4FHVA

Crystal structures of the cid1 poly (u) polymerase reveal the mechanism for utp selectivity - mgctp bound
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
338
structure length
323
Chain Sequence
SHKEFTKFCYEVYNEIKISDKEFKEKRAALDTLRLCLKRISPDAELVAFGSLESGLALKNSDMDLCVLMDSRVQSDTIALQFYEELIAEGFEGKFLQRARIPIIKLTSDTKNGFGASFQCDIGFNNRLAIHNTLLLSSYTKLDARLKPMVLLVKHWAKRKQINSPYFGTLSSYGYVLMVLYYLIHVIKPPVFPNLLLSPLKQEKIVDGFDVGFDDKLEDIPPSQNYSSLGSLLHGFFRFYAYKFEPREKVVTFRRPDGYLTKQEKGWTRYILAIEDPFEISHNVGRTVSSSGLYRIRGEFMAASRLLNSRSYPIPYDSLFEEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Poly(A) RNA polymerase protein cid1
publication title Crystal structures of the Cid1 poly (U) polymerase reveal the mechanism for UTP selectivity.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 109
structure length 323
sequence length 338
ec nomenclature ec 2.7.7.19: Polynucleotide adenylyltransferase.
pdb deposition date 2012-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01909 NTP_transf_2 Nucleotidyltransferase domain
A PF03828 PAP_assoc Cid1 family poly A polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.10 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain Poly(a)-polymerase, middle domain 4fhvA01
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4fhvA02
4YD1A 4YMMA 8ICKA 3AQLA 4RT2A 4O9MA 8ICGA 4RQ3A 7ICVA 2PFOA 4NLZA 7ICIA 4X4OA 2BPCA 3B0YA 5IIKA 3L9DA 4KLDA 4RWPA 4YN4A 4E80A 3PMNA 9ICVA 5HC9A 1ZQOA 9ICTA 2ZH7A 4X0AA 7ICSA 5D46A 8ICXA 8ICYA 5F2VO 8ICCA 3C5FA 7ICPA 4LZDA 4Z6CA 1ZQWA 3GDXA 3LQCB 5J0OA 2FMPA 4R65A 5J0WA 1ZJMA 4QZ9A 5J2FA 9ICIA 3OVBA 4QZGA 1FA0A 2DR5A 4NLKA 4TUSA 1NO5A 2ZH8A 3JPSA 4KLEA 3WFOA 5J2AA 4FH3A 4IQUA 4M2YA 5BPCA 4X4QA 4LVSA 9ICNA 3WFSC 4QZCA 3UQ0A 8ICSA 4WC4A 4GXIA 3JPRA 1R8BA 4UBBA 1BPZA 4O5CA 4X4VA 2Q66A 5CR0A 4KLQA 3JPTA 3AQKA 8ICAA 5DB8A 4RQ6A 3JPNA 4M5DA 9ICAA 1BPBA 4WC6A 4I28A 4QZAA 4JWMA 5J29A 1ZQFA 4R63A 3PNCA 4KLFA 9ICBA 4KLOA 4PHPA 3H37A 4AT9A 1JN3A 1JQRA 5HRFA 3K75D 4NY8A 4PPXA 7ICHA 5D4BA 1ZQZA 4NLNA 5CA7A 3JYYA 3UQ2A 8ICQA 4PGYA 5IIOA 4WC3A 2BCSA 4RPZA 4PGXA 8ICJA 9ICGA 4K4HA 1ZQVA 1R8AA 1ZQPA 4YCXA 5J2GA 4K4IA 4KLTA 1OU5A 5CHGA 4RQ1A 4FHXA 3HW8A 5DDMA 4EP7A 4I2FA 9ICWA 4PHEA 4XA5A 4M47A 4I2IA 1ZQAA 4UAZA 4FHVA 2PBEA 7ICOA 5J0TA 3OVSA 1R89A 5J2KA 9ICSA 2PFPA 1ZQUA 4IQWA 2DRBA 4AT8B 4AT7B 2M2VA 4KLHA 8ICIA 5TZVA 4WC5A 5DBBA 4FHYA 4MFAA 3OVAA 3V7KA 9ICQA 9ICJA 4ATBA 5DDYA 4YMNA 3RJHA 4KLSA 4MFCA 1V4AA 4I2HA 4UB5A 1ZQIA 2B51A 4PHAA 4DOAA 4WBZA 1ZQNA 4EBJA 8ICZA 4K4GA 4RQ0A 8ICTA 2M2WA 4P4MA 4TURA 3OGUA 5J0RA 4KLLA 3RH4A 2BPFA 5IINA 4I2EA 5DBCA 4UAYA 9ICHA 5HRKA 4GXKA 3B0XA 4YMOA 2P66A 3JZ0A 4X0BA 4MF8A 3RJKA 4QZIA 4R64A 4X4TA 4M9NA 1XSPA 4E8FA 4NM1A 1MQ2A 5DEDA 8ICMA 5DB6A 1ZQTA 2ZH2A 4S3NA 3UPSA 7ICLA 4P4OA 1BPEA 3MGIA 7ICMA 1Q78A 4X4NA 2PFNA 1MQ3A 4RQ5A 3OUYA 1VJ7A 9ICCA 4IG8A 4KLMA 2NRKA 4WC2A 1ZQEA 3H3AA 4RQ7A 4LZGA 4X4PA 4UAWA 5DB7A 4QZDA 5DKWA 4WCWA 4RWNA 4RWQA 5IIIA 4M9JA 4NKTA 4RWOA 5BOMA 4MFFA 4WBYA 4Z6EA 2M2UA 4YD2A 1WOTA 1F5AA 4DO9A 2IHMA 2O5AA 3WFPA 7ICKA 4FO6A 8ICFA 5HR9A 5J2HA 4F5PA 4UB4A 1TFWA 3MGHA 9ICEA 4F5NA 2DRAA 4X4UA 3LK9A 2DR7A 3AU6A 2VANA 3TFSA 5D49A 4UB3A 9ICOA 1ZQHA 7ICRA 8ICRA 4UB1A 4UBCA 1HUZA 4AT9B 8ICUA 4XQ7A 5HRDA 3AQNA 4WC1A 1ZQXA 1HUOA 1XSNA 5J2EA 4UD5A 3HJ4A 2PXIA 1ZQDA 7ICNA 5DB9A 3ISCA 3C5GA 3V7LA 4KLIA 1TVAA 5CB1A 1MIWA 3H39A 8ICWA 4P2HA 1VFGA 1ZQBA 9ICXA 5HRHA 2FMSA 4O5KA 2ID1A 3C2KA 3MDCA 4M0AA 1JMSA 4RQ2A 9ICMA 4PHDA 4JWNA 3WFQE 3MDAA 4NKUA 4TUQA 4I2GA 3UXNA 2RFFA 1ZJNA 1ZQCA 2O1PA 7ICGA 4F5OA 4DOCA 5J0YA 4QZBA 3UXPA 5CJ7A 8ICVA 1JAJA 4RPYA 5HREA 2ISPA 4ATBB 4FHPA 1UEVA 4UD4A 4I27A 5J0PA 5J2IA 2ZH9A 4FHWA 4X5VA 2BCUA 2PFQA 