4FHVA

Crystal structures of the cid1 poly (u) polymerase reveal the mechanism for utp selectivity - mgctp bound
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
338
structure length
323
Chain Sequence
SHKEFTKFCYEVYNEIKISDKEFKEKRAALDTLRLCLKRISPDAELVAFGSLESGLALKNSDMDLCVLMDSRVQSDTIALQFYEELIAEGFEGKFLQRARIPIIKLTSDTKNGFGASFQCDIGFNNRLAIHNTLLLSSYTKLDARLKPMVLLVKHWAKRKQINSPYFGTLSSYGYVLMVLYYLIHVIKPPVFPNLLLSPLKQEKIVDGFDVGFDDKLEDIPPSQNYSSLGSLLHGFFRFYAYKFEPREKVVTFRRPDGYLTKQEKGWTRYILAIEDPFEISHNVGRTVSSSGLYRIRGEFMAASRLLNSRSYPIPYDSLFEEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the Cid1 poly (U) polymerase reveal the mechanism for UTP selectivity.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transferase
molecule keywords Poly(A) RNA polymerase protein cid1
total genus 109
structure length 323
sequence length 338
ec nomenclature ec 2.7.7.19: Polynucleotide adenylyltransferase.
pdb deposition date 2012-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01909 NTP_transf_2 Nucleotidyltransferase domain
A PF03828 PAP_assoc Cid1 family poly A polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.10 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain Poly(a)-polymerase, middle domain 4fhvA01
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4fhvA02
3GDXA 9ICSA 3ISCA 4I2DA 1UEUA 2ZH8A 4TURA 4YN4A 8ICBA 1ZQVA 2PFNA 3UQ2A 1NO5A 1MIYA 2ZH2A 4AT9B 4JWNA 4IG8A 4O5EA 1ZQIA 4MFFA 9ICTA 4WC4A 8ICCA 4TUPA 1TVAA 5HRGA 1ZQUA 2DVIA 4M2YA 8ICLA 4YD1A 3HWTA 4X4OA 4XRHA 8ICZA 5IILA 3C2MA 3WFQE 3HJ4A 3RJJA 3JPOA 1ZQMA 4GXIA 1KDHA 4IQUA 3ISBA 3RJGA 2ISPA 4WC0A 4WC6A 1ZQBA 5D4BA 4KLTA 7ICFA 7ICHA 4WBZA 5CHGA 8ICMA 3JYYA 5HRLA 1Q78A 2DR9A 2FMPA 3MBYA 1WOTA 2M2WA 4PHDA 2P66A 4YMOA 5J2EA 4WBYA 4KLEA 4QZHA 2B4VA 4UD5A 1BPYA 4I2EA 8ICSA 8ICGA 4F5RA 4PGYA 2BCUA 1R89A 8ICEA 5BPCA 4M5DA 4XUSA 2W9MA 8ICPA 4NLZA 5J2DA 4KLGA 4M47A 1KEJA 4FHXA 3OVBA 2O5AA 3K75D 4RQ6A 3C2KA 4I29A 1ZJMA 4Z6DA 2PFQA 4X5VA 4PHPA 4QZEA 8ICQA 4NKUA 2ZH3A 4PGQA 7ICSA 8ICJA 4X4RA 1RPLA 3TFSA 3TFRA 7ICKA 3C18A 4X4PA 3LQCB 4FHPA 9ICPA 1ZQEA 4M9JA 8ICNA 4PHEA 5J2HA 4O5CA 7ICTA 5J2BA 1BPZA 5CB1A 2BCRA 9ICIA 4O5KA 4XQ7A 1KNYA 4NLNA 1ZQOA 2HHPA 5IIIA 8ICOA 5HRBA 1ZQTA 9ICUA 7ICVA 4X4QA 3HIYA 4RT3A 3JPNA 5EOZA 3LK9A 5TZVA 3C5FA 4E8FA 4KLUA 1FA0A 4KLQA 3B0XA 4GXJA 1ZQAA 3WFSC 2DR7A 1JMSA 4QZDA 1UEVA 3C66A 4WC7A 2ZHAA 2BPCA 5HHHA 4MF2A 4FH3A 2ZH9A 1YLQA 5J2JA 4NKTA 1BPEA 