKKGKELGERIEELKREIMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/rna
molecule keywords Poly A polymerase
publication title Measurement of Acceptor-T Psi C Helix Length of tRNA for Terminal A76-Addition by A-Adding Enzyme.
pubmed doi rcsb
source organism Aquifex aeolicus
total genus 114
structure length 367
sequence length 381
ec nomenclature
pdb deposition date 2014-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01743 PolyA_pol Poly A polymerase head domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3090.10 Mainly Alpha Orthogonal Bundle cca-adding enzyme, domain 2 cca-adding enzyme, domain 2 4x0bA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4x0bA01
4M9NA 4LT6A 4WC4A 2RFFA 4WC1A 4O5EA 2DR9A 4WBZA 4TUSA 4PPXA 5DB6A 1ZQRA 4LVSA 3UPQA 4RT3A 4TUQA 4EBKA 9ICIA 8ICNA 4XQ8A 2PFNA 4I2HA 4IG8A 4FH5A 3HX0A 4MFFA 4MFCA 9ICMA 4RT2A 2FMPA 1ZQXA 1KEJA 5HHHA 5BOMA 3HIYA 4AT8B 1BPDA 2BPGA 9ICBA 1V4AA 4GXIA 4FO6A 4IQTA 4QZEA 5J2CA 5HRHA 1R8CA 5DECA 7ICJA 1JN3A 4I2JA 2ZH4A 4UB4A 4QZGA 4UB3A 7ICVA 4TUPA 3JPRA 2FMQA 9ICHA 4NKTA 4X4TA 4PGYA 2DR7A 1WOTA 8ICKA 1R8AA 4PGXA 5D46A 4X4VA 4LZGA 3ISCA 2M2WA 3LQCB 4QZCA 8ICPA 4UAZA 4KLOA 9ICUA 3WFPA 3HW8A 1KDHA 4KLLA 5J2IA 5J0PA 5J2DA 5J2AA 4I2CA 4I2AA 4RQ4A 2BCVA 3MDAA 4O5KA 4RQ1A 4F5OA 3HJ1A 5CHGA 5DDMA 1XSNA 8ICMA 3GDXA 4LZDA 3RJGA 5DBAA 4O5CA 3C5GA 3MDCA 7ICPA 8ICXA 4KLTA 4K4GA 8ICFA 4X4QA 4RPZA 4PHEA 4X5VA 5HRKA 5J0SA 5J0QA 3OVSA 3UXNA 4E7XA 3K75D 4UB2A 4QZBA 2ISPA 4IQUA 4E8FA 4YMNA 8ICVA 4QZAA 2ZH7A 2PXIA 4KLGA 4DOBA 4K4HA 8ICCA 1ZQWA 4KLDA 7ICMA 1BPZA 2I9GA 7ICOA 4PHDA 4M9LA 1MIYA 4PHPA 1PX5A 5HR9A 4UB1A 4S3NA 5IIJA 5DKWA 5TZVA 4MF2A 4NXZA 4XRHA 4R64A 4KLEA 5DB8A 5HRBA 4RWOA 3MBYA 3OUYA 2O1PA 5CWRA 5HRFA 4I27A 5J0YA 5J2EA 4KLHA 1XSLA 1ZQJA 4WC5A 1BPYA 3RJFA 4UD5A 1HUOA 3AQMA 8ICLA 4M0AA 5J0UA 2Q66A 4KLQA 3RH6A 4P2HA 1F5AA 3TFRA 1ZQZA 4GXJA 2ZH5A 4WC2A 2BCQA 1BPXA 1NO5A 3RH5A 4NM1A 2ZH2A 4AT9B 4I2DA 4YMOA 3UPSA 4IQWA 4F5PA 3B0XA 5J2BA 4Z6EA 4RQ3A 1RZTA 2ZHAA 7ICKA 4X4NA 4KLUA 8ICAA 4R66A 2DR8A 9ICFA 3C66A 5HRDA 4I2BA 4UBBA 3WFSC 4AT8A 7ICRA 4FHPA 1JMSA 3RH4A 4YCXA 4UD4A 1JQRA 7ICEA 1NOMA 1ZQPA 3WFOA 3V7LA 4EBJA 5IINA 7ICLA 8ICTA 5CR0A 1ZQSA 4KLFA 3H39A 5D4BA 1TFWA 5HRIA 5J2KA 5J0TA 5IILA 4X0AA 4F5QA 5DBCA 2FMSA 1ZQHA 3UXOA 8ICBA 1ZQFA 3V72A 5IIKA 4XA5A 5J29A 1YLQA 1ZQBA 2ZH9A 4F5RA 5CP2A 4I2IA 3JPNA 4FH3A 8ICUA 4P4PA 3JPQA 4WC6A 3PMNA 8ICOA 5HRGA 9ICCA 1VFGA 3OV7A 4KLSA 3RJJA 3RJEA 8ICWA 4PGQA 4AT7B 2DRBA 7ICFA 4RWPA 1ZJMA 4PH5A 5HC9A 5D49A 4FHWA 9ICSA 8ICQA 4AT7A 1ZQKA 8ICEA 1ZQDA 5HRLA 3AUOA 4FHYA 3C2MA 7ICIA 1HUZA 1TFYA 4DOAA 4WC7A 5J0XA 4X4PA 3H38A 3MGHA 4WC0A 1MQ2A 3OVBA 9ICQA 5BPCA 3ISBA 5IIIA 9ICEA 5J0OA 4WC3A 2DRAA 4YMMA 3C2KA 3AQLA 8ICRA 4RQ6A 8ICHA 4I2FA 1ZQCA 4M04A 1ZQTA 3V7JA 5CJ7A 1JAJA 1XSPA 4X0BA 4M47A 3UQ0A 4K4IA 5HREA 2NRKA 3HJ4A 2ZH3A 4RWQA 5IIOA 1BPEA 5DBBA 5F2VO 5DB9A 4NLKA 2ZH8A 2M2UA 4RQ0A 2PBEA 2O5AA 7ICUA 4UBCA 3JPTA 8ICIA 9ICKA 2GWSA 4KLIA 2BPCA 4FHVA 4KLJA 5CA7A 3H37A 3C18A 7ICGA 4PHAA 1ZQUA 4R65A 3V7KA 9ICWA 4AT9A 2VANA 2PFOA 1R89A 1TV9A 1MQ3A 3UQ2A 4WBYA 4TURA 4X4UA 3JZ0A 7ICHA 2DR5A 3H3AA 2ISOA 4X4SA 9ICLA 4MF8A 4X4RA 4RQ2A 4M9GA 5J2FA 3ISDA 4I28A 4YD1A 4F5NA 4QZFA 1ZQAA 2W9MA 1ZQEA 9ICPA 9ICXA 8ICSA 3L9DA 4YN4A 5HHIA 4QZ9A 4RWNA 2M2TA 4WCWA 3WFRE 1ZQGA 1R8BA 4RQ7A 4ATBB 4I29A 7ICNA 9ICGA 5J2JA 4NY8A 4RPXA 4M9HA 4NLNA 1TVAA 4Z6CA 4X4OA 1BPBA 4Z6DA 3UXPA 4E80A 4DOCA 3TFSA 2PFPA 3JYYA 4ATBA 2BPFA 1ZJNA 4NKUA 2ZHBA 3AQNA 1ZQOA 3PNCA 1OU5A 1Q78A 7ICTA 4RQ5A 4M9JA 4P4MA 2HHPA 9ICVA 