7ICTA 4M9LA 3AU2A 4MF2A 4I2AA 1KEJA 3UPQA 8ICHA 2M2TA 5HRBA 5J2JA 3JPPA 4X4RA 4KLJA 2ZH6A 5HRGA 3RJEA 2DR8A 1ZQQA 4XRHA 4WC7A 3C2LA 3HWTA 3AUOA 9ICKA 4NXZA 2I9GA 8ICNA 1KNYA 8ICPA 3RJGA 2ZHAA 3OV7A 7ICEA 4XQ8A 1MIYA 2BPGA 3UXOA 8ICEA 4F5QA 5BOLA 4UB2A 3HJ1A 4R66A 4KLUA 5J0SA 4M9HA 7ICUA 4DOBA 1ZQKA 5DECA 4I29A 1RPLA 9ICUA 3C18A 1NOMA 3AQMA 9ICPA 4GXJA 4KLGA 3V72A 4O5EA 8ICLA 3HIYA 1XSLA 1TFYA 5J0UA 4RPXA 5CP2A 1KDHA 4X4SA 2ZH3A 3RJJA 4I2BA 3RH6A 5J0XA 4RQ8A 4QZ8A 4I2DA 1MIVA 4WC0A 2ZH4A 3OUYB 5HHIA 3RJIA 3C66A 3JPOA 8ICOA 1PX5A 1ZQYA 4RT3A 2W9MA 2GWSA 3RJFA 4AT8A 7ICJA 4AT7A 1BPXA 3WFRE 4M04A 1R8CA 5IIMA 5J2BA 5J2DA 1RZTA 1UETA 1ZQLA 4FH5A 4PH5A 4EBKA 4LT6A 5IIJA 2BCQA 3H38A 1BPYA 1YLQA 3ISDA 2ZH5A 1ZQJA 2DR9A 5J0QA 4Z6DA 7ICFA 1ZQMA 2FMQA 4PGQA 2BE3A 5HRLA 4XUSA 3RH5A 2B4VA 7ICQA 4I2JA 2ISOA 3JPQA 4IQTA 2ZHBA 4I2CA 3PMLA 9ICRA 4TUPA 5DBAA 3HX0A 4M9GA 8ICBA 9ICFA 9ICLA 4NM2A 1TV9A 1ZQGA 3NYBA 3MBYA 1ZQSA 5CWRA 3V7JA 2BCVA 2ZH1A 1BPDA 4IQVA 4QZEA 3C2MA 1ZQRA 5HRIA 2BCRA 1Q79A 4Z6FA 4QZFA 5IILA 4QZHA 3TFRA 4F5RA 2DVIA 4E7XA 5HHHA 2HHPA 4P4PA 1UEUA 5EOZA 4RQ4A 3ISBA 2B56A 5J2CA
chains in the Genus database with same CATH superfamily
4YD1A 4YMMA 8ICKA 3AQLA 4RT2A 4O9MA 8ICGA 4RQ3A 7ICVA 2PFOA 4NLZA 7ICIA 4X4OA 2BPCA 3B0YA 5IIKA 3L9DA 3OWGA 4NXWA 4KLDA 4RWPA 4YN4A 4E80A 3PMNA 9ICVA 5HC9A 1ZQOA 9ICTA 2ZH7A 4X0AA 7ICSA 4LEVA 5D46A 8ICXA 8ICYA 5F2VO 8ICCA 3C5FA 7ICPA 4FO1A 4LZDA 4Z6CA 4K9AA 1ZQWA 3GDXA 3LQCB 5CFUA 5J0OA 2FMPA 4R65A 5J0WA 1ZJMA 4QZ9A 5J2FA 9ICIA 3OVBA 4QZGA 1FA0A 4LEYA 2DR5A 4NLKA 4TUSA 1NO5A 3CK6A 2ZH8A 4WH5A 3JPSA 4KLEA 3WFOA 4WQKA 5J2AA 4FH3A 4IQUA 4M2YA 5BPCA 4X4QA 4LVSA 9ICNA 4KB6A 3WFSC 4QZCA 3UQ0A 8ICSA 4WC4A 4GXIA 3JPRA 1R8BA 4UBBA 1BPZA 4O5CA 4X4VA 2Q66A 5CR0A 4KLQA 3JPTA 3AQKA 8ICAA 5DB8A 4RQ6A 3JPNA 4M5DA 9ICAA 1BPBA 4WC6A 4I28A 4QZAA 4NXXA 4JWMA 5J29A 1ZQFA 4R63A 3PNCA 4KLFA 3K7DA 4KLOA 9ICBA 4PHPA 4AT9A 3H37A 1JN3A 1JQRA 5HRFA 3K75D 4NY8A 4PPXA 4NXVA 7ICHA 5D4BA 1ZQZA 4NLNA 5CA7A 3JYYA 3UQ2A 8ICQA 4PGYA 3NVOA 5IIOA 4WC3A 2BCSA 4RPZA 4PGXA 8ICJA 9ICGA 3JCFA 4K4HA 1ZQVA 1R8AA 1ZQPA 4YCXA 5J2GA 4K4IA 4KLTA 1OU5A 5CHGA 4RQ1A 4FHXA 3HW8A 5DDMA 4EP7A 4I2FA 9ICWA 2GAFD 4PHEA 4XA5A 4M47A 4I2IA 1ZQAA 4UAZA 4FHVA 2PBEA 7ICOA 3ER9B 5J0TA 3OVSA 1R89A 5J2KA 9ICSA 2HN1A 2PFPA 1ZQUA 4IQWA 2DRBA 4AT8B 4AT7B 5D63A 2M2VA 4KLHA 8ICIA 5TZVA 4WC5A 5DBBA 4FHYA 4MFAA 3OVAA 3V7KA 9ICQA 9ICJA 4ATBA 5DDYA 4WQLA 4YMNA 3RJHA 4KLSA 4NXTA 4MFCA 1V4AA 4OAHA 4I2HA 4UB5A 1ZQIA 2B51A 4PHAA 4K99A 2HN2A 4DOAA 4WBZA 1ZQNA 4EBJA 8ICZA 4K4GA 4RQ0A 2FCLA 8ICTA 2M2WA 4P4MA 4TURA 3OGUA 5J0RA 4KLLA 3RH4A 2BPFA 5IINA 4I2EA 5DBCA 4UAYA 9ICHA 5HRKA 4GXKA 3B0XA 4YMOA 4MKPA 2P66A 3JZ0A 5D61A 4X0BA 4MF8A 3RJKA 4QZIA 5CFTA 4R64A 4X4TA 4M9NA 1XSPA 4E8FA 4NM1A 1MQ2A 5DEDA 8ICMA 5DB6A 1ZQTA 2ZH2A 4S3NA 4K8VA 3UPSA 7ICLA 4P4OA 1BPEA 3MGIA 7ICMA 3EF2A 1Q78A 4X4NA 4OAGA 2PFNA 1MQ3A 4RQ5A 3OUYA 1VJ7A 9ICCA 4IG8A 4KLMA 2NRKA 4WC2A 1ZQEA 3H3AA 4RQ7A 4LZGA 4X4PA 4UAWA 2BBJA 5DB7A 4QZDA 4KM5A 5DKWA 4WCWA 4RWNA 4RWQA 4O69A 5IIIA 4M9JA 4NKTA 4RWOA 5BOMA 4K97A 4HX0A 4WBYA 4Z6EA 2M2UA 4MFFA 4YD2A 1WOTA 1F5AA 4XJEA 4DO9A 2IHMA 3ER8C 2O5AA 2GA9D 3WFPA 7ICKA 4K98A 4FO6A 8ICFA 5HR9A 5J2HA 4F5PA 4UB4A 4EEDA 4LEZA 1TFWA 3MGHA 9ICEA 4F5NA 2DRAA 4X4UA 2DR7A 3LK9A 3AU6A 4WOYA 2VANA 3TFSA 5D49A 4UB3A 9ICOA 1ZQHA 7ICRA 8ICRA 4UB1A 4UBCA 1HUZA 5B3QA 4AT9B 8ICUA 4XQ7A 5HRDA 3AQNA 4WC1A 1ZQXA 1HUOA 1XSNA 5J2EA 4UD5A 3HJ4A 2PXIA 1ZQDA 7ICNA 5DB9A 3ISCA 3C5GA 3V7LA 4KLIA 1TVAA 4NXUA 5CB1A 1MIWA 3H39A 8ICWA 4P2HA 1VFGA 1ZQBA 9ICXA 5HRHA 2FMSA 4O5KA 2ID1A 3C2KA 3MDCA 4M0AA 1JMSA 4LEWA 4RQ2A 9ICMA 4PHDA 4OAIZ 4JWNA 3WFQE 3MDAA 4NKUA 4TUQA 5B3PA 4I2GA 3UXNA 2RFFA 