1XSLA 4KLLA 4YMNA 2PBEA 1ZQRA 4ATBA 4Z6CA 2ZH6A 3HW8A 3RJHA 1TV9A 3AQNA 3JPQA 1BPXA 5DKWA 9ICAA 2M2VA 3RH5A 3H38A 5DBBA 2ZHBA 1ZQQA 5J2IA 4PH5A 8ICYA 4WC1A 4QZ8A 4DOBA 4KLHA 1BPDA 3C2LA 2ZH4A 7ICMA 4RPYA 8ICWA 1ZQNA 4I2AA 5DB9A 2BPFA 4QZFA 8ICHA 1Q79A 4E80A 8ICAA 3ISDA 2O1PA 3OVAA 5J0RA 1ZQPA 4LZGA 9ICFA 5J2CA 5J2GA 5CJ7A 1UETA 5J0TA 2Q66A 4UB3A 3HJ1A 2M2UA 4M9NA 7ICJA 3PNCA 4K4GA 1ZQXA 4QZ9A 3AQMA 2FMSA 4UD4A 1ZQGA 3L9DA 4P4PA 4AT7A 8ICVA 8ICTA 4KLFA 3V7LA 4MFAA 5DBCA 1VFGA 9ICKA 4WC3A 2I9GA 4R63A 5J0PA 4RQ0A 4K4IA 4FHWA 4I2GA 4FH5A 5HREA 4DOCA 5HRFA 4P4OA 3OVSA 3H37A 7ICNA 2NRKA 4PPXA 5HC9A 4EBJA 4NM1A 8ICKA 4K4HA 4FHYA 4F5NA 5J0UA 4E7XA 5HRDA 1HUZA 5HR9A 1ZQZA 4AT8A 3UXPA 3JPTA 3UXOA 2M2TA 3OGUA 1ZQDA 4RT2A 4RPXA 4F5OA 1ZQYA 5DECA 4NM2A 7ICLA 5IIOA 2PFPA 1NOMA 4M9HA 4X0BA 4MFCA 5DDMA 9ICWA 4NXZA 4IQWA 4QZGA 3OUYB 5J0QA 9ICHA 4QZBA 4UB4A 3MDCA 3JPRA 1R8CA 4Z6FA 2ID1A 2BPGA 4I2CA 2FMQA 3PMNA 1HUOA 3WFPA 2BE3A 5J0SA 1TFYA 3MDAA 8ICFA 4F5QA 4UB5A 2IHMA 4X4NA 5HRHA 1ZQFA 7ICIA 1MIWA 4TUSA 1ZQHA 5HRIA 4DO9A 3RJFA 5DB8A 9ICVA 4Z6EA 1PX5A 1ZJNA 4XA5A 1ZQCA 4I2IA 4RQ1A 5CR0A 2B51A 1F5AA 1ZQSA 5BOLA 4M9LA 1RZTA 5J0YA 4RQ3A 5IIKA 4UAYA 4UBBA 9ICQA 8ICXA 4RQ4A 4P4MA 4JWMA 8ICRA 3HX0A 2PXIA 5HRKA 5IINA 4NLKA 3C5GA 3UPQA 3JZ0A 7ICPA 4I2FA 4EP7A 7ICRA 4RQ8A 1MQ2A 4X4VA 1R8AA 4QZAA 4IQVA 5J2KA 4MF8A 5J29A 1XSNA 2ZH5A 4EBKA 3JPPA 4I2BA 4M9GA 3H3AA 2ISOA 2BCQA 4I2HA 4O9MA 3V7KA 1BPBA 3RJKA 4M0AA 4UAZA 4AT8B 2ZH7A 5D49A 5IIMA 1OU5A 7ICGA 1ZQKA 3MGHA 4DOAA 1JAJA 3WFOA 4QZCA 4YCXA 1VJ7A 4RWNA 7ICQA 3V72A 4PGXA 4X4UA 5HHIA 4ATBB 5DB7A 5J0WA 4R64A 9ICRA 4XQ8A 1V4AA 1JN3A 3OUYA 2ZH1A 5IIJA 5J2FA 4I2JA 5DDYA 1MQ3A 3WFRE 4P2HA 4WCWA 5CA7A 4KLDA 1JQRA 4WC2A 2GWSA 1ZQLA 9ICOA 1XSPA 3H39A 4RWQA 8ICUA 4LZDA 3AU6A 3AUOA 3OV7A 3AQKA 5CWRA 4X4TA 9ICCA 5DBAA 4PHAA 3NYBA 4YD2A 2RFFA 4KLMA 5DEDA 4RQ5A 4X4SA 3RH4A 9ICXA 3RJEA 5F2VO 4R65A 3MGIA 9ICNA 4M04A 9ICBA 3UXNA 2BCSA 7ICOA 3AQLA 9ICGA 4X0AA 8ICIA 3PMLA 4GXKA 4RQ2A 2DR8A 2BCVA 3AU2A 4UBCA 4RWPA 4R66A 4TUQA 9ICJA 4KLJA 4AT7B 3UQ0A 4KLIA 5DB6A 5J2AA 4FHVA 3RJIA 2VANA 4RWOA 9ICLA 4RQ7A 2DR5A 2PFOA 4LVSA 4UB1A 9ICEA 4QZIA 7ICUA 4IQTA 4RPZA 4WC5A 5CP2A 5D46A 4YMMA 1TFWA 3RH6A 4I28A 4KLSA 5BOMA 9ICMA 4UAWA 1ZQWA 3V7JA 2DRAA 3UPSA 1ZQJA 4F5PA 4NY8A 5J0XA 4KLOA 3JPSA 4I27A 4AT9A 1R8BA 4LT6A 5J0OA 4S3NA 4FO6A 7ICEA 2B56A 1MIVA 3B0YA 4UB2A 2DRBA
chains in the Genus database with same CATH superfamily