9ICRA 5BOLA 2P66A 5IIMA 3AU6A 4M2YA 3C2LA 2BCSA 4RPYA 1ZQLA 1MIVA 4EP7A 1Q79A 4QZIA 4P4OA 8ICYA 3HWTA 1ZQQA 1FA0A 5J2GA 4QZHA 3JPSA 1ZQYA 3AQKA 4YD2A 3OGUA 4UB5A 4JWNA 3LK9A 3JPOA 1UETA 1ZQNA 4KLMA 7ICQA 1ZQVA 3RJHA 1ZQIA 5EOZA 4UAWA 4O9MA 4DO9A 5J0RA 2DVIA 8ICGA 4I2GA 4JWMA 9ICTA 2ZH6A 1KNYA 9ICOA 3B0YA 5CB1A 5J2HA 5DEDA 4UAYA 8ICZA 9ICNA 4NLZA 4QZ8A 4QZDA 4GXKA 9ICJA 3RJIA 4MFAA 3C5FA 2ZH1A 2IHMA 5J0WA 4RQ8A 4XQ7A 1MIWA 3WFQE 3AU2A 7ICSA 1UEVA 4R63A 1UEUA 2ID1A 9ICAA 4M5DA 3OUYB 3OVAA 2BCUA 2PFQA 8ICJA 1ZQMA 3PMLA 4FHXA 5DB7A 3RJKA 3MGIA 3NYBA 4Z6FA 2BE3A 1VJ7A 2M2VA 4XUSA 4IQVA 1RPLA 5DDYA 4NM2A 2BCRA 4I2EA 3JPPA
chains in the Genus database with same CATH superfamily
4M9NA 4LT6A 4WC4A 2RFFA 4WC1A 4O5EA 2DR9A 4WBZA 4TUSA 4PPXA 5DB6A 1ZQRA 4LVSA 4FO1A 3UPQA 4RT3A 4TUQA 4EBKA 9ICIA 8ICNA 4XQ8A 2PFNA 4I2HA 4IG8A 4FH5A 4O6AA 3HX0A 4MFFA 3ER8C 4MFCA 9ICMA 4RT2A 2FMPA 1ZQXA 1KEJA 5HHHA 5BOMA 3HIYA 4AT8B 1BPDA 2BPGA 9ICBA 1V4AA 4GXIA 4FO6A 4LEZA 4IQTA 4QZEA 5J2CA 5HRHA 1R8CA 5DECA 7ICJA 1JN3A 4I2JA 2ZH4A 4UB4A 4QZGA 4UB3A 7ICVA 4TUPA 3JPRA 2FMQA 9ICHA 4NKTA 4X4TA 4PGYA 2DR7A 1WOTA 8ICKA 1R8AA 4PGXA 4K98A 5D46A 4X4VA 5CFTA 4LZGA 4KM5A 3ISCA 2M2WA 3LQCB 4QZCA 8ICPA 4UAZA 4KLOA 9ICUA 3WFPA 3HW8A 1KDHA 4EEDA 4KLLA 5J2IA 5J0PA 5J2DA 5J2AA 4I2CA 4I2AA 4RQ4A 2BCVA 3MDAA 4O5KA 4RQ1A 4F5OA 3HJ1A 5CHGA 5DDMA 1XSNA 8ICMA 3GDXA 4LZDA 4O68A 2FCLA 3RJGA 5DBAA 4O5CA 3C5GA 3OWGA 3MDCA 7ICPA 8ICXA 4KLTA 4K4GA 8ICFA 4X4QA 4K96A 4RPZA 4PHEA 4X5VA 3CK6A 4XJEA 5HRKA 5J0SA 5J0QA 3OVSA 4K97A 3UXNA 4E7XA 3K75D 4UB2A 4QZBA 2ISPA 4IQUA 4E8FA 4YMNA 8ICVA 4QZAA 2ZH7A 2PXIA 4KLGA 2BBHA 4DOBA 4K4HA 2HN1A 1ZQWA 4KLDA 8ICCA 7ICMA 4MKPA 1BPZA 2I9GA 7ICOA 2IUBA 4PHDA 4JLXA 4M9LA 1MIYA 4PHPA 1PX5A 5HR9A 4UB1A 4S3NA 5IIJA 5DKWA 5TZVA 4MF2A 4NXZA 4XRHA 4R64A 4KLEA 5DB8A 4LEYA 5HRBA 4RWOA 3MBYA 3OUYA 2O1PA 5CWRA 5HRFA 4I27A 5J0YA 5J2EA 4KLHA 1XSLA 4NXTA 1ZQJA 4WC5A 1BPYA 3RJFA 4UD5A 1HUOA 3AQMA 4NXXA 8ICLA 4M0AA 5J0UA 2Q66A 4KLQA 5B3QA 3RH6A 4P2HA 1F5AA 3TFRA 4KB6A 1ZQZA 4GXJA 2ZH5A 4WC2A 2BCQA 1BPXA 1NO5A 3RH5A 4NM1A 2ZH2A 4AT9B 4I2DA 4YMOA 3UPSA 4IQWA 4F5PA 3B0XA 5J2BA 4Z6EA 4RQ3A 4NXWA 1RZTA 2ZHAA 7ICKA 4X4NA 4KLUA 8ICAA 3EF2A 4R66A 2DR8A 4K9BA 9ICFA 3C66A 5HRDA 4I2BA 4UBBA 3WFSC 4AT8A 7ICRA 4FHPA 5B3PA 1JMSA 4EEBA 3RH4A 4YCXA 4UD4A 1JQRA 7ICEA 1NOMA 3MCRA 3PHZA 1ZQPA 3WFOA 3V7LA 4EBJA 5IINA 7ICLA 8ICTA 5CR0A 1ZQSA 4KLFA 3H39A 5D4BA 4NXVA 1TFWA 5HRIA 5J2KA 5J0TA 4NXUA 5IILA 4X0AA 4F5QA 5DBCA 2FMSA 1ZQHA 3UXOA 2HN2A 8ICBA 1ZQFA 3V72A 5IIKA 4XA5A 5J29A 1YLQA 1ZQBA 4LEWA 2ZH9A 4HX0A 4F5RA 3K7DA 5CP2A 2B56A 4I2IA 3JPNA 4FH3A 8ICUA 4WH5A 4P4PA 3JPQA 4WC6A 3PMNA 5CFSA 5HRGA 8ICOA 9ICCA 1VFGA 3OV7A 4KLSA 3RJJA 3RJEA 8ICWA 2BBJA 4PGQA 2EWRA 4AT7B 2DRBA 7ICFA 4RWPA 1ZJMA 4PH5A 5HC9A 5D49A 4FHWA 9ICSA 3ERCC 8ICQA 4AT7A 1ZQKA 5CFUA 4EGWA 1ZQDA 8ICEA 5HRLA 3AUOA 4FHYA 2B4VA 3C2MA 7ICIA 1HUZA 1TFYA 4OAGA 4DOAA 4WC7A 5J0XA 4X4PA 3H38A 3MGHA 4WC0A 1MQ2A 3OVBA 9ICQA 5BPCA 3ISBA 5IIIA 9ICEA 5J0OA 4WC3A 2DRAA 5D61A 4YMMA 3C2KA 3AQLA 8ICRA 4RQ6A 8ICHA 4I2FA 1ZQCA 4M04A 1ZQTA 3V7JA 4OAIZ 5CJ7A 1JAJA 1XSPA 4X0BA 4I0UA 4M47A 3UQ0A 4K4IA 5HREA 2NRKA 3HJ4A 2ZH3A 4RWQA 5IIOA 5D62A 1BPEA 5DBBA 2GA9D 5F2VO 5DB9A 4NLKA 2ZH8A 2M2UA 4RQ0A 2PBEA 2O5AA 7ICUA 4UBCA 3JPTA 2B51A 8ICIA 9ICKA 2GWSA 4KLIA 2BPCA 3ER9B 4FHVA 4KLJA 5CA7A 3H37A 3C18A 7ICGA 4PHAA 1ZQUA 4R65A 3V7KA 5D63A 9ICWA 4AT9A 2VANA 2PFOA 3NWIA 1R89A 1TV9A 1MQ3A 3UQ2A 4WBYA 4TURA 4X4UA 3JZ0A 7ICHA 2DR5A 3H3AA 2ISOA 2GAFD 4X4SA 9ICLA 4MF8A 4X4RA 4RQ2A 4M9GA 5J2FA 3ISDA 4I28A 