2IUBA 1ZJNA 1ZQCA 2BBHA 2O1PA 7ICGA 4F5OA 4DOCA 5J0YA 4QZBA 3UXPA 5CJ7A 8ICVA 1JAJA 4RPYA 5HREA 2ISPA 4ATBB 4FHPA 1UEVA 4UD4A 4I27A 5J0PA 5JTGA 5J2IA 2ZH9A 4FHWA 4X5VA 2BCUA 2PFQA 7ICTA 4K96A 4M9LA 3AU2A 4MF2A 4I2AA 1KEJA 3UPQA 8ICHA 2M2TA 2EWRA 5HRBA 5J2JA 3JPPA 4X4RA 4KLJA 2ZH6A 5HRGA 3RJEA 2DR8A 4JLZA 1ZQQA 4XRHA 4WC7A 3C2LA 4JLXA 3HWTA 5CFSA 3AUOA 9ICKA 4NXZA 2I9GA 8ICNA 1KNYA 8ICPA 3RJGA 2ZHAA 3OV7A 7ICEA 4XQ8A 1MIYA 2BPGA 3UXOA 8ICEA 1GPJA 4F5QA 5BOLA 4UB2A 3HJ1A 4R66A 4KLUA 5J0SA 4M9HA 7ICUA 4DOBA 1ZQKA 5DECA 4I29A 1RPLA 4K9BA 4I0UA 9ICUA 3C18A 1NOMA 3AQMA 9ICPA 4GXJA 4KLGA 3V72A 4O5EA 8ICLA 3HIYA 1TFYA 5D62A 4EV6A 1XSLA 4O6AA 5CHEA 5J0UA 4RPXA 5CP2A 2IHOA 1KDHA 4X4SA 2ZH3A 3RJJA 4I2BA 3RH6A 5J0XA 4RQ8A 4QZ8A 4I2DA 1MIVA 4WC0A 2ZH4A 3OUYB 5HHIA 3RJIA 3C66A 3JPOA 8ICOA 1PX5A 1ZQYA 4RT3A 2W9MA 2GWSA 3RJFA 4AT8A 7ICJA 4AT7A 1BPXA 3WFRE 4M04A 1R8CA 5IIMA 5J2BA 5J2DA 1RZTA 1UETA 1ZQLA 4FH5A 4PH5A 4EEBA 4EBKA 4LT6A 5IIJA 2BCQA 3H38A 1BPYA 1YLQA 3ISDA 2ZH5A 1ZQJA 2DR9A 5J0QA 4Z6DA 7ICFA 4EGWA 3NWIA 1ZQMA 2FMQA 4PGQA 2BE3A 3PHZA 5HRLA 4XUSA 3RH5A 2B4VA 7ICQA 4I2JA 2ISOA 3JPQA 2ZHBA 4IQTA 4I2CA 3PMLA 9ICRA 4TUPA 5DBAA 3HX0A 4M9GA 4N7RA 8ICBA 9ICFA 9ICLA 4O67A 4NM2A 1TV9A 1ZQGA 3NYBA 3MCRA 3MBYA 1ZQSA 5CWRA 3V7JA 2BCVA 2ZH1A 1BPDA 4IQVA 4QZEA 3C2MA 1ZQRA 5HRIA 2BCRA 1Q79A 4Z6FA 4OAFA 4QZFA 5IILA 4QZHA 3TFRA 4F5RA 2DVIA 4O68A 3ERCC 4E7XA 3NKUA 5HHHA 2HHPA 4P4PA 1UEUA 5EOZA 4RQ4A 3ISBA 2B56A 5J2CA
chains in the Genus database with same CATH topology
4YD1A 4YMMA 8ICKA 3AQLA 4RT2A 4O9MA 8ICGA 4RQ3A 7ICVA 2PFOA 4NLZA 7ICIA 4X4OA 2BPCA 3B0YA 5IIKA 3L9DA 4NXWA 4KLDA 4RWPA 4YN4A 4E80A 3PMNA 9ICVA 5HC9A 1ZQOA 9ICTA 2ZH7A 4X0AA 7ICSA 4LEVA 5D46A 8ICXA 8ICYA 5F2VO 8ICCA 3C5FA 7ICPA 4LZDA 4Z6CA 4K9AA 1ZQWA 3GDXA 3LQCB 5J0OA 2FMPA 4R65A 5J0WA 1ZJMA 4QZ9A 5J2FA 9ICIA 3OVBA 4QZGA 1FA0A 4LEYA 2DR5A 4NLKA 4TUSA 1NO5A 2ZH8A 3JPSA 4KLEA 3WFOA 5J2AA 4FH3A 4IQUA 4M2YA 5BPCA 4X4QA 4LVSA 9ICNA 4KB6A 3WFSC 4QZCA 3UQ0A 8ICSA 4WC4A 4GXIA 3JPRA 1R8BA 4UBBA 1BPZA 4O5CA 4X4VA 2Q66A 5CR0A 4KLQA 3JPTA 3AQKA 8ICAA 5DB8A 4RQ6A 3JPNA 4M5DA 9ICAA 1BPBA 4WC6A 4I28A 4QZAA 4NXXA 4JWMA 5J29A 1ZQFA 4R63A 3PNCA 4KLFA 9ICBA 4KLOA 4PHPA 4AT9A 3H37A 1JN3A 1JQRA 5HRFA 3K75D 4NY8A 4PPXA 4NXVA 7ICHA 5D4BA 1ZQZA 4NLNA 5CA7A 3JYYA 3UQ2A 8ICQA 4PGYA 5IIOA 4WC3A 2BCSA 4RPZA 4PGXA 8ICJA 9ICGA 4K4HA 1ZQVA 1R8AA 1ZQPA 4YCXA 5J2GA 4K4IA 4KLTA 1OU5A 5CHGA 4RQ1A 4FHXA 3HW8A 5DDMA 4EP7A 4I2FA 9ICWA 4PHEA 4XA5A 4M47A 4I2IA 1ZQAA 4UAZA 4FHVA 2PBEA 7ICOA 5J0TA 3OVSA 1R89A 5J2KA 9ICSA 2PFPA 1ZQUA 4IQWA 2DRBA 4AT8B 4AT7B 2M2VA 4KLHA 8ICIA 5TZVA 4WC5A 5DBBA 4FHYA 4MFAA 3OVAA 3V7KA 9ICQA 9ICJA 4ATBA 5DDYA 4YMNA 3RJHA 4KLSA 4NXTA 4MFCA 1V4AA 4OAHA 4I2HA 4UB5A 1ZQIA 2B51A 4PHAA 4K99A 4DOAA 4WBZA 1ZQNA 4EBJA 8ICZA 4K4GA 4RQ0A 8ICTA 2M2WA 4P4MA 4TURA 3OGUA 5J0RA 4KLLA 3RH4A 2BPFA 5IINA 4I2EA 5DBCA 4UAYA 9ICHA 5HRKA 4GXKA 3B0XA 4YMOA 4MKPA 2P66A 3JZ0A 4X0BA 4MF8A 3RJKA 4QZIA 4R64A 4X4TA 4M9NA 1XSPA 4E8FA 4NM1A 1MQ2A 5DEDA 8ICMA 5DB6A 1ZQTA 2ZH2A 4S3NA 4K8VA 3UPSA 7ICLA 4P4OA 1BPEA 3MGIA 7ICMA 1Q78A 4X4NA 4OAGA 2PFNA 1MQ3A 4RQ5A 3OUYA 1VJ7A 9ICCA 4IG8A 4KLMA 2NRKA 4WC2A 1ZQEA 3H3AA 4RQ7A 4LZGA 4X4PA 4UAWA 5DB7A 4QZDA 4KM5A 5DKWA 4WCWA 4RWNA 4RWQA 4O69A 5IIIA 4M9JA 4NKTA 4RWOA 5BOMA 4K97A 4MFFA 4WBYA 4Z6EA 2M2UA 4YD2A 1WOTA 1F5AA 4DO9A 2IHMA 2O5AA 3WFPA 7ICKA 4K98A 4FO6A 8ICFA 5HR9A 5J2HA 4F5PA 4UB4A 4LEZA 1TFWA 3MGHA 9ICEA 4F5NA 2DRAA 4X4UA 2DR7A 3LK9A 3AU6A 4WOYA 2VANA 3TFSA 5D49A 4UB3A 9ICOA 1ZQHA 7ICRA 8ICRA 4UB1A 4UBCA 1HUZA 4AT9B 8ICUA 4XQ7A 5HRDA 3AQNA 4WC1A 1ZQXA 1HUOA 1XSNA 5J2EA 4UD5A 3HJ4A 2PXIA 1ZQDA 7ICNA 5DB9A 3ISCA 3C5GA 3V7LA 4KLIA 1TVAA 4NXUA 5CB1A 1MIWA 3H39A 