4I0UA 3GDXA 9ICSA 3ISCA 4I2DA 1UEUA 2ZH8A 4TURA 4YN4A 8ICBA 4K9BA 1ZQVA 2PFNA 4EGWA 3UQ2A 1NO5A 1MIYA 2ZH2A 4AT9B 4IG8A 4JWNA 4O5EA 1ZQIA 4MFFA 9ICTA 4WC4A 8ICCA 4TUPA 1TVAA 5CFTA 5HRGA 2DVIA 1ZQUA 4M2YA 8ICLA 4YD1A 3HWTA 5B3PA 3NVOA 4X4OA 4XRHA 8ICZA 5IILA 3C2MA 3WFQE 3HJ4A 3RJJA 3JPOA 4HX0A 4LEVA 1ZQMA 4GXIA 1KDHA 4IQUA 3ISBA 3RJGA 2ISPA 4WC0A 4WC6A 1ZQBA 5D4BA 4KLTA 7ICFA 7ICHA 4WBZA 5CHGA 8ICMA 3K7DA 3JYYA 5HRLA 1Q78A 2DR9A 2FMPA 3MBYA 1WOTA 2M2WA 4PHDA 2P66A 4YMOA 5J2EA 4LEZA 4EV6A 4WBYA 4KLEA 4QZHA 2B4VA 4UD5A 1BPYA 4I2EA 8ICSA 8ICGA 4F5RA 4PGYA 2BCUA 1R89A 8ICEA 5BPCA 4XUSA 4M5DA 2W9MA 8ICPA 4NLZA 5J2DA 4KLGA 4M47A 1KEJA 4FHXA 5JTGA 3OVBA 2O5AA 3K75D 4RQ6A 3C2KA 4I29A 1ZJMA 4Z6DA 2PFQA 4X5VA 4PHPA 4QZEA 8ICQA 4NKUA 3ERCC 2ZH3A 4PGQA 7ICSA 8ICJA 4X4RA 1RPLA 3TFSA 3TFRA 7ICKA 3C18A 4X4PA 3LQCB 4FHPA 9ICPA 1ZQEA 3ER9B 4M9JA 8ICNA 4PHEA 5D61A 4O6AA 5J2HA 4O5CA 7ICTA 5J2BA 1BPZA 5CB1A 2BCRA 9ICIA 4O5KA 4XQ7A 4NXWA 1KNYA 4NLNA 1ZQOA 2HHPA 5D63A 5IIIA 8ICOA 5HRBA 1ZQTA 9ICUA 7ICVA 4X4QA 3HIYA 4NXXA 4RT3A 3JPNA 5EOZA 3LK9A 4K99A 5TZVA 3C5FA 4E8FA 4KLUA 1FA0A 4KLQA 3B0XA 4GXJA 1ZQAA 3NWIA 3WFSC 2DR7A 1JMSA 4QZDA 1UEVA 3C66A 4KB6A 2ZHAA 4WC7A 2BPCA 5HHHA 4MF2A 4FH3A 2ZH9A 1YLQA 5J2JA 4O69A 4NKTA 1BPEA 1XSLA 4KLLA 4YMNA 2PBEA 4WQKA 1ZQRA 4ATBA 4Z6CA 2ZH6A 3HW8A 3RJHA 1TV9A 3AQNA 3JPQA 4NXUA 1BPXA 5DKWA 9ICAA 2M2VA 3RH5A 2ZHBA 3H38A 5DBBA 1ZQQA 5J2IA 4PH5A 8ICYA 3PHZA 4WC1A 4QZ8A 4DOBA 4KLHA 1BPDA 3C2LA 2ZH4A 4NXTA 7ICMA 4RPYA 8ICWA 1ZQNA 4I2AA 5DB9A 2BPFA 4QZFA 8ICHA 1Q79A 4E80A 8ICAA 3ISDA 2O1PA 4K97A 3OVAA 3CK6A 5J0RA 1ZQPA 4LZGA 9ICFA 5J2CA 5J2GA 4O67A 5CJ7A 1UETA 4EEBA 5J0TA 2Q66A 4UB3A 3HJ1A 2M2UA 4M9NA 7ICJA 3PNCA 4K4GA 1ZQXA 4QZ9A 3AQMA 2FMSA 4UD4A 1ZQGA 3L9DA 2GAFD 3MCRA 4P4PA 4AT7A 4NXVA 8ICVA 8ICTA 4KLFA 3V7LA 4MFAA 5DBCA 1VFGA 9ICKA 4WC3A 2I9GA 4R63A 5J0PA 4RQ0A 4K4IA 4FHWA 4I2GA 4FH5A 4OAHA 5HREA 4DOCA 5HRFA 4JLXA 3OVSA 4P4OA 3H37A 7ICNA 2NRKA 4PPXA 5HC9A 4EBJA 4NM1A 8ICKA 4K4HA 4FHYA 4F5NA 5J0UA 4E7XA 5HRDA 4K8VA 1HUZA 5HR9A 4WOYA 1ZQZA 4AT8A 3UXPA 3JPTA 3UXOA 2M2TA 3OGUA 1ZQDA 4RT2A 4RPXA 4F5OA 1ZQYA 5DECA 4NM2A 7ICLA 5IIOA 2PFPA 1NOMA 4M9HA 4X0BA 4MFCA 5DDMA 9ICWA 4K9AA 4K96A 4NXZA 4IQWA 4QZGA 3OUYB 5J0QA 4KM5A 9ICHA 4QZBA 4EEDA 4UB4A 3MDCA 3JPRA 1R8CA 4Z6FA 5D62A 2ID1A 2BPGA 4I2CA 2FCLA 2FMQA 3PMNA 1HUOA 3WFPA 2BE3A 5J0SA 1TFYA 5CHEA 3MDAA 8ICFA 4F5QA 4UB5A 2IHMA 4X4NA 5HRHA 1ZQFA 7ICIA 1MIWA 4TUSA 1ZQHA 5HRIA 