4YD1A 4F5NA 4QZFA 1ZQAA 2W9MA 1ZQEA 9ICPA 9ICXA 8ICSA 3L9DA 4YN4A 5HHIA 4QZ9A 4RWNA 2M2TA 4WCWA 5JTGA 3WFRE 1ZQGA 1R8BA 3NKUA 4RQ7A 4ATBB 4I29A 7ICNA 9ICGA 5J2JA 4NY8A 4RPXA 4M9HA 4NLNA 1TVAA 4Z6CA 4X4OA 5CHEA 1BPBA 4Z6DA 3UXPA 4E80A 4DOCA 3TFSA 4O69A 2PFPA 3JYYA 4ATBA 4K99A 1ZJNA 2BPFA 4NKUA 2ZHBA 3AQNA 1ZQOA 3PNCA 1OU5A 1Q78A 7ICTA 4RQ5A 4M9JA 4P4MA 2HHPA 9ICVA 9ICRA 5BOLA 4OAFA 2P66A 5IIMA 3AU6A 4M2YA 3C2LA 2BCSA 4RPYA 1ZQLA 1MIVA 4EP7A 1Q79A 3JCFA 4QZIA 4P4OA 4N7RA 8ICYA 3HWTA 1ZQQA 1FA0A 4WQLA 5J2GA 4QZHA 3JPSA 1ZQYA 3AQKA 4YD2A 3OGUA 4UB5A 4JWNA 3LK9A 3JPOA 1UETA 1ZQNA 4KLMA 7ICQA 1ZQVA 3RJHA 1ZQIA 5EOZA 4UAWA 4O9MA 4DO9A 5J0RA 4EV6A 2DVIA 4JLZA 8ICGA 4I2GA 4JWMA 9ICTA 2ZH6A 4K9AA 1KNYA 9ICOA 3B0YA 4K8VA 5CB1A 5J2HA 5DEDA 4UAYA 8ICZA 9ICNA 4NLZA 4QZ8A 4QZDA 2IHOA 4GXKA 4LEVA 9ICJA 3RJIA 4MFAA 3C5FA 2ZH1A 2IHMA 5J0WA 4RQ8A 4XQ7A 1MIWA 3WFQE 3AU2A 7ICSA 1UEVA 4R63A 3NVOA 1UEUA 2ID1A 9ICAA 4M5DA 3OUYB 3OVAA 2BCUA 4WQKA 2PFQA 8ICJA 4WOYA 1ZQMA 3PMLA 4FHXA 4O67A 5DB7A 3RJKA 4OAHA 3MGIA 1GPJA 3NYBA 4Z6FA 2BE3A 1VJ7A 2M2VA 4XUSA 4IQVA 1RPLA 5DDYA 4NM2A 2BCRA 4I2EA 3JPPA
chains in the Genus database with same CATH topology
4M9NA 4LT6A 4WC4A 2RFFA 4WC1A 4O5EA 2DR9A 4WBZA 4TUSA 4PPXA 5DB6A 1ZQRA 4LVSA 3UPQA 4RT3A 4TUQA 4EBKA 9ICIA 8ICNA 4XQ8A 2PFNA 4I2HA 4IG8A 4FH5A 3HX0A 4MFFA 4MFCA 9ICMA 4RT2A 2FMPA 1ZQXA 1KEJA 5HHHA 5BOMA 3HIYA 4AT8B 1BPDA 2BPGA 9ICBA 1V4AA 4GXIA 4FO6A 4IQTA 4QZEA 5J2CA 5HRHA 1R8CA 5DECA 7ICJA 1JN3A 4I2JA 2ZH4A 4UB4A 4QZGA 4UB3A 7ICVA 4TUPA 3JPRA 2FMQA 9ICHA 4NKTA 4X4TA 4PGYA 2DR7A 1WOTA 8ICKA 1R8AA 4PGXA 5D46A 4X4VA 4LZGA 3ISCA 2M2WA 3LQCB 4QZCA 8ICPA 4UAZA 4KLOA 9ICUA 3WFPA 3HW8A 1KDHA 4KLLA 5J2IA 5J0PA 5J2DA 5J2AA 4I2CA 4I2AA 4RQ4A 2BCVA 3MDAA 4O5KA 4RQ1A 4F5OA 3HJ1A 5CHGA 5DDMA 1XSNA 8ICMA 3GDXA 4LZDA 3RJGA 5DBAA 4O5CA 3C5GA 3MDCA 7ICPA 8ICXA 4KLTA 4K4GA 8ICFA 4X4QA 4RPZA 4PHEA 4X5VA 5HRKA 5J0SA 5J0QA 3OVSA 3UXNA 4E7XA 3K75D 4UB2A 4QZBA 2ISPA 4IQUA 4E8FA 4YMNA 8ICVA 4QZAA 2ZH7A 2PXIA 4KLGA 4DOBA 4K4HA 8ICCA 1ZQWA 4KLDA 7ICMA 1BPZA 2I9GA 7ICOA 4PHDA 4M9LA 1MIYA 4PHPA 1PX5A 5HR9A 4UB1A 4S3NA 5IIJA 5DKWA 5TZVA 4MF2A 4NXZA 4XRHA 4R64A 4KLEA 5DB8A 5HRBA 4RWOA 3MBYA 3OUYA 2O1PA 5CWRA 5HRFA 4I27A 5J0YA 5J2EA 4KLHA 1XSLA 1ZQJA 4WC5A 1BPYA 3RJFA 4UD5A 1HUOA 3AQMA 8ICLA 4M0AA 5J0UA 2Q66A 4KLQA 3RH6A 4P2HA 1F5AA 3TFRA 1ZQZA 4GXJA 2ZH5A 4WC2A 2BCQA 1BPXA 1NO5A 3RH5A 4NM1A 2ZH2A 4AT9B 4I2DA 4YMOA 3UPSA 4IQWA 4F5PA 3B0XA 5J2BA 4Z6EA 4RQ3A 1RZTA 2ZHAA 7ICKA 4X4NA 4KLUA 8ICAA 4R66A 2DR8A 9ICFA 3C66A 5HRDA 4I2BA 4UBBA 3WFSC 4AT8A 7ICRA 4FHPA 1JMSA 3RH4A 4YCXA 4UD4A 1JQRA 7ICEA 1NOMA 1ZQPA 3WFOA 3V7LA 4EBJA 5IINA 7ICLA 8ICTA 5CR0A 1ZQSA 4KLFA 3H39A 5D4BA 1TFWA 5HRIA 5J2KA 5J0TA 5IILA 4X0AA 4F5QA 5DBCA 2FMSA 1ZQHA 3UXOA 8ICBA 1ZQFA 3V72A 5IIKA 4XA5A 5J29A 1YLQA 1ZQBA 2ZH9A 4F5RA 5CP2A 4I2IA 3JPNA 4FH3A 8ICUA 4P4PA 3JPQA 4WC6A 3PMNA 8ICOA 5HRGA 9ICCA 1VFGA 3OV7A 4KLSA 3RJJA 3RJEA 8ICWA 4PGQA 4AT7B 2DRBA 7ICFA 4RWPA 1ZJMA 4PH5A 5HC9A 5D49A 4FHWA 9ICSA 8ICQA 4AT7A 1ZQKA 8ICEA 1ZQDA 5HRLA 3AUOA 4FHYA 3C2MA 7ICIA 1HUZA 1TFYA 4DOAA 4WC7A 5J0XA 4X4PA 3H38A 3MGHA 4WC0A 1MQ2A 3OVBA 9ICQA 5BPCA 3ISBA 5IIIA 9ICEA 5J0OA 4WC3A 2DRAA 4YMMA 3C2KA 3AQLA 8ICRA 4RQ6A 8ICHA 4I2FA 1ZQCA 4M04A 1ZQTA 3V7JA 5CJ7A 1JAJA 1XSPA 4X0BA 4M47A 3UQ0A 4K4IA 5HREA 2NRKA 3HJ4A 2ZH3A 4RWQA 5IIOA 1BPEA 5DBBA 5F2VO 5DB9A 4NLKA 2ZH8A 2M2UA 4RQ0A 2PBEA 2O5AA 7ICUA 4UBCA 3JPTA 8ICIA 9ICKA 2GWSA 4KLIA 2BPCA 4FHVA 4KLJA 5CA7A 3H37A 3C18A 7ICGA 4PHAA 1ZQUA 4R65A 3V7KA 9ICWA 4AT9A 2VANA 2PFOA 1R89A 1TV9A 