8ICWA 4P2HA 1VFGA 1ZQBA 9ICXA 5HRHA 2FMSA 4O5KA 2ID1A 3C2KA 3MDCA 4M0AA 1JMSA 4LEWA 4RQ2A 9ICMA 4PHDA 4OAIZ 4JWNA 3WFQE 3MDAA 4NKUA 4TUQA 4I2GA 3UXNA 2RFFA 1ZJNA 1ZQCA 2O1PA 7ICGA 4F5OA 4DOCA 5J0YA 4QZBA 3UXPA 5CJ7A 8ICVA 1JAJA 4RPYA 5HREA 2ISPA 4ATBB 4FHPA 1UEVA 4UD4A 4I27A 5J0PA 5J2IA 2ZH9A 4FHWA 4X5VA 2BCUA 2PFQA 7ICTA 4K96A 4M9LA 3AU2A 4MF2A 4I2AA 1KEJA 3UPQA 8ICHA 2M2TA 5HRBA 5J2JA 3JPPA 4X4RA 4KLJA 2ZH6A 5HRGA 3RJEA 2DR8A 4JLZA 1ZQQA 4XRHA 4WC7A 3C2LA 4JLXA 3HWTA 3AUOA 9ICKA 4NXZA 2I9GA 8ICNA 1KNYA 8ICPA 3RJGA 2ZHAA 3OV7A 7ICEA 4XQ8A 1MIYA 2BPGA 3UXOA 8ICEA 4F5QA 5BOLA 4UB2A 3HJ1A 4R66A 4KLUA 5J0SA 4M9HA 7ICUA 4DOBA 1ZQKA 5DECA 4I29A 1RPLA 4K9BA 9ICUA 3C18A 1NOMA 3AQMA 9ICPA 4GXJA 4KLGA 3V72A 4O5EA 8ICLA 3HIYA 1TFYA 1XSLA 4O6AA 5J0UA 4RPXA 5CP2A 1KDHA 4X4SA 2ZH3A 3RJJA 4I2BA 3RH6A 5J0XA 4RQ8A 4QZ8A 4I2DA 1MIVA 4WC0A 2ZH4A 3OUYB 5HHIA 3RJIA 3C66A 3JPOA 8ICOA 1PX5A 1ZQYA 4RT3A 2W9MA 2GWSA 3RJFA 4AT8A 7ICJA 4AT7A 1BPXA 3WFRE 4M04A 1R8CA 5IIMA 5J2BA 5J2DA 1RZTA 1UETA 1ZQLA 4FH5A 4PH5A 4EBKA 4LT6A 5IIJA 2BCQA 3H38A 1BPYA 1YLQA 3ISDA 2ZH5A 1ZQJA 2DR9A 5J0QA 4Z6DA 7ICFA 1ZQMA 2FMQA 4PGQA 2BE3A 5HRLA 4XUSA 3RH5A 2B4VA 7ICQA 4I2JA 2ISOA 3JPQA 2ZHBA 4IQTA 4I2CA 3PMLA 9ICRA 4TUPA 5DBAA 3HX0A 4M9GA 8ICBA 9ICFA 9ICLA 4O67A 4NM2A 1TV9A 1ZQGA 3NYBA 3MBYA 1ZQSA 5CWRA 3V7JA 2BCVA 2ZH1A 1BPDA 4IQVA 4QZEA 3C2MA 1ZQRA 5HRIA 2BCRA 1Q79A 4Z6FA 4OAFA 4QZFA 5IILA 4QZHA 3TFRA 4F5RA 2DVIA 4O68A 4E7XA 5HHHA 2HHPA 4P4PA 1UEUA 5EOZA 4RQ4A 3ISBA 2B56A 5J2CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YD1 A;  4YMM A;  8ICK A;  3AQL A;  4RT2 A;  4O9M A;  8ICG A;  4RQ3 A;  7ICV A;  2PFO A;  4NLZ A;  7ICI A;  4X4O A;  2BPC A;  3B0Y A;  5IIK A;  3L9D A;  4KLD A;  4RWP A;  4YN4 A;  4E80 A;  3PMN A;  9ICV A;  5HC9 A;  1ZQO A;  9ICT A;  2ZH7 A;  4X0A A;  7ICS A;  5D46 A;  8ICX A;  8ICY A;  5F2V O;  8ICC A;  3C5F A;  7ICP A;  4LZD A;  4Z6C A;  1ZQW A;  3GDX A;  3LQC B;  5J0O A;  2FMP A;  4R65 A;  5J0W A;  1ZJM A;  4QZ9 A;  5J2F A;  9ICI A;  3OVB A;  4QZG A;  1FA0 A;  2DR5 A;  4NLK A;  4TUS A;  1NO5 A;  2ZH8 A;  3JPS A;  4KLE A;  3WFO A;  5J2A A;  4FH3 A;  4IQU A;  4M2Y A;  5BPC A;  4X4Q A;  4LVS A;  9ICN A;  3WFS C;  4QZC A;  3UQ0 A;  8ICS A;  4WC4 A;  4GXI A;  3JPR A;  1R8B A;  4UBB A;  1BPZ A;  4O5C A;  4X4V A;  2Q66 A;  5CR0 A;  4KLQ A;  3JPT A;  3AQK A;  8ICA A;  5DB8 A;  4RQ6 A;  3JPN A;  4M5D A;  9ICA A;  1BPB A;  4WC6 A;  4I28 A;  4QZA A;  4JWM A;  5J29 A;  1ZQF A;  4R63 A;  3PNC A;  4KLF A;  9ICB A;  4KLO A;  4PHP A;  3H37 A;  4AT9 A;  1JN3 A;  1JQR A;  5HRF A;  3K75 D;  4NY8 A;  4PPX A;  7ICH A;  5D4B A;  1ZQZ A;  4NLN A;  5CA7 A;  3JYY A;  3UQ2 A;  8ICQ A;  4PGY A;  5IIO A;  4WC3 A;  2BCS A;  4RPZ A;  4PGX A;  8ICJ A;  9ICG A;  4K4H A;  1ZQV A;  1R8A A;  1ZQP A;  4YCX A;  5J2G A;  4K4I A;  4KLT A;  1OU5 A;  5CHG A;  4RQ1 A;  4FHX A;  3HW8 A;  5DDM A;  4EP7 A;  4I2F A;  9ICW A;  4PHE A;  4XA5 A;  4M47 A;  4I2I A;  1ZQA A;  4UAZ A;  4FHV A;  2PBE A;  7ICO A;  5J0T A;  3OVS A;  1R89 A;  5J2K A;  9ICS A;  2PFP A;  1ZQU A;  4IQW A;  2DRB A;  4AT8 B;  4AT7 B;  2M2V A;  4KLH A;  8ICI A;  5TZV A;  4WC5 A;  5DBB A;  4FHY A;  4MFA A;  3OVA A;  3V7K A;  9ICQ A;  9ICJ A;  4ATB A;  5DDY A;  4YMN A;  3RJH A;  4KLS A;  4MFC A;  1V4A A;  4I2H A;  4UB5 A;  1ZQI A;  2B51 A;  4PHA A;  4DOA A;  4WBZ A;  1ZQN A;  4EBJ A;  8ICZ A;  4K4G A;  4RQ0 A;  8ICT A;  2M2W A;  4P4M A;  4TUR A;  3OGU A;  5J0R A;  4KLL A;  3RH4 A;  2BPF A;  5IIN A;  4I2E A;  5DBC A;  4UAY A;  9ICH A;  5HRK A;  4GXK A;  3B0X A;  4YMO A;  2P66 A;  3JZ0 A;  4X0B A;  4MF8 A;  3RJK A;  4QZI A;  4R64 A;  4X4T A;  4M9N A;  1XSP A;  4E8F A;  4NM1 A;  1MQ2 A;  5DED A;  