4DO9A 4OAIZ 3RJFA 5DB8A 9ICVA 4LEWA 1PX5A 2HN1A 4WH5A 4Z6EA 1ZJNA 4XA5A 1ZQCA 4I2IA 4RQ1A 5CR0A 2B51A 1F5AA 1ZQSA 4WQLA 2BBJA 5BOLA 4M9LA 5CFUA 1RZTA 5J0YA 3ER8C 4RQ3A 5IIKA 4UAYA 4UBBA 9ICQA 8ICXA 4RQ4A 4P4MA 4JWMA 4MKPA 2BBHA 8ICRA 3HX0A 2PXIA 5HRKA 4LEYA 5IINA 4NLKA 3C5GA 3UPQA 3JZ0A 7ICPA 4I2FA 4EP7A 7ICRA 2HN2A 4RQ8A 1MQ2A 4X4VA 1R8AA 4QZAA 4IQVA 5J2KA 4MF8A 5J29A 1XSNA 2ZH5A 4EBKA 4JLZA 3JPPA 4I2BA 3JCFA 4M9GA 3H3AA 2ISOA 2BCQA 4I2HA 4O9MA 3V7KA 1BPBA 3RJKA 4M0AA 4AT8B 4UAZA 2ZH7A 5D49A 5IIMA 1OU5A 7ICGA 1ZQKA 3MGHA 4DOAA 1JAJA 2IHOA 3WFOA 4QZCA 4YCXA 1VJ7A 2GA9D 4RWNA 4N7RA 7ICQA 3V72A 4PGXA 4XJEA 4X4UA 5HHIA 4ATBB 5DB7A 5J0WA 4R64A 9ICRA 4XQ8A 1V4AA 4FO1A 1JN3A 3OUYA 2ZH1A 5IIJA 5J2FA 4I2JA 5DDYA 1MQ3A 3WFRE 4P2HA 4WCWA 5CA7A 4KLDA 1JQRA 1GPJA 4WC2A 2GWSA 1ZQLA 9ICOA 1XSPA 3H39A 4RWQA 8ICUA 4LZDA 3AU6A 3AUOA 3OV7A 3AQKA 5CWRA 4X4TA 9ICCA 5DBAA 4PHAA 3NYBA 2EWRA 2RFFA 4YD2A 4KLMA 4X4SA 5DEDA 4RQ5A 4OAFA 3RH4A 9ICXA 3RJEA 5F2VO 4R65A 3MGIA 9ICNA 4M04A 9ICBA 3UXNA 2BCSA 7ICOA 3AQLA 9ICGA 4X0AA 8ICIA 3PMLA 4GXKA 2DR8A 3NKUA 4RQ2A 3OWGA 2BCVA 3AU2A 4UBCA 4RWPA 4R66A 4TUQA 9ICJA 4KLJA 4AT7B 3UQ0A 4KLIA 5DB6A 5B3QA 5J2AA 4FHVA 3RJIA 4RWOA 2VANA 9ICLA 2DR5A 4RQ7A 2PFOA 4LVSA 4K98A 4UB1A 4QZIA 9ICEA 7ICUA 4IQTA 4RPZA 4WC5A 5CP2A 4OAGA 5D46A 4YMMA 1TFWA 3RH6A 4I28A 4KLSA 2IUBA 5BOMA 9ICMA 4UAWA 1ZQWA 4O68A 2DRAA 3V7JA 3UPSA 1ZQJA 4F5PA 4NY8A 5J0XA 4KLOA 3EF2A 3JPSA 4I27A 4AT9A 1R8BA 4LT6A 5CFSA 5J0OA 4S3NA 4FO6A 7ICEA 2B56A 1MIVA 3B0YA 4UB2A 2DRBA
chains in the Genus database with same CATH topology
3GDXA 9ICSA 3ISCA 4I2DA 1UEUA 2ZH8A 4TURA 4YN4A 8ICBA 4K9BA 1ZQVA 2PFNA 3UQ2A 1NO5A 1MIYA 2ZH2A 4AT9B 4JWNA 4IG8A 4O5EA 1ZQIA 4MFFA 9ICTA 4WC4A 8ICCA 4TUPA 1TVAA 5HRGA 2DVIA 1ZQUA 4M2YA 8ICLA 4YD1A 3HWTA 4X4OA 4XRHA 8ICZA 5IILA 3C2MA 3WFQE 3HJ4A 3RJJA 3JPOA 4LEVA 1ZQMA 4GXIA 1KDHA 4IQUA 3ISBA 3RJGA 2ISPA 4WC0A 4WC6A 1ZQBA 5D4BA 4KLTA 7ICFA 7ICHA 4WBZA 5CHGA 8ICMA 3JYYA 5HRLA 1Q78A 2DR9A 2FMPA 3MBYA 1WOTA 2M2WA 4PHDA 2P66A 4YMOA 5J2EA 4LEZA 4WBYA 4KLEA 4QZHA 2B4VA 4UD5A 1BPYA 4I2EA 8ICSA 8ICGA 4F5RA 4PGYA 2BCUA 1R89A 8ICEA 5BPCA 4M5DA 4XUSA 2W9MA 8ICPA 4NLZA 5J2DA 4KLGA 4M47A 1KEJA 4FHXA 3OVBA 2O5AA 3K75D 4RQ6A 3C2KA 4I29A 1ZJMA 4Z6DA 2PFQA 4X5VA 4PHPA 4QZEA 8ICQA 4NKUA 2ZH3A 4PGQA 7ICSA 8ICJA 4X4RA 1RPLA 3TFSA 3TFRA 7ICKA 3C18A 4X4PA 3LQCB 4FHPA 9ICPA 1ZQEA 4M9JA 8ICNA 4PHEA 4O6AA 5J2HA 4O5CA 7ICTA 5J2BA 1BPZA 5CB1A 2BCRA 