1MQ3A 3UQ2A 4WBYA 4TURA 4X4UA 3JZ0A 7ICHA 2DR5A 3H3AA 2ISOA 4X4SA 9ICLA 4MF8A 4X4RA 4RQ2A 4M9GA 5J2FA 3ISDA 4I28A 4YD1A 4F5NA 4QZFA 1ZQAA 2W9MA 1ZQEA 9ICPA 9ICXA 8ICSA 3L9DA 4YN4A 5HHIA 4QZ9A 4RWNA 2M2TA 4WCWA 3WFRE 1ZQGA 1R8BA 4RQ7A 4ATBB 4I29A 7ICNA 9ICGA 5J2JA 4NY8A 4RPXA 4M9HA 4NLNA 1TVAA 4Z6CA 4X4OA 1BPBA 4Z6DA 3UXPA 4E80A 4DOCA 3TFSA 2PFPA 3JYYA 4ATBA 2BPFA 1ZJNA 4NKUA 2ZHBA 3AQNA 1ZQOA 3PNCA 1OU5A 1Q78A 7ICTA 4RQ5A 4M9JA 4P4MA 2HHPA 9ICVA 9ICRA 5BOLA 2P66A 5IIMA 3AU6A 4M2YA 3C2LA 2BCSA 4RPYA 1ZQLA 1MIVA 4EP7A 1Q79A 4QZIA 4P4OA 8ICYA 3HWTA 1ZQQA 1FA0A 5J2GA 4QZHA 3JPSA 1ZQYA 3AQKA 4YD2A 3OGUA 4UB5A 4JWNA 3LK9A 3JPOA 1UETA 1ZQNA 4KLMA 7ICQA 1ZQVA 3RJHA 1ZQIA 5EOZA 4UAWA 4O9MA 4DO9A 5J0RA 2DVIA 8ICGA 4I2GA 4JWMA 9ICTA 2ZH6A 1KNYA 9ICOA 3B0YA 5CB1A 5J2HA 5DEDA 4UAYA 8ICZA 9ICNA 4NLZA 4QZ8A 4QZDA 4GXKA 9ICJA 3RJIA 4MFAA 3C5FA 2ZH1A 2IHMA 5J0WA 4RQ8A 4XQ7A 1MIWA 3WFQE 3AU2A 7ICSA 1UEVA 4R63A 1UEUA 2ID1A 9ICAA 4M5DA 3OUYB 3OVAA 2BCUA 2PFQA 8ICJA 1ZQMA 3PMLA 4FHXA 5DB7A 3RJKA 3MGIA 3NYBA 4Z6FA 2BE3A 1VJ7A 2M2VA 4XUSA 4IQVA 1RPLA 5DDYA 4NM2A 2BCRA 4I2EA 3JPPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M9N A;  4LT6 A;  4WC4 A;  2RFF A;  4WC1 A;  4O5E A;  2DR9 A;  4WBZ A;  4TUS A;  4PPX A;  5DB6 A;  1ZQR A;  4LVS A;  3UPQ A;  4RT3 A;  4TUQ A;  4EBK A;  9ICI A;  8ICN A;  4XQ8 A;  2PFN A;  4I2H A;  4IG8 A;  4FH5 A;  3HX0 A;  4MFF A;  4MFC A;  9ICM A;  4RT2 A;  2FMP A;  1ZQX A;  1KEJ A;  5HHH A;  5BOM A;  3HIY A;  4AT8 B;  1BPD A;  2BPG A;  9ICB A;  1V4A A;  4GXI A;  4FO6 A;  4IQT A;  4QZE A;  5J2C A;  5HRH A;  1R8C A;  5DEC A;  7ICJ A;  1JN3 A;  4I2J A;  2ZH4 A;  4UB4 A;  4QZG A;  4UB3 A;  7ICV A;  4TUP A;  3JPR A;  2FMQ A;  9ICH A;  4NKT A;  4X4T A;  4PGY A;  2DR7 A;  1WOT A;  8ICK A;  1R8A A;  4PGX A;  5D46 A;  4X4V A;  4LZG A;  3ISC A;  2M2W A;  3LQC B;  4QZC A;  8ICP A;  4UAZ A;  4KLO A;  9ICU A;  3WFP A;  3HW8 A;  1KDH A;  4KLL A;  5J2I A;  5J0P A;  5J2D A;  5J2A A;  4I2C A;  4I2A A;  4RQ4 A;  2BCV A;  3MDA A;  4O5K A;  4RQ1 A;  4F5O A;  3HJ1 A;  5CHG A;  5DDM A;  1XSN A;  8ICM A;  3GDX A;  4LZD A;  3RJG A;  5DBA A;  4O5C A;  3C5G A;  3MDC A;  7ICP A;  8ICX A;  4KLT A;  4K4G A;  8ICF A;  4X4Q A;  4RPZ A;  4PHE A;  4X5V A;  5HRK A;  5J0S A;  5J0Q A;  3OVS A;  3UXN A;  4E7X A;  3K75 D;  4UB2 A;  4QZB A;  2ISP A;  4IQU A;  4E8F A;  4YMN A;  8ICV A;  4QZA A;  2ZH7 A;  2PXI A;  4KLG A;  4DOB A;  4K4H A;  8ICC A;  1ZQW A;  4KLD A;  7ICM A;  1BPZ A;  2I9G A;  7ICO A;  4PHD A;  4M9L A;  1MIY A;  4PHP A;  1PX5 A;  5HR9 A;  4UB1 A;  4S3N A;  5IIJ A;  5DKW A;  5TZV A;  4MF2 A;  4NXZ A;  4XRH A;  4R64 A;  4KLE A;  5DB8 A;  5HRB A;  4RWO A;  3MBY A;  3OUY A;  2O1P A;  5CWR A;  5HRF A;  4I27 A;  5J0Y A;  5J2E A;  4KLH A;  1XSL A;  1ZQJ A;  4WC5 A;  1BPY A;  3RJF A;  4UD5 A;  1HUO A;  3AQM A;  8ICL A;  4M0A A;  5J0U A;  2Q66 A;  4KLQ A;  3RH6 A;  4P2H A;  1F5A A;  3TFR A;  1ZQZ A;  4GXJ A;  2ZH5 A;  4WC2 A;  2BCQ A;  1BPX A;  1NO5 A;  3RH5 A;  4NM1 A;  2ZH2 A;  4AT9 B;  4I2D A;  4YMO A;  3UPS A;  4IQW A;  4F5P A;  3B0X A;  5J2B A;  4Z6E A;  4RQ3 A;  1RZT A;  2ZHA A;  7ICK A;  4X4N A;  4KLU A;  8ICA A;  4R66 A;  2DR8 A;  9ICF A;  3C66 A;  5HRD A;  4I2B A;  4UBB A;  3WFS C;  4AT8 A;  7ICR A;  4FHP A;  1JMS A;  3RH4 A;  4YCX A;  4UD4 A;  1JQR A;  7ICE A;  1NOM A;  1ZQP A;  3WFO A;  3V7L A;  4EBJ A;  5IIN A;  7ICL A;  8ICT A;  5CR0 A;  1ZQS A;  4KLF A;  3H39 A;  5D4B A;  1TFW A;  5HRI A;  5J2K A;  5J0T A;  5IIL A;  4X0A A;  4F5Q A;  5DBC A;  2FMS A;  1ZQH A;  3UXO A;  