8ICM A;  5DB6 A;  1ZQT A;  2ZH2 A;  4S3N A;  3UPS A;  7ICL A;  4P4O A;  1BPE A;  3MGI A;  7ICM A;  1Q78 A;  4X4N A;  2PFN A;  1MQ3 A;  4RQ5 A;  3OUY A;  1VJ7 A;  9ICC A;  4IG8 A;  4KLM A;  2NRK A;  4WC2 A;  1ZQE A;  3H3A A;  4RQ7 A;  4LZG A;  4X4P A;  4UAW A;  5DB7 A;  4QZD A;  5DKW A;  4WCW A;  4RWN A;  4RWQ A;  5III A;  4M9J A;  4NKT A;  4RWO A;  5BOM A;  4MFF A;  4WBY A;  4Z6E A;  2M2U A;  4YD2 A;  1WOT A;  1F5A A;  4DO9 A;  2IHM A;  2O5A A;  3WFP A;  7ICK A;  4FO6 A;  8ICF A;  5HR9 A;  5J2H A;  4F5P A;  4UB4 A;  1TFW A;  3MGH A;  9ICE A;  4F5N A;  2DRA A;  4X4U A;  3LK9 A;  2DR7 A;  3AU6 A;  2VAN A;  3TFS A;  5D49 A;  4UB3 A;  9ICO A;  1ZQH A;  7ICR A;  8ICR A;  4UB1 A;  4UBC A;  1HUZ A;  4AT9 B;  8ICU A;  4XQ7 A;  5HRD A;  3AQN A;  4WC1 A;  1ZQX A;  1HUO A;  1XSN A;  5J2E A;  4UD5 A;  3HJ4 A;  2PXI A;  1ZQD A;  7ICN A;  5DB9 A;  3ISC A;  3C5G A;  3V7L A;  4KLI A;  1TVA A;  5CB1 A;  1MIW A;  3H39 A;  8ICW A;  4P2H A;  1VFG A;  1ZQB A;  9ICX A;  5HRH A;  2FMS A;  4O5K A;  2ID1 A;  3C2K A;  3MDC A;  4M0A A;  1JMS A;  4RQ2 A;  9ICM A;  4PHD A;  4JWN A;  3WFQ E;  3MDA A;  4NKU A;  4TUQ A;  4I2G A;  3UXN A;  2RFF A;  1ZJN A;  1ZQC A;  2O1P A;  7ICG A;  4F5O A;  4DOC A;  5J0Y A;  4QZB A;  3UXP A;  5CJ7 A;  8ICV A;  1JAJ A;  4RPY A;  5HRE A;  2ISP A;  4ATB B;  4FHP A;  1UEV A;  4UD4 A;  4I27 A;  5J0P A;  5J2I A;  2ZH9 A;  4FHW A;  4X5V A;  2BCU A;  2PFQ A;  7ICT A;  4M9L A;  3AU2 A;  4MF2 A;  4I2A A;  1KEJ A;  3UPQ A;  8ICH A;  2M2T A;  5HRB A;  5J2J A;  3JPP A;  4X4R A;  4KLJ A;  2ZH6 A;  5HRG A;  3RJE A;  2DR8 A;  1ZQQ A;  4XRH A;  4WC7 A;  3C2L A;  3HWT A;  3AUO A;  9ICK A;  4NXZ A;  2I9G A;  8ICN A;  1KNY A;  8ICP A;  3RJG A;  2ZHA A;  3OV7 A;  7ICE A;  4XQ8 A;  1MIY A;  2BPG A;  3UXO A;  8ICE A;  4F5Q A;  5BOL A;  4UB2 A;  3HJ1 A;  4R66 A;  4KLU A;  5J0S A;  4M9H A;  7ICU A;  4DOB A;  1ZQK A;  5DEC A;  4I29 A;  1RPL A;  9ICU A;  3C18 A;  1NOM A;  3AQM A;  9ICP A;  4GXJ A;  4KLG A;  3V72 A;  4O5E A;  8ICL A;  3HIY A;  1XSL A;  1TFY A;  5J0U A;  4RPX A;  5CP2 A;  1KDH A;  4X4S A;  2ZH3 A;  3RJJ A;  4I2B A;  3RH6 A;  5J0X A;  4RQ8 A;  4QZ8 A;  4I2D A;  1MIV A;  4WC0 A;  2ZH4 A;  3OUY B;  5HHI A;  3RJI A;  3C66 A;  3JPO A;  8ICO A;  1PX5 A;  1ZQY A;  4RT3 A;  2W9M A;  2GWS A;  3RJF A;  4AT8 A;  7ICJ A;  4AT7 A;  1BPX A;  3WFR E;  4M04 A;  1R8C A;  5IIM A;  5J2B A;  5J2D A;  1RZT A;  1UET A;  1ZQL A;  4FH5 A;  4PH5 A;  4EBK A;  4LT6 A;  5IIJ A;  2BCQ A;  3H38 A;  1BPY A;  1YLQ A;  3ISD A;  2ZH5 A;  1ZQJ A;  2DR9 A;  5J0Q A;  4Z6D A;  7ICF A;  1ZQM A;  2FMQ A;  4PGQ A;  2BE3 A;  5HRL A;  4XUS A;  3RH5 A;  2B4V A;  7ICQ A;  4I2J A;  2ISO A;  3JPQ A;  4IQT A;  2ZHB A;  4I2C A;  3PML A;  9ICR A;  4TUP A;  5DBA A;  3HX0 A;  4M9G A;  8ICB A;  9ICF A;  9ICL A;  4NM2 A;  1TV9 A;  1ZQG A;  3NYB A;  3MBY A;  1ZQS A;  5CWR A;  3V7J A;  2BCV A;  2ZH1 A;  1BPD A;  4IQV A;  4QZE A;  3C2M A;  1ZQR A;  5HRI A;  2BCR A;  1Q79 A;  4Z6F A;  4QZF A;  5IIL A;  4QZH A;  3TFR A;  4F5R A;  2DVI A;  4E7X A;  5HHH A;  2HHP A;  4P4P A;  1UEU A;  5EOZ A;  4RQ4 A;  3ISB A;  2B56 A;  5J2C A; 
#chains in the Genus database with same CATH topology