9ICIA 4O5KA 4XQ7A 4NXWA 1KNYA 4NLNA 1ZQOA 2HHPA 5IIIA 8ICOA 5HRBA 1ZQTA 9ICUA 7ICVA 4X4QA 3HIYA 4NXXA 4RT3A 3JPNA 5EOZA 3LK9A 4K99A 5TZVA 3C5FA 4E8FA 4KLUA 1FA0A 4KLQA 3B0XA 4GXJA 1ZQAA 3WFSC 2DR7A 1JMSA 4QZDA 1UEVA 3C66A 4KB6A 2ZHAA 4WC7A 2BPCA 5HHHA 4MF2A 4FH3A 2ZH9A 1YLQA 5J2JA 4O69A 4NKTA 1BPEA 1XSLA 4KLLA 4YMNA 2PBEA 1ZQRA 4ATBA 4Z6CA 2ZH6A 3HW8A 3RJHA 1TV9A 3AQNA 3JPQA 4NXUA 1BPXA 5DKWA 9ICAA 2M2VA 3RH5A 2ZHBA 3H38A 5DBBA 1ZQQA 5J2IA 4PH5A 8ICYA 4WC1A 4QZ8A 4DOBA 4KLHA 1BPDA 3C2LA 2ZH4A 4NXTA 7ICMA 4RPYA 8ICWA 1ZQNA 4I2AA 5DB9A 2BPFA 4QZFA 8ICHA 1Q79A 4E80A 8ICAA 3ISDA 2O1PA 4K97A 3OVAA 5J0RA 1ZQPA 4LZGA 9ICFA 5J2CA 5J2GA 4O67A 5CJ7A 1UETA 5J0TA 2Q66A 4UB3A 3HJ1A 2M2UA 4M9NA 7ICJA 3PNCA 4K4GA 1ZQXA 4QZ9A 3AQMA 2FMSA 4UD4A 1ZQGA 3L9DA 4P4PA 4AT7A 4NXVA 8ICVA 8ICTA 4KLFA 3V7LA 4MFAA 5DBCA 1VFGA 9ICKA 4WC3A 2I9GA 4R63A 5J0PA 4RQ0A 4K4IA 4FHWA 4I2GA 4FH5A 4OAHA 5HREA 4DOCA 5HRFA 4JLXA 3OVSA 4P4OA 3H37A 7ICNA 2NRKA 4PPXA 5HC9A 4EBJA 4NM1A 8ICKA 4K4HA 4FHYA 4F5NA 5J0UA 4E7XA 5HRDA 4K8VA 1HUZA 5HR9A 4WOYA 1ZQZA 4AT8A 3UXPA 3JPTA 3UXOA 2M2TA 3OGUA 1ZQDA 4RT2A 4RPXA 4F5OA 1ZQYA 5DECA 4NM2A 7ICLA 5IIOA 2PFPA 1NOMA 4M9HA 4X0BA 4MFCA 5DDMA 9ICWA 4K9AA 4K96A 4NXZA 4IQWA 4QZGA 3OUYB 5J0QA 4KM5A 9ICHA 4QZBA 4UB4A 3MDCA 3JPRA 1R8CA 4Z6FA 2ID1A 2BPGA 4I2CA 2FMQA 3PMNA 1HUOA 3WFPA 2BE3A 5J0SA 1TFYA 3MDAA 8ICFA 4F5QA 4UB5A 2IHMA 4X4NA 5HRHA 1ZQFA 7ICIA 1MIWA 4TUSA 1ZQHA 5HRIA 4DO9A 4OAIZ 3RJFA 5DB8A 9ICVA 4LEWA 1PX5A 4Z6EA 1ZJNA 4XA5A 1ZQCA 4I2IA 4RQ1A 5CR0A 2B51A 1F5AA 1ZQSA 5BOLA 4M9LA 1RZTA 5J0YA 4RQ3A 5IIKA 4UAYA 4UBBA 9ICQA 8ICXA 4RQ4A 4P4MA 4JWMA 4MKPA 8ICRA 3HX0A 2PXIA 5HRKA 4LEYA 5IINA 4NLKA 3C5GA 3UPQA 3JZ0A 7ICPA 4I2FA 4EP7A 7ICRA 4RQ8A 1MQ2A 4X4VA 1R8AA 4QZAA 4IQVA 5J2KA 4MF8A 5J29A 1XSNA 2ZH5A 4EBKA 4JLZA 3JPPA 4I2BA 4M9GA 3H3AA 2ISOA 2BCQA 4I2HA 4O9MA 3V7KA 1BPBA 3RJKA 4M0AA 4UAZA 4AT8B 2ZH7A 5D49A 5IIMA 1OU5A 7ICGA 1ZQKA 3MGHA 4DOAA 1JAJA 3WFOA 4QZCA 4YCXA 1VJ7A 4RWNA 7ICQA 3V72A 4PGXA 4X4UA 5HHIA 4ATBB 5DB7A 5J0WA 4R64A 9ICRA 4XQ8A 1V4AA 1JN3A 3OUYA 2ZH1A 5IIJA 5J2FA 4I2JA 5DDYA 1MQ3A 3WFRE 4P2HA 4WCWA 5CA7A 4KLDA 1JQRA 4WC2A 2GWSA 1ZQLA 9ICOA 1XSPA 3H39A 4RWQA 8ICUA 4LZDA 3AU6A 3AUOA 3OV7A 3AQKA 5CWRA 4X4TA 9ICCA 5DBAA 4PHAA 3NYBA 4YD2A 2RFFA 4KLMA 4X4SA 5DEDA 4RQ5A 4OAFA 3RH4A 9ICXA 3RJEA 5F2VO 4R65A 3MGIA 9ICNA 4M04A 9ICBA 3UXNA 2BCSA 7ICOA 3AQLA 9ICGA 4X0AA 8ICIA 3PMLA 4GXKA 2DR8A 4RQ2A 2BCVA 3AU2A 4UBCA 4RWPA 4R66A 