8ICB A;  1ZQF A;  3V72 A;  5IIK A;  4XA5 A;  5J29 A;  1YLQ A;  1ZQB A;  2ZH9 A;  4F5R A;  5CP2 A;  4I2I A;  3JPN A;  4FH3 A;  8ICU A;  4P4P A;  3JPQ A;  4WC6 A;  3PMN A;  8ICO A;  5HRG A;  9ICC A;  1VFG A;  3OV7 A;  4KLS A;  3RJJ A;  3RJE A;  8ICW A;  4PGQ A;  4AT7 B;  2DRB A;  7ICF A;  4RWP A;  1ZJM A;  4PH5 A;  5HC9 A;  5D49 A;  4FHW A;  9ICS A;  8ICQ A;  4AT7 A;  1ZQK A;  8ICE A;  1ZQD A;  5HRL A;  3AUO A;  4FHY A;  3C2M A;  7ICI A;  1HUZ A;  1TFY A;  4DOA A;  4WC7 A;  5J0X A;  4X4P A;  3H38 A;  3MGH A;  4WC0 A;  1MQ2 A;  3OVB A;  9ICQ A;  5BPC A;  3ISB A;  5III A;  9ICE A;  5J0O A;  4WC3 A;  2DRA A;  4YMM A;  3C2K A;  3AQL A;  8ICR A;  4RQ6 A;  8ICH A;  4I2F A;  1ZQC A;  4M04 A;  1ZQT A;  3V7J A;  5CJ7 A;  1JAJ A;  1XSP A;  4X0B A;  4M47 A;  3UQ0 A;  4K4I A;  5HRE A;  2NRK A;  3HJ4 A;  2ZH3 A;  4RWQ A;  5IIO A;  1BPE A;  5DBB A;  5F2V O;  5DB9 A;  4NLK A;  2ZH8 A;  2M2U A;  4RQ0 A;  2PBE A;  2O5A A;  7ICU A;  4UBC A;  3JPT A;  8ICI A;  9ICK A;  2GWS A;  4KLI A;  2BPC A;  4FHV A;  4KLJ A;  5CA7 A;  3H37 A;  3C18 A;  7ICG A;  4PHA A;  1ZQU A;  4R65 A;  3V7K A;  9ICW A;  4AT9 A;  2VAN A;  2PFO A;  1R89 A;  1TV9 A;  1MQ3 A;  3UQ2 A;  4WBY A;  4TUR A;  4X4U A;  3JZ0 A;  7ICH A;  2DR5 A;  3H3A A;  2ISO A;  4X4S A;  9ICL A;  4MF8 A;  4X4R A;  4RQ2 A;  4M9G A;  5J2F A;  3ISD A;  4I28 A;  4YD1 A;  4F5N A;  4QZF A;  1ZQA A;  2W9M A;  1ZQE A;  9ICP A;  9ICX A;  8ICS A;  3L9D A;  4YN4 A;  5HHI A;  4QZ9 A;  4RWN A;  2M2T A;  4WCW A;  3WFR E;  1ZQG A;  1R8B A;  4RQ7 A;  4ATB B;  4I29 A;  7ICN A;  9ICG A;  5J2J A;  4NY8 A;  4RPX A;  4M9H A;  4NLN A;  1TVA A;  4Z6C A;  4X4O A;  1BPB A;  4Z6D A;  3UXP A;  4E80 A;  4DOC A;  3TFS A;  2PFP A;  3JYY A;  4ATB A;  2BPF A;  1ZJN A;  4NKU A;  2ZHB A;  3AQN A;  1ZQO A;  3PNC A;  1OU5 A;  1Q78 A;  7ICT A;  4RQ5 A;  4M9J A;  4P4M A;  2HHP A;  9ICV A;  9ICR A;  5BOL A;  2P66 A;  5IIM A;  3AU6 A;  4M2Y A;  3C2L A;  2BCS A;  4RPY A;  1ZQL A;  1MIV A;  4EP7 A;  1Q79 A;  4QZI A;  4P4O A;  8ICY A;  3HWT A;  1ZQQ A;  1FA0 A;  5J2G A;  4QZH A;  3JPS A;  1ZQY A;  3AQK A;  4YD2 A;  3OGU A;  4UB5 A;  4JWN A;  3LK9 A;  3JPO A;  1UET A;  1ZQN A;  4KLM A;  7ICQ A;  1ZQV A;  3RJH A;  1ZQI A;  5EOZ A;  4UAW A;  4O9M A;  4DO9 A;  5J0R A;  2DVI A;  8ICG A;  4I2G A;  4JWM A;  9ICT A;  2ZH6 A;  1KNY A;  9ICO A;  3B0Y A;  5CB1 A;  5J2H A;  5DED A;  4UAY A;  8ICZ A;  9ICN A;  4NLZ A;  4QZ8 A;  4QZD A;  4GXK A;  9ICJ A;  3RJI A;  4MFA A;  3C5F A;  2ZH1 A;  2IHM A;  5J0W A;  4RQ8 A;  4XQ7 A;  1MIW A;  3WFQ E;  3AU2 A;  7ICS A;  1UEV A;  4R63 A;  1UEU A;  2ID1 A;  9ICA A;  4M5D A;  3OUY B;  3OVA A;  2BCU A;  2PFQ A;  8ICJ A;  1ZQM A;  3PML A;  4FHX A;  5DB7 A;  3RJK A;  3MGI A;  3NYB A;  4Z6F A;  2BE3 A;  1VJ7 A;  2M2V A;  4XUS A;  4IQV A;  1RPL A;  5DDY A;  4NM2 A;  2BCR A;  4I2E A;  3JPP A; 
#chains in the Genus database with same CATH topology
 4M9N A;  4LT6 A;  4WC4 A;  2RFF A;  4WC1 A;  4O5E A;  2DR9 A;  4WBZ A;  4TUS A;  4PPX A;  5DB6 A;  1ZQR A;  4LVS A;  4FO1 A;  3UPQ A;  4RT3 A;  4TUQ A;  4EBK A;  9ICI A;  8ICN A;  4XQ8 A;  2PFN A;  4I2H A;  4IG8 A;  4FH5 A;  4O6A A;  3HX0 A;  4MFF A;  3ER8 C;  4MFC A;  9ICM A;  4RT2 A;  2FMP A;  1ZQX A;  1KEJ A;  5HHH A;  5BOM A;  3HIY A;  4AT8 B;  1BPD A;  2BPG A;  9ICB A;  1V4A A;  4GXI A;  4FO6 A;  4LEZ A;  4IQT A;  4QZE A;  5J2C A;  5HRH A;  1R8C A;  5DEC A;  7ICJ A;  1JN3 A;  4I2J A;  2ZH4 A;  4UB4 A;  4QZG A;  4UB3 A;  7ICV A;  4TUP A;  3JPR A;  2FMQ A;  9ICH A;  4NKT A;  4X4T A;  4PGY A;  2DR7 A;  1WOT A;  8ICK