 4YD1 A;  4YMM A;  8ICK A;  3AQL A;  4RT2 A;  4O9M A;  8ICG A;  4RQ3 A;  7ICV A;  2PFO A;  4NLZ A;  7ICI A;  4X4O A;  2BPC A;  3B0Y A;  5IIK A;  3L9D A;  3OWG A;  4NXW A;  4KLD A;  4RWP A;  4YN4 A;  4E80 A;  3PMN A;  9ICV A;  5HC9 A;  1ZQO A;  9ICT A;  2ZH7 A;  4X0A A;  7ICS A;  4LEV A;  5D46 A;  8ICX A;  8ICY A;  5F2V O;  8ICC A;  3C5F A;  7ICP A;  4FO1 A;  4LZD A;  4Z6C A;  4K9A A;  1ZQW A;  3GDX A;  3LQC B;  5CFU A;  5J0O A;  2FMP A;  4R65 A;  5J0W A;  1ZJM A;  4QZ9 A;  5J2F A;  9ICI A;  3OVB A;  4QZG A;  1FA0 A;  4LEY A;  2DR5 A;  4NLK A;  4TUS A;  1NO5 A;  3CK6 A;  2ZH8 A;  4WH5 A;  3JPS A;  4KLE A;  3WFO A;  4WQK A;  5J2A A;  4FH3 A;  4IQU A;  4M2Y A;  5BPC A;  4X4Q A;  4LVS A;  9ICN A;  4KB6 A;  3WFS C;  4QZC A;  3UQ0 A;  8ICS A;  4WC4 A;  4GXI A;  3JPR A;  1R8B A;  4UBB A;  1BPZ A;  4O5C A;  4X4V A;  2Q66 A;  5CR0 A;  4KLQ A;  3JPT A;  3AQK A;  8ICA A;  5DB8 A;  4RQ6 A;  3JPN A;  4M5D A;  9ICA A;  1BPB A;  4WC6 A;  4I28 A;  4QZA A;  4NXX A;  4JWM A;  5J29 A;  1ZQF A;  4R63 A;  3PNC A;  4KLF A;  3K7D A;  4KLO A;  9ICB A;  4PHP A;  4AT9 A;  3H37 A;  1JN3 A;  1JQR A;  5HRF A;  3K75 D;  4NY8 A;  4PPX A;  4NXV A;  7ICH A;  5D4B A;  1ZQZ A;  4NLN A;  5CA7 A;  3JYY A;  3UQ2 A;  8ICQ A;  4PGY A;  3NVO A;  5IIO A;  4WC3 A;  2BCS A;  4RPZ A;  4PGX A;  8ICJ A;  9ICG A;  3JCF A;  4K4H A;  1ZQV A;  1R8A A;  1ZQP A;  4YCX A;  5J2G A;  4K4I A;  4KLT A;  1OU5 A;  5CHG A;  4RQ1 A;  4FHX A;  3HW8 A;  5DDM A;  4EP7 A;  4I2F A;  9ICW A;  2GAF D;  4PHE A;  4XA5 A;  4M47 A;  4I2I A;  1ZQA A;  4UAZ A;  4FHV A;  2PBE A;  7ICO A;  3ER9 B;  5J0T A;  3OVS A;  1R89 A;  5J2K A;  9ICS A;  2HN1 A;  2PFP A;  1ZQU A;  4IQW A;  2DRB A;  4AT8 B;  4AT7 B;  5D63 A;  2M2V A;  4KLH A;  8ICI A;  5TZV A;  4WC5 A;  5DBB A;  4FHY A;  4MFA A;  3OVA A;  3V7K A;  9ICQ A;  9ICJ A;  4ATB A;  5DDY A;  4WQL A;  4YMN A;  3RJH A;  4KLS A;  4NXT A;  4MFC A;  1V4A A;  4OAH A;  4I2H A;  4UB5 A;  1ZQI A;  2B51 A;  4PHA A;  4K99 A;  2HN2 A;  4DOA A;  4WBZ A;  1ZQN A;  4EBJ A;  8ICZ A;  4K4G A;  4RQ0 A;  2FCL A;  8ICT A;  2M2W A;  4P4M A;  4TUR A;  3OGU A;  5J0R A;  4KLL A;  3RH4 A;  2BPF A;  5IIN A;  4I2E A;  5DBC A;  4UAY A;  9ICH A;  5HRK A;  4GXK A;  3B0X A;  4YMO A;  4MKP A;  2P66 A;  3JZ0 A;  5D61 A;  4X0B A;  4MF8 A;  3RJK A;  4QZI A;  5CFT A;  4R64 A;  4X4T A;  4M9N A;  1XSP A;  4E8F A;  4NM1 A;  1MQ2 A;  5DED A;  8ICM A;  5DB6 A;  1ZQT A;  2ZH2 A;  4S3N A;  4K8V A;  3UPS A;  7ICL A;  4P4O A;  1BPE A;  3MGI A;  7ICM A;  3EF2 A;  1Q78 A;  4X4N A;  4OAG A;  2PFN A;  1MQ3 A;  4RQ5 A;  3OUY A;  1VJ7 A;  9ICC A;  4IG8 A;  4KLM A;  2NRK A;  4WC2 A;  1ZQE A;  3H3A A;  4RQ7 A;  4LZG A;  4X4P A;  4UAW A;  2BBJ A;  5DB7 A;  4QZD A;  4KM5 A;  5DKW A;  4WCW A;  4RWN A;  4RWQ A;  4O69 A;  5III A;  4M9J A;  4NKT A;  4RWO A;  5BOM A;  4K97 A;  4HX0 A;  4WBY A;  4Z6E A;  2M2U A;  4MFF A;  4YD2 A;  1WOT A;  1F5A A;  4XJE A;  4DO9 A;  2IHM A;  3ER8 C;  2O5A A;  2GA9 D;  3WFP A;  7ICK A;  4K98 A;  4FO6 A;  8ICF A;  5HR9 A;  5J2H A;  4F5P A;  4UB4 A;  4EED A;  4LEZ A;  1TFW A;  3MGH A;  9ICE A;  4F5N A;  2DRA A;  4X4U A;  2DR7 A;  3LK9 A;  3AU6 A;  4WOY A;  2VAN A;  3TFS A;  5D49 A;  4UB3 A;  9ICO A;  1ZQH A;  7ICR A;  8ICR A;  4UB1 A;  4UBC A;  1HUZ A;  5B3Q A;  4AT9 B;  8ICU A;  4XQ7 A;  5HRD A;  3AQN A;  4WC1 A;  1ZQX A;  1HUO A;  1XSN A;  5J2E A;  4UD5 A;  3HJ4 A;  2PXI A;  1ZQD A;  7ICN A;  5DB9 A;  3ISC A;  3C5G A;  3V7L A;  4KLI A;  1TVA A;  4NXU A;  5CB1 A;  1MIW A;  3H39 A;  8ICW A;  4P2H A;  1VFG A;  1ZQB A;  9ICX A;  5HRH A;  2FMS A;  4O5K A;  2ID1 A;  3C2K A;  3MDC A;  4M0A A;  1JMS A;  4LEW A;  4RQ2 A;  9ICM A;  4PHD A;  4OAI Z;  4JWN A;  3WFQ E;  3MDA A;  4NKU A;  4TUQ A;  5B3P A;  4I2G A;  3UXN A;  2RFF A;  2IUB A;  1ZJN A;  1ZQC A;  2BBH A;  2O1P A;  7ICG A;  4F5O A;  4DOC A;  5J0Y A;  4QZB A;  3UXP A;  5CJ7 A;  8ICV A;  1JAJ A;  4RPY A;  5HRE A;  2ISP A;  4ATB B;  4FHP A;  1UEV A;  4UD4 A;  4I27 A;  5J0P A;  5JTG A;  5J2I A;  2ZH9 A;  4FHW A;  4X5V A;  2BCU A;  2PFQ A;  7ICT A;  4K96 A;  4M9L A;  3AU2 A;  4MF2 A;  4I2A A;  1KEJ A;  3UPQ A;  8ICH A;  2M2T A;  2EWR A;  5HRB A;  5J2J A;  3JPP A;  4X4R A;  4KLJ A;  2ZH6 A;  5HRG A;  3RJE