4TUQA 9ICJA 4KLJA 4AT7B 3UQ0A 4KLIA 5DB6A 5J2AA 4FHVA 3RJIA 2VANA 4RWOA 9ICLA 2DR5A 4RQ7A 2PFOA 4LVSA 4K98A 4UB1A 4QZIA 9ICEA 7ICUA 4IQTA 4RPZA 4WC5A 5CP2A 4OAGA 5D46A 4YMMA 1TFWA 3RH6A 4I28A 4KLSA 5BOMA 9ICMA 4UAWA 1ZQWA 4O68A 2DRAA 3V7JA 3UPSA 1ZQJA 4F5PA 4NY8A 5J0XA 4KLOA 3JPSA 4I27A 4AT9A 1R8BA 4LT6A 5J0OA 4S3NA 4FO6A 7ICEA 2B56A 1MIVA 3B0YA 4UB2A 2DRBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GDX A;  9ICS A;  3ISC A;  4I2D A;  1UEU A;  2ZH8 A;  4TUR A;  4YN4 A;  8ICB A;  1ZQV A;  2PFN A;  3UQ2 A;  1NO5 A;  1MIY A;  2ZH2 A;  4AT9 B;  4JWN A;  4IG8 A;  4O5E A;  1ZQI A;  4MFF A;  9ICT A;  4WC4 A;  8ICC A;  4TUP A;  1TVA A;  5HRG A;  1ZQU A;  2DVI A;  4M2Y A;  8ICL A;  4YD1 A;  3HWT A;  4X4O A;  4XRH A;  8ICZ A;  5IIL A;  3C2M A;  3WFQ E;  3HJ4 A;  3RJJ A;  3JPO A;  1ZQM A;  4GXI A;  1KDH A;  4IQU A;  3ISB A;  3RJG A;  2ISP A;  4WC0 A;  4WC6 A;  1ZQB A;  5D4B A;  4KLT A;  7ICF A;  7ICH A;  4WBZ A;  5CHG A;  8ICM A;  3JYY A;  5HRL A;  1Q78 A;  2DR9 A;  2FMP A;  3MBY A;  1WOT A;  2M2W A;  4PHD A;  2P66 A;  4YMO A;  5J2E A;  4WBY A;  4KLE A;  4QZH A;  2B4V A;  4UD5 A;  1BPY A;  4I2E A;  8ICS A;  8ICG A;  4F5R A;  4PGY A;  2BCU A;  1R89 A;  8ICE A;  5BPC A;  4M5D A;  4XUS A;  2W9M A;  8ICP A;  4NLZ A;  5J2D A;  4KLG A;  4M47 A;  1KEJ A;  4FHX A;  3OVB A;  2O5A A;  3K75 D;  4RQ6 A;  3C2K A;  4I29 A;  1ZJM A;  4Z6D A;  2PFQ A;  4X5V A;  4PHP A;  4QZE A;  8ICQ A;  4NKU A;  2ZH3 A;  4PGQ A;  7ICS A;  8ICJ A;  4X4R A;  1RPL A;  3TFS A;  3TFR A;  7ICK A;  3C18 A;  4X4P A;  3LQC B;  4FHP A;  9ICP A;  1ZQE A;  4M9J A;  8ICN A;  4PHE A;  5J2H A;  4O5C A;  7ICT A;  5J2B A;  1BPZ A;  5CB1 A;  2BCR A;  9ICI A;  4O5K A;  4XQ7 A;  1KNY A;  4NLN A;  1ZQO A;  2HHP A;  5III A;  8ICO A;  5HRB A;  1ZQT A;  9ICU A;  7ICV A;  4X4Q A;  3HIY A;  4RT3 A;  3JPN A;  5EOZ A;  3LK9 A;  5TZV A;  3C5F A;  4E8F A;  4KLU A;  1FA0 A;  4KLQ A;  3B0X A;  4GXJ A;  1ZQA A;  3WFS C;  2DR7 A;  1JMS A;  4QZD A;  1UEV A;  3C66 A;  4WC7 A;  2ZHA A;  2BPC A;  5HHH A;  4MF2 A;  4FH3 A;  2ZH9 A;  1YLQ A;  5J2J A;  4NKT A;  1BPE A;  1XSL A;  4KLL A;  4YMN A;  2PBE A;  1ZQR A;  4ATB A;  4Z6C A;  2ZH6 A;  3HW8 A;  3RJH A;  1TV9 A;  3AQN A;  3JPQ A;  1BPX A;  5DKW A;  9ICA A;  2M2V A;  3RH5 A;  3H38 A;  5DBB A;  2ZHB A;  1ZQQ A;  5J2I A;  4PH5 A;  8ICY A;  4WC1 A;  4QZ8 A;  4DOB A;  4KLH A;  1BPD A;  3C2L A;  2ZH4 A;  7ICM A;  4RPY A;  8ICW A;  1ZQN A;  4I2A A;  5DB9 A;  2BPF A;  4QZF A;  8ICH A;  1Q79 A;  4E80 A;  8ICA A;  3ISD A;  2O1P A;  3OVA A;  5J0R A;  1ZQP A;  4LZG A;  9ICF A;  5J2C A;  5J2G A;  5CJ7 A;  1UET A;  5J0T A;  2Q66 A;  4UB3 A;  3HJ1 A;  2M2U A;  4M9N A;  7ICJ A;  3PNC A;  4K4G A;  1ZQX A;  4QZ9 A;  3AQM A;  2FMS A;  4UD4 A;  1ZQG A;  3L9D A;  4P4P A;  4AT7 A;  8ICV A;  8ICT A;  4KLF A;  3V7L A;  4MFA A;  5DBC A;  1VFG A;  9ICK A;  4WC3 A;  2I9G A;  4R63 A;  5J0P A;  4RQ0 A;  4K4I A;  4FHW A;  4I2G A;  4FH5 A;  5HRE A;  4DOC A;  5HRF A;  4P4O A;  3OVS A;  3H37 A;  7ICN A;  2NRK A;  4PPX A;  5HC9 A;  4EBJ A;  4NM1 A;  8ICK A;  4K4H A;  4FHY A;  4F5N A;  5J0U A;  4E7X A;  5HRD A;  1HUZ A;  5HR9 A;  1ZQZ A;  4AT8 A;  3UXP A;  3JPT A;  3UXO A;  2M2T A;  3OGU A;  1ZQD A;  4RT2 A;  4RPX A;  4F5O A;  1ZQY A;  5DEC A;  4NM2 A;  7ICL A;  5IIO A;  2PFP A;  1NOM A;  4M9H A;  4X0B A;  4MFC A;  5DDM A;  9ICW A;  4NXZ A;  4IQW A;  4QZG A;  3OUY B;  5J0Q A;  9ICH A;  4QZB A;  4UB4 A;  3MDC A;  3JPR A;  1R8C A;  4Z6F A;  2ID1 A;  2BPG A;  4I2C A;  2FMQ A;  3PMN A;  1HUO A;  3WFP A;  2BE3 A;  5J0S A;  1TFY A;  3MDA A;  8ICF A;  4F5Q A;  4UB5 A;  2IHM A;  4X4N A;  5HRH A;  1ZQF A;  7ICI A;  1MIW A;  4TUS A;  1ZQH A;  5HRI A;  4DO9 A;  3RJF A;  5DB8 A;  9ICV A;  4Z6E A;  1PX5 A;  1ZJN A;  4XA5 A;  1ZQC A;  4I2I A;  4RQ1 A;  5CR0 A;  2B51 A;  1F5A A;  1ZQS A;  5BOL A;  4M9L A;  1RZT A;  5J0Y A;  4RQ3 A;  5IIK A;  4UAY A;  4UBB A;  9ICQ A;  8ICX A;  4RQ4 A;  4P4M A;  4JWM A;  8ICR A;  3HX0 A;  2PXI A;  5HRK A;  5IIN A;  4NLK A;  3C5G A;  3UPQ A;  3JZ0 A;  7ICP A;  4I2F A;  4EP7 A;  7ICR A;  4RQ8 A;  1MQ2 A;  4X4V A;  1R8A A;  4QZA A;  4IQV A;  5J2K A;  4MF8 A;  5J29 A;  1XSN A;  2ZH5 A;  4EBK A;  3JPP A;  4I2B A;  4M9G A;  3H3A A;  2ISO A;  2BCQ A;  4I2H A;  4O9M A;  3V7K A;  1BPB A;  3RJK A;  4M0A A;  4UAZ A;  4AT8 B;  2ZH7 A;  5D49 A;  5IIM A;  1OU5 A;  7ICG A;  1ZQK A;  3MGH A;  4DOA A;  1JAJ A;  3WFO A;  4QZC A;  4YCX A;  1VJ7 A;  4RWN A;  7ICQ A;  3V72 A;  4PGX A;  4X4U A;  5HHI A;  4ATB B;  5DB7 A;  5J0W A;  4R64 A;  9ICR A;  4XQ8 A;  1V4A A;  1JN3 A;  3OUY A;  2ZH1 A;  5IIJ A;  5J2F A;  4I2J A;  5DDY A;  1MQ3 A;  3WFR E;  4P2H A;  4WCW A;  5CA7 A;  4KLD A;  1JQR A;  4WC2 A;  2GWS A;  1ZQL A;  9ICO A;  1XSP A;  3H39 A;  4RWQ A;  8ICU A;  4LZD A;  3AU6 A;  3AUO A;  3OV7 A;  3AQK A;  5CWR A;  4X4T A;  9ICC A;  5DBA A;  4PHA A;  3NYB A;  4YD2 A;  2RFF A;  4KLM A;  5DED