A;  1R8A A;  4PGX A;  4K98 A;  5D46 A;  4X4V A;  5CFT A;  4LZG A;  4KM5 A;  3ISC A;  2M2W A;  3LQC B;  4QZC A;  8ICP A;  4UAZ A;  4KLO A;  9ICU A;  3WFP A;  3HW8 A;  1KDH A;  4EED A;  4KLL A;  5J2I A;  5J0P A;  5J2D A;  5J2A A;  4I2C A;  4I2A A;  4RQ4 A;  2BCV A;  3MDA A;  4O5K A;  4RQ1 A;  4F5O A;  3HJ1 A;  5CHG A;  5DDM A;  1XSN A;  8ICM A;  3GDX A;  4LZD A;  4O68 A;  2FCL A;  3RJG A;  5DBA A;  4O5C A;  3C5G A;  3OWG A;  3MDC A;  7ICP A;  8ICX A;  4KLT A;  4K4G A;  8ICF A;  4X4Q A;  4K96 A;  4RPZ A;  4PHE A;  4X5V A;  3CK6 A;  4XJE A;  5HRK A;  5J0S A;  5J0Q A;  3OVS A;  4K97 A;  3UXN A;  4E7X A;  3K75 D;  4UB2 A;  4QZB A;  2ISP A;  4IQU A;  4E8F A;  4YMN A;  8ICV A;  4QZA A;  2ZH7 A;  2PXI A;  4KLG A;  2BBH A;  4DOB A;  4K4H A;  2HN1 A;  1ZQW A;  4KLD A;  8ICC A;  7ICM A;  4MKP A;  1BPZ A;  2I9G A;  7ICO A;  2IUB A;  4PHD A;  4JLX A;  4M9L A;  1MIY A;  4PHP A;  1PX5 A;  5HR9 A;  4UB1 A;  4S3N A;  5IIJ A;  5DKW A;  5TZV A;  4MF2 A;  4NXZ A;  4XRH A;  4R64 A;  4KLE A;  5DB8 A;  4LEY A;  5HRB A;  4RWO A;  3MBY A;  3OUY A;  2O1P A;  5CWR A;  5HRF A;  4I27 A;  5J0Y A;  5J2E A;  4KLH A;  1XSL A;  4NXT A;  1ZQJ A;  4WC5 A;  1BPY A;  3RJF A;  4UD5 A;  1HUO A;  3AQM A;  4NXX A;  8ICL A;  4M0A A;  5J0U A;  2Q66 A;  4KLQ A;  5B3Q A;  3RH6 A;  4P2H A;  1F5A A;  3TFR A;  4KB6 A;  1ZQZ A;  4GXJ A;  2ZH5 A;  4WC2 A;  2BCQ A;  1BPX A;  1NO5 A;  3RH5 A;  4NM1 A;  2ZH2 A;  4AT9 B;  4I2D A;  4YMO A;  3UPS A;  4IQW A;  4F5P A;  3B0X A;  5J2B A;  4Z6E A;  4RQ3 A;  4NXW A;  1RZT A;  2ZHA A;  7ICK A;  4X4N A;  4KLU A;  8ICA A;  3EF2 A;  4R66 A;  2DR8 A;  4K9B A;  9ICF A;  3C66 A;  5HRD A;  4I2B A;  4UBB A;  3WFS C;  4AT8 A;  7ICR A;  4FHP A;  5B3P A;  1JMS A;  4EEB A;  3RH4 A;  4YCX A;  4UD4 A;  1JQR A;  7ICE A;  1NOM A;  3MCR A;  3PHZ A;  1ZQP A;  3WFO A;  3V7L A;  4EBJ A;  5IIN A;  7ICL A;  8ICT A;  5CR0 A;  1ZQS A;  4KLF A;  3H39 A;  5D4B A;  4NXV A;  1TFW A;  5HRI A;  5J2K A;  5J0T A;  4NXU A;  5IIL A;  4X0A A;  4F5Q A;  5DBC A;  2FMS A;  1ZQH A;  3UXO A;  2HN2 A;  8ICB A;  1ZQF A;  3V72 A;  5IIK A;  4XA5 A;  5J29 A;  1YLQ A;  1ZQB A;  4LEW A;  2ZH9 A;  4HX0 A;  4F5R A;  3K7D A;  5CP2 A;  2B56 A;  4I2I A;  3JPN A;  4FH3 A;  8ICU A;  4WH5 A;  4P4P A;  3JPQ A;  4WC6 A;  3PMN A;  5CFS A;  5HRG A;  8ICO A;  9ICC A;  1VFG A;  3OV7 A;  4KLS A;  3RJJ A;  3RJE A;  8ICW A;  2BBJ A;  4PGQ A;  2EWR A;  4AT7 B;  2DRB A;  7ICF A;  4RWP A;  1ZJM A;  4PH5 A;  5HC9 A;  5D49 A;  4FHW A;  9ICS A;  3ERC C;  8ICQ A;  4AT7 A;  1ZQK A;  5CFU A;  4EGW A;  1ZQD A;  8ICE A;  5HRL A;  3AUO A;  4FHY A;  2B4V A;  3C2M A;  7ICI A;  1HUZ A;  1TFY A;  4OAG A;  4DOA A;  4WC7 A;  5J0X A;  4X4P A;  3H38 A;  3MGH A;  4WC0 A;  1MQ2 A;  3OVB A;  9ICQ A;  5BPC A;  3ISB A;  5III A;  9ICE A;  5J0O A;  4WC3 A;  2DRA A;  5D61 A;  4YMM A;  3C2K A;  3AQL A;  8ICR A;  4RQ6 A;  8ICH A;  4I2F A;  1ZQC A;  4M04 A;  1ZQT A;  3V7J A;  4OAI Z;  5CJ7 A;  1JAJ A;  1XSP A;  4X0B A;  4I0U A;  4M47 A;  3UQ0 A;  4K4I A;  5HRE A;  2NRK A;  3HJ4 A;  2ZH3 A;  4RWQ A;  5IIO A;  5D62 A;  1BPE A;  5DBB A;  2GA9 D;  5F2V O;  5DB9 A;  4NLK A;  2ZH8 A;  2M2U A;  4RQ0 A;  2PBE A;  2O5A A;  7ICU A;  4UBC A;  3JPT A;  2B51 A;  8ICI A;  9ICK A;  2GWS A;  4KLI A;  2BPC A;  3ER9 B;  4FHV A;  4KLJ A;  5CA7 A;  3H37 A;  3C18 A;  7ICG A;  4PHA A;  1ZQU A;  4R65 A;  3V7K A;  5D63 A;  9ICW A;  4AT9 A;  2VAN A;  2PFO A;  3NWI A;  1R89 A;  1TV9 A;  1MQ3 A;  3UQ2 A;  4WBY A;  4TUR A;  4X4U A;  3JZ0 A;  7ICH A;  2DR5 A;  3H3A A;  2ISO A;  2GAF D;  4X4S A;  