A;  2DR8 A;  4JLZ A;  1ZQQ A;  4XRH A;  4WC7 A;  3C2L A;  4JLX A;  3HWT A;  5CFS A;  3AUO A;  9ICK A;  4NXZ A;  2I9G A;  8ICN A;  1KNY A;  8ICP A;  3RJG A;  2ZHA A;  3OV7 A;  7ICE A;  4XQ8 A;  1MIY A;  2BPG A;  3UXO A;  8ICE A;  1GPJ A;  4F5Q A;  5BOL A;  4UB2 A;  3HJ1 A;  4R66 A;  4KLU A;  5J0S A;  4M9H A;  7ICU A;  4DOB A;  1ZQK A;  5DEC A;  4I29 A;  1RPL A;  4K9B A;  4I0U A;  9ICU A;  3C18 A;  1NOM A;  3AQM A;  9ICP A;  4GXJ A;  4KLG A;  3V72 A;  4O5E A;  8ICL A;  3HIY A;  1TFY A;  5D62 A;  4EV6 A;  1XSL A;  4O6A A;  5CHE A;  5J0U A;  4RPX A;  5CP2 A;  2IHO A;  1KDH A;  4X4S A;  2ZH3 A;  3RJJ A;  4I2B A;  3RH6 A;  5J0X A;  4RQ8 A;  4QZ8 A;  4I2D A;  1MIV A;  4WC0 A;  2ZH4 A;  3OUY B;  5HHI A;  3RJI A;  3C66 A;  3JPO A;  8ICO A;  1PX5 A;  1ZQY A;  4RT3 A;  2W9M A;  2GWS A;  3RJF A;  4AT8 A;  7ICJ A;  4AT7 A;  1BPX A;  3WFR E;  4M04 A;  1R8C A;  5IIM A;  5J2B A;  5J2D A;  1RZT A;  1UET A;  1ZQL A;  4FH5 A;  4PH5 A;  4EEB A;  4EBK A;  4LT6 A;  5IIJ A;  2BCQ A;  3H38 A;  1BPY A;  1YLQ A;  3ISD A;  2ZH5 A;  1ZQJ A;  2DR9 A;  5J0Q A;  4Z6D A;  7ICF A;  4EGW A;  3NWI A;  1ZQM A;  2FMQ A;  4PGQ A;  2BE3 A;  3PHZ A;  5HRL A;  4XUS A;  3RH5 A;  2B4V A;  7ICQ A;  4I2J A;  2ISO A;  3JPQ A;  2ZHB A;  4IQT A;  4I2C A;  3PML A;  9ICR A;  4TUP A;  5DBA A;  3HX0 A;  4M9G A;  4N7R A;  8ICB A;  9ICF A;  9ICL A;  4O67 A;  4NM2 A;  1TV9 A;  1ZQG A;  3NYB A;  3MCR A;  3MBY A;  1ZQS A;  5CWR A;  3V7J A;  2BCV A;  2ZH1 A;  1BPD A;  4IQV A;  4QZE A;  3C2M A;  1ZQR A;  5HRI A;  2BCR A;  1Q79 A;  4Z6F A;  4OAF A;  4QZF A;  5IIL A;  4QZH A;  3TFR A;  4F5R A;  2DVI A;  4O68 A;  3ERC C;  4E7X A;  3NKU A;  5HHH A;  2HHP A;  4P4P A;  1UEU A;  5EOZ A;  4RQ4 A;  3ISB A;  2B56 A;  5J2C A; 
#chains in the Genus database with same CATH homology
 4YD1 A;  4YMM A;  8ICK A;  3AQL A;  4RT2 A;  4O9M A;  8ICG A;  4RQ3 A;  7ICV A;  2PFO A;  4NLZ A;  7ICI A;  4X4O A;  2BPC A;  3B0Y A;  5IIK A;  3L9D A;  4NXW A;  4KLD A;  4RWP A;  4YN4 A;  4E80 A;  3PMN A;  9ICV A;  5HC9 A;  1ZQO A;  9ICT A;  2ZH7 A;  4X0A A;  7ICS A;  4LEV A;  5D46 A;  8ICX A;  8ICY A;  5F2V O;  8ICC A;  3C5F A;  7ICP A;  4LZD A;  4Z6C A;  4K9A A;  1ZQW A;  3GDX A;  3LQC B;  5J0O A;  2FMP A;  4R65 A;  5J0W A;  1ZJM A;  4QZ9 A;  5J2F A;  9ICI A;  3OVB A;  4QZG A;  1FA0 A;  4LEY A;  2DR5 A;  4NLK A;  4TUS A;  1NO5 A;  2ZH8 A;  3JPS A;  4KLE A;  3WFO A;  5J2A A;  4FH3 A;  4IQU A;  4M2Y A;  5BPC A;  4X4Q A;  4LVS A;  9ICN A;  4KB6 A;  3WFS C;  4QZC A;  3UQ0 A;  8ICS A;  4WC4 A;  4GXI A;  3JPR A;  1R8B A;  4UBB A;  1BPZ A;  4O5C A;  4X4V A;  2Q66 A;  5CR0 A;  4KLQ A;  3JPT A;  3AQK A;  8ICA A;  5DB8 A;  4RQ6 A;  3JPN A;  4M5D A;  9ICA A;  1BPB A;  4WC6 A;  4I28 A;  4QZA A;  4NXX A;  4JWM A;  5J29 A;  1ZQF A;  4R63 A;  3PNC A;  4KLF A;  9ICB A;  4KLO A;  4PHP A;  4AT9 A;  3H37 A;  1JN3 A;  1JQR A;  5HRF A;  3K75 D;  4NY8 A;  4PPX A;  4NXV A;  7ICH A;  5D4B A;  1ZQZ A;  4NLN A;  5CA7 A;  3JYY A;  3UQ2 A;  8ICQ A;  4PGY A;  5IIO A;  4WC3 A;  2BCS A;  4RPZ A;  4PGX A;  8ICJ A;  9ICG A;  4K4H A;  1ZQV A;  1R8A A;  1ZQP A;  4YCX A;  5J2G A;  4K4I A;  4KLT A;  1OU5 A;  5CHG A;  4RQ1 A;  4FHX A;  3HW8 A;  5DDM A;  4EP7 A;  4I2F A;  9ICW A;  4PHE A;  4XA5 A;  4M47 A;  4I2I A;  1ZQA A;  4UAZ A;  4FHV A;  2PBE A;  7ICO A;  5J0T A;  3OVS A;  1R89 A;  5J2K A;  9ICS A;  2PFP A;  1ZQU A;  4IQW A;  2DRB A;  4AT8 B;  4AT7 B;  2M2V A;  4KLH A;  8ICI A;  5TZV A;  4WC5 A;  5DBB A;  4FHY A;  4MFA A;  3OVA A;  3V7K A;  9ICQ A;  9ICJ A;  4ATB A;  5DDY A;  4YMN A;  3RJH A;  4KLS A;  4NXT A;  4MFC A;  1V4A A;  4OAH A;  4I2H A;  4UB5 A;  1ZQI A;  2B51 A;  4PHA A;  4K99 A;  4DOA A;  4WBZ A;  1ZQN A;  4EBJ A;  8ICZ A;  4K4G A;  4RQ0 A;  8ICT A;  2M2W A;  4P4M A;  4TUR A;  3OGU A;  5J0R A;  4KLL A;  3RH4 A;  2BPF A;  5IIN A;  4I2E A;  5DBC A;  4UAY A;  9ICH A;  5HRK A;  4GXK A;  3B0X A;  4YMO A;  4MKP A;  2P66 A;  3JZ0 A;  4X0B A;  4MF8 A;  3RJK A;  4QZI A;  4R64 A;  4X4T A;  4M9N A;  1XSP A;  4E8F A;  4NM1 A;  1MQ2 A;  5DED A;  8ICM A;  5DB6 A;  1ZQT A;  2ZH2 A;  4S3N A;  4K8V A;  3UPS A;  7ICL A;  4P4O A;  1BPE A;  3MGI A;  7ICM A;  1Q78 A;  4X4N A;  4OAG A;  2PFN A;  1MQ3 A;  4RQ5 A;  3OUY A;  1VJ7 A;  9ICC A;  4IG8 A;  4KLM A;  2NRK A;  4WC2 A;  1ZQE A;  3H3A A;  4RQ7 A;  4LZG A;  4X4P A;  4UAW A;  5DB7 A;  4QZD A;  4KM5 A;  5DKW A;  4WCW A;  4RWN A;  4RWQ A;  4O69 A;  5III A;  4M9J A;  4NKT A;  4RWO A;  5BOM A;  4K97 A;  4MFF A;  4WBY A;  4Z6E A;  2M2U A;  4YD2 A;  1WOT A;  1F5A A;  4DO9 A;  2IHM A;  2O5A A;  3WFP A;  7ICK A;  4K98 A;  4FO6 A;  8ICF A;  5HR9 A;  5J2H A;  4F5P A;  4UB4 A;  4LEZ A;  1TFW A;  3MGH A;  9ICE A;  4F5N A;  2DRA A;  4X4U A;  2DR7 A;  3LK9 A;  3AU6 A;  4WOY A;  2VAN A;  3TFS A;  5D49 A;  4UB3 A;  9ICO A;  1ZQH A;  7ICR A;  8ICR A;  4UB1 A;  4UBC A;  1HUZ A;  4AT9 B;  8ICU A;  4XQ7 A;  5HRD A;  3AQN A;  4WC1 A;  1ZQX A;  1HUO A;  1XSN A;  5J2E A;  4UD5 A;  3HJ4 A;  2PXI A;  1ZQD A;  7ICN A;  5DB9 A;  3ISC A;  3C5G A;  3V7L A;  4KLI A;  1TVA A;  4NXU A;  5CB1 A;  1MIW A;  3H39 A;  8ICW A;  4P2H A;  1VFG A;  1ZQB A;  9ICX A;  5HRH A;  2FMS A;  4O5K A;  2ID1 A;  3C2K A;  3MDC A;  4M0A A;  1JMS A;  4LEW A;  4RQ2 A;  9ICM A;  4PHD A;  4OAI Z;  4JWN A;  3WFQ E;  3MDA A;  4NKU A;  4TUQ A;  4I2G A;  3UXN A;  2RFF A;  1ZJN A;  1ZQC A;  2O1P A;  7ICG A;  4F5O A;  4DOC A;  5J0Y A;  4QZB A;  3UXP A;  5CJ7 A;  8ICV A;  1JAJ A;  4RPY A;  5HRE A;  2ISP A;  4ATB B;  4FHP A;  1UEV A;  4UD4 A;  4I27 A;  5J0P A;  5J2I A;  2ZH9 A;  4FHW A;  4X5V A;  2BCU A;  2PFQ A;  7ICT A;  4K96 A;  4M9L A;  3AU2 A;  4MF2 A;  4I2A A;  1KEJ A;  3UPQ A;  8ICH A;  2M2T A;  5HRB A;  5J2J A;  3JPP A;  4X4R A;  4KLJ A;  2ZH6 A;  5HRG A;  3RJE A;  2DR8 A;  4JLZ A;  1ZQQ A;  4XRH A;  4WC7 A;  3C2L A;  4JLX A;  3HWT A;  3AUO A;  9ICK A;  4NXZ A;  2I9G A;  8ICN A;  1KNY A;  8ICP A;  3RJG A;  2ZHA A;  3OV7 A;  7ICE A;  4XQ8 A;  1MIY A;  2BPG A;  3UXO A;  8ICE A;  4F5Q A;  5BOL A;  4UB2 A;  3HJ1 A;  4R66 A;  4KLU A;  5J0S A;  4M9H A;  7ICU A;  4DOB A;  1ZQK A;  5DEC A;  4I29 A;  1RPL A;  4K9B A;  9ICU A;  3C18 A;  1NOM A;  3AQM A;  9ICP A;  4GXJ A;  4KLG A;  3V72 A;  4O5E A;  8ICL A;  3HIY A;  1TFY A;  1XSL A;  4O6A A;  5J0U A;  4RPX A;  5CP2 A;  1KDH A;  4X4S A;  2ZH3 A;  3RJJ A;  4I2B A;  3RH6 A;  5J0X A;  4RQ8 A;  4QZ8 A;  4I2D A;  1MIV A;  4WC0 A;  2ZH4 A;  3OUY B;  5HHI A;  3RJI A;  3C66 A;  3JPO A;  8ICO A;  1PX5 A;  1ZQY A;  4RT3 A;  2W9M A;  2GWS A;  3RJF A;  4AT8 A;  7ICJ A;  4AT7 A;  1BPX A;  3WFR E;  4M04 A;  1R8C A;  5IIM A;  5J2B A;  5J2D A;  1RZT A;  1UET A;  1ZQL A;  4FH5 A;  4PH5 A;  4EBK A;  4LT6 A;  5IIJ A;  2BCQ A;  3H38 A;  1BPY A;  1YLQ A;  3ISD A;  2ZH5 A;  1ZQJ A;  2DR9 A;  5J0Q A;  4Z6D A;  7ICF A;  1ZQM A;  2FMQ A;  4PGQ A;  2BE3 A;  5HRL A;  4XUS A;  3RH5 A;  2B4V A;  7ICQ A;  4I2J A;  2ISO A;  3JPQ A;  2ZHB A;  4IQT A;  4I2C A;  3PML A;  9ICR A;  4TUP A;  5DBA A;  3HX0 A;  4M9G A;  8ICB A;  9ICF A;  9ICL A;  4O67 A;  4NM2 A;  1TV9 A;  1ZQG A;  3NYB A;  3MBY A;  1ZQS A;  5CWR A;  3V7J A;  2BCV A;  2ZH1 A;  1BPD A;  4IQV A;  4QZE A;  3C2M A;  1ZQR A;  5HRI A;  2BCR A;  1Q79 A;  4Z6F A;  4OAF A;  4QZF A;  5IIL A;  4QZH A;  3TFR A;  4F5R A;  2DVI A;  4O68 A;  4E7X A;  5HHH A;  2HHP A;  4P4P A;  1UEU A;  5EOZ A;  4RQ4 A;  3ISB A;  2B56 A;  5J2C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...