9ICL A;  4MF8 A;  4X4R A;  4RQ2 A;  4M9G A;  5J2F A;  3ISD A;  4I28 A;  4YD1 A;  4F5N A;  4QZF A;  1ZQA A;  2W9M A;  1ZQE A;  9ICP A;  9ICX A;  8ICS A;  3L9D A;  4YN4 A;  5HHI A;  4QZ9 A;  4RWN A;  2M2T A;  4WCW A;  5JTG A;  3WFR E;  1ZQG A;  1R8B A;  3NKU A;  4RQ7 A;  4ATB B;  4I29 A;  7ICN A;  9ICG A;  5J2J A;  4NY8 A;  4RPX A;  4M9H A;  4NLN A;  1TVA A;  4Z6C A;  4X4O A;  5CHE A;  1BPB A;  4Z6D A;  3UXP A;  4E80 A;  4DOC A;  3TFS A;  4O69 A;  2PFP A;  3JYY A;  4ATB A;  4K99 A;  1ZJN A;  2BPF A;  4NKU A;  2ZHB A;  3AQN A;  1ZQO A;  3PNC A;  1OU5 A;  1Q78 A;  7ICT A;  4RQ5 A;  4M9J A;  4P4M A;  2HHP A;  9ICV A;  9ICR A;  5BOL A;  4OAF A;  2P66 A;  5IIM A;  3AU6 A;  4M2Y A;  3C2L A;  2BCS A;  4RPY A;  1ZQL A;  1MIV A;  4EP7 A;  1Q79 A;  3JCF A;  4QZI A;  4P4O A;  4N7R A;  8ICY A;  3HWT A;  1ZQQ A;  1FA0 A;  4WQL A;  5J2G A;  4QZH A;  3JPS A;  1ZQY A;  3AQK A;  4YD2 A;  3OGU A;  4UB5 A;  4JWN A;  3LK9 A;  3JPO A;  1UET A;  1ZQN A;  4KLM A;  7ICQ A;  1ZQV A;  3RJH A;  1ZQI A;  5EOZ A;  4UAW A;  4O9M A;  4DO9 A;  5J0R A;  4EV6 A;  2DVI A;  4JLZ A;  8ICG A;  4I2G A;  4JWM A;  9ICT A;  2ZH6 A;  4K9A A;  1KNY A;  9ICO A;  3B0Y A;  4K8V A;  5CB1 A;  5J2H A;  5DED A;  4UAY A;  8ICZ A;  9ICN A;  4NLZ A;  4QZ8 A;  4QZD A;  2IHO A;  4GXK A;  4LEV A;  9ICJ A;  3RJI A;  4MFA A;  3C5F A;  2ZH1 A;  2IHM A;  5J0W A;  4RQ8 A;  4XQ7 A;  1MIW A;  3WFQ E;  3AU2 A;  7ICS A;  1UEV A;  4R63 A;  3NVO A;  1UEU A;  2ID1 A;  9ICA A;  4M5D A;  3OUY B;  3OVA A;  2BCU A;  4WQK A;  2PFQ A;  8ICJ A;  4WOY A;  1ZQM A;  3PML A;  4FHX A;  4O67 A;  5DB7 A;  3RJK A;  4OAH A;  3MGI A;  1GPJ A;  3NYB A;  4Z6F A;  2BE3 A;  1VJ7 A;  2M2V A;  4XUS A;  4IQV A;  1RPL A;  5DDY A;  4NM2 A;  2BCR A;  4I2E A;  3JPP A; 
#chains in the Genus database with same CATH homology
 4M9N A;  4LT6 A;  4WC4 A;  2RFF A;  4WC1 A;  4O5E A;  2DR9 A;  4WBZ A;  4TUS A;  4PPX A;  5DB6 A;  1ZQR A;  4LVS A;  3UPQ A;  4RT3 A;  4TUQ A;  4EBK A;  9ICI A;  8ICN A;  4XQ8 A;  2PFN A;  4I2H A;  4IG8 A;  4FH5 A;  3HX0 A;  4MFF A;  4MFC A;  9ICM A;  4RT2 A;  2FMP A;  1ZQX A;  1KEJ A;  5HHH A;  5BOM A;  3HIY A;  4AT8 B;  1BPD A;  2BPG A;  9ICB A;  1V4A A;  4GXI A;  4FO6 A;  4IQT A;  4QZE A;  5J2C A;  5HRH A;  1R8C A;  5DEC A;  7ICJ A;  1JN3 A;  4I2J A;  2ZH4 A;  4UB4 A;  4QZG A;  4UB3 A;  7ICV A;  4TUP A;  3JPR A;  2FMQ A;  9ICH A;  4NKT A;  4X4T A;  4PGY A;  2DR7 A;  1WOT A;  8ICK A;  1R8A A;  4PGX A;  5D46 A;  4X4V A;  4LZG A;  3ISC A;  2M2W A;  3LQC B;  4QZC A;  8ICP A;  4UAZ A;  4KLO A;  9ICU A;  3WFP A;  3HW8 A;  1KDH A;  4KLL A;  5J2I A;  5J0P A;  5J2D A;  5J2A A;  4I2C A;  4I2A A;  4RQ4 A;  2BCV A;  3MDA A;  4O5K A;  4RQ1 A;  4F5O A;  3HJ1 A;  5CHG A;  5DDM A;  1XSN A;  8ICM A;  3GDX A;  4LZD A;  3RJG A;  5DBA A;  4O5C A;  3C5G A;  3MDC A;  7ICP A;  8ICX A;  4KLT A;  4K4G A;  8ICF A;  4X4Q A;  4RPZ A;  4PHE A;  4X5V A;  5HRK A;  5J0S A;  5J0Q A;  3OVS A;  3UXN A;  4E7X A;  3K75 D;  4UB2 A;  4QZB A;  2ISP A;  4IQU A;  4E8F A;  4YMN A;  8ICV A;  4QZA A;  2ZH7 A;  2PXI A;  4KLG A;  4DOB A;  4K4H A;  8ICC A;  1ZQW A;  4KLD A;  7ICM A;  1BPZ A;  2I9G A;  7ICO A;  4PHD A;  4M9L A;  1MIY A;  4PHP A;  1PX5 A;  5HR9 A;  4UB1 A;  4S3N A;  5IIJ A;  5DKW A;  5TZV A;  4MF2 A;  4NXZ A;  4XRH A;  4R64 A;  4KLE A;  5DB8 A;  5HRB A;  4RWO A;  3MBY A;  3OUY A;  2O1P A;  5CWR A;  5HRF A;  4I27 A;  5J0Y A;  5J2E A;  4KLH A;  1XSL A;  1ZQJ A;  4WC5 A;  1BPY A;  3RJF A;  4UD5 A;  1HUO A;  3AQM A;  8ICL A;  4M0A A;  5J0U A;  2Q66 A;  4KLQ A;  3RH6 A;  4P2H A;  1F5A A;  3TFR A;  1ZQZ A;  4GXJ A;  2ZH5 A;  4WC2 A;  2BCQ A;  1BPX A;  1NO5 A;  3RH5 A;  4NM1 A;  2ZH2 A;  4AT9 B;  4I2D A;  4YMO A;  3UPS A;  4IQW A;  4F5P A;  3B0X A;  5J2B A;  4Z6E A;  4RQ3 A;  1RZT A;  2ZHA A;  7ICK A;  4X4N A;  4KLU A;  8ICA A;  4R66 A;  2DR8 A;  9ICF A;  3C66 A;  5HRD A;  4I2B A;  4UBB A;  3WFS C;  4AT8 A;  7ICR A;  4FHP A;  1JMS A;  3RH4 A;  4YCX A;  4UD4 A;  1JQR A;  7ICE A;  1NOM A;  1ZQP A;  3WFO A;  3V7L A;  4EBJ A;  5IIN A;  7ICL A;  8ICT A;  5CR0 A;  1ZQS A;  4KLF A;  3H39 A;  5D4B A;  1TFW A;  5HRI A;  5J2K A;  5J0T A;  5IIL A;  4X0A A;  4F5Q A;  5DBC A;  2FMS A;  1ZQH A;  3UXO A;  8ICB A;  1ZQF A;  3V72 A;  5IIK A;  4XA5 A;  5J29 A;  1YLQ A;  1ZQB A;  2ZH9 A;  4F5R A;  5CP2 A;  4I2I A;  3JPN A;  4FH3 A;  8ICU A;  4P4P A;  3JPQ A;  4WC6 A;  3PMN A;  8ICO A;  5HRG A;  9ICC A;  1VFG A;  3OV7 A;  4KLS A;  3RJJ A;  3RJE A;  8ICW A;  4PGQ A;  4AT7 B;  2DRB A;  7ICF A;  4RWP A;  1ZJM A;  4PH5 A;  5HC9 A;  5D49 A;  4FHW A;  9ICS A;  8ICQ A;  4AT7 A;  1ZQK A;  8ICE A;  1ZQD A;  5HRL A;  3AUO A;  4FHY A;  3C2M A;  7ICI A;  1HUZ A;  1TFY A;  4DOA A;  4WC7 A;  5J0X A;  4X4P A;  3H38 A;  3MGH A;  4WC0 A;  1MQ2 A;  3OVB A;  9ICQ A;  5BPC A;  3ISB A;  5III A;  9ICE A;  5J0O A;  4WC3 A;  2DRA A;  4YMM A;  3C2K A;  3AQL A;  8ICR A;  4RQ6 A;  8ICH A;  4I2F A;  1ZQC A;  4M04 A;  1ZQT A;  3V7J A;  5CJ7 A;  1JAJ A;  1XSP A;  4X0B A;  4M47 A;  3UQ0 A;  4K4I A;  5HRE A;  2NRK A;  3HJ4 A;  2ZH3 A;  4RWQ A;  5IIO A;  1BPE A;  5DBB A;  5F2V O;  5DB9 A;  4NLK A;  2ZH8 A;  2M2U A;  4RQ0 A;  2PBE A;  2O5A A;  7ICU A;  4UBC A;  3JPT A;  8ICI A;  9ICK A;  2GWS A;  4KLI A;  2BPC A;  4FHV A;  4KLJ A;  5CA7 A;  3H37 A;  3C18 A;  7ICG A;  4PHA A;  1ZQU A;  4R65 A;  3V7K A;  9ICW A;  4AT9 A;  2VAN A;  2PFO A;  1R89 A;  1TV9 A;  1MQ3 A;  3UQ2 A;  4WBY A;  4TUR A;  4X4U A;  3JZ0 A;  7ICH A;  2DR5 A;  3H3A A;  2ISO A;  4X4S A;  9ICL A;  4MF8 A;  4X4R A;  4RQ2 A;  4M9G A;  5J2F A;  3ISD A;  4I28 A;  4YD1 A;  4F5N A;  4QZF A;  1ZQA A;  2W9M A;  1ZQE A;  9ICP A;  9ICX A;  8ICS A;  3L9D A;  4YN4 A;  5HHI A;  4QZ9 A;  4RWN A;  2M2T A;  4WCW A;  3WFR E;  1ZQG A;  1R8B A;  4RQ7 A;  4ATB B;  4I29 A;  7ICN A;  9ICG A;  5J2J A;  4NY8 A;  4RPX A;  4M9H A;  4NLN A;  1TVA A;  4Z6C A;  4X4O A;  1BPB A;  4Z6D A;  3UXP A;  4E80 A;  4DOC A;  3TFS A;  2PFP A;  3JYY A;  4ATB A;  2BPF A;  1ZJN A;  4NKU A;  2ZHB A;  3AQN A;  1ZQO A;  3PNC A;  1OU5 A;  1Q78 A;  7ICT A;  4RQ5 A;  4M9J A;  4P4M A;  2HHP A;  9ICV A;  9ICR A;  5BOL A;  2P66 A;  5IIM A;  3AU6 A;  4M2Y A;  3C2L A;  2BCS A;  4RPY A;  1ZQL A;  1MIV A;  4EP7 A;  1Q79 A;  4QZI A;  4P4O A;  8ICY A;  3HWT A;  1ZQQ A;  1FA0 A;  5J2G A;  4QZH A;  3JPS A;  1ZQY A;  3AQK A;  4YD2 A;  3OGU A;  4UB5 A;  4JWN A;  3LK9 A;  3JPO A;  1UET A;  1ZQN A;  4KLM A;  7ICQ A;  1ZQV A;  3RJH A;  1ZQI A;  5EOZ A;  4UAW A;  4O9M A;  4DO9 A;  5J0R A;  2DVI A;  8ICG A;  4I2G A;  4JWM A;  9ICT A;  2ZH6 A;  1KNY A;  9ICO A;  3B0Y A;  5CB1 A;  5J2H A;  5DED A;  4UAY A;  8ICZ A;  9ICN A;  4NLZ A;  4QZ8 A;  4QZD A;  4GXK A;  9ICJ A;  3RJI A;  4MFA A;  3C5F A;  2ZH1 A;  2IHM A;  5J0W A;  4RQ8 A;  4XQ7 A;  1MIW A;  3WFQ E;  3AU2 A;  7ICS A;  1UEV A;  4R63 A;  1UEU A;  2ID1 A;  9ICA A;  4M5D A;  3OUY B;  3OVA A;  2BCU A;  2PFQ A;  8ICJ A;  1ZQM A;  3PML A;  4FHX A;  5DB7 A;  3RJK A;  3MGI A;  3NYB A;  4Z6F A;  2BE3 A;  1VJ7 A;  2M2V A;  4XUS A;  4IQV A;  1RPL A;  5DDY A;  4NM2 A;  2BCR A;  4I2E A;  3JPP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...