A;  4RQ5 A;  4X4S A;  3RH4 A;  9ICX A;  3RJE A;  5F2V O;  4R65 A;  3MGI A;  9ICN A;  4M04 A;  9ICB A;  3UXN A;  2BCS A;  7ICO A;  3AQL A;  9ICG A;  4X0A A;  8ICI A;  3PML A;  4GXK A;  4RQ2 A;  2DR8 A;  2BCV A;  3AU2 A;  4UBC A;  4RWP A;  4R66 A;  4TUQ A;  9ICJ A;  4KLJ A;  4AT7 B;  3UQ0 A;  4KLI A;  5DB6 A;  5J2A A;  4FHV A;  3RJI A;  2VAN A;  4RWO A;  9ICL A;  4RQ7 A;  2DR5 A;  2PFO A;  4LVS A;  4UB1 A;  9ICE A;  4QZI A;  7ICU A;  4IQT A;  4RPZ A;  4WC5 A;  5CP2 A;  5D46 A;  4YMM A;  1TFW A;  3RH6 A;  4I28 A;  4KLS A;  5BOM A;  9ICM A;  4UAW A;  1ZQW A;  3V7J A;  2DRA A;  3UPS A;  1ZQJ A;  4F5P A;  4NY8 A;  5J0X A;  4KLO A;  3JPS A;  4I27 A;  4AT9 A;  1R8B A;  4LT6 A;  5J0O A;  4S3N A;  4FO6 A;  7ICE A;  2B56 A;  1MIV A;  3B0Y A;  4UB2 A;  2DRB A; 
#chains in the Genus database with same CATH topology
 4I0U A;  3GDX A;  9ICS A;  3ISC A;  4I2D A;  1UEU A;  2ZH8 A;  4TUR A;  4YN4 A;  8ICB A;  4K9B A;  1ZQV A;  2PFN A;  4EGW A;  3UQ2 A;  1NO5 A;  1MIY A;  2ZH2 A;  4AT9 B;  4IG8 A;  4JWN A;  4O5E A;  1ZQI A;  4MFF A;  9ICT A;  4WC4 A;  8ICC A;  4TUP A;  1TVA A;  5CFT A;  5HRG A;  2DVI A;  1ZQU A;  4M2Y A;  8ICL A;  4YD1 A;  3HWT A;  5B3P A;  3NVO A;  4X4O A;  4XRH A;  8ICZ A;  5IIL A;  3C2M A;  3WFQ E;  3HJ4 A;  3RJJ A;  3JPO A;  4HX0 A;  4LEV A;  1ZQM A;  4GXI A;  1KDH A;  4IQU A;  3ISB A;  3RJG A;  2ISP A;  4WC0 A;  4WC6 A;  1ZQB A;  5D4B A;  4KLT A;  7ICF A;  7ICH A;  4WBZ A;  5CHG A;  8ICM A;  3K7D A;  3JYY A;  5HRL A;  1Q78 A;  2DR9 A;  2FMP A;  3MBY A;  1WOT A;  2M2W A;  4PHD A;  2P66 A;  4YMO A;  5J2E A;  4LEZ A;  4EV6 A;  4WBY A;  4KLE A;  4QZH A;  2B4V A;  4UD5 A;  1BPY A;  4I2E A;  8ICS A;  8ICG A;  4F5R A;  4PGY A;  2BCU A;  1R89 A;  8ICE A;  5BPC A;  4XUS A;  4M5D A;  2W9M A;  8ICP A;  4NLZ A;  5J2D A;  4KLG A;  4M47 A;  1KEJ A;  4FHX A;  5JTG A;  3OVB A;  2O5A A;  3K75 D;  4RQ6 A;  3C2K A;  4I29 A;  1ZJM A;  4Z6D A;  2PFQ A;  4X5V A;  4PHP A;  4QZE A;  8ICQ A;  4NKU A;  3ERC C;  2ZH3 A;  4PGQ A;  7ICS A;  8ICJ A;  4X4R A;  1RPL A;  3TFS A;  3TFR A;  7ICK A;  3C18 A;  4X4P A;  3LQC B;  4FHP A;  9ICP A;  1ZQE A;  3ER9 B;  4M9J A;  8ICN A;  4PHE A;  5D61 A;  4O6A A;  5J2H A;  4O5C A;  7ICT A;  5J2B A;  1BPZ A;  5CB1 A;  2BCR A;  9ICI A;  4O5K A;  4XQ7 A;  4NXW A;  1KNY A;  4NLN A;  1ZQO A;  2HHP A;  5D63 A;  5III A;  8ICO A;  5HRB A;  1ZQT A;  9ICU A;  7ICV A;  4X4Q A;  3HIY A;  4NXX A;  4RT3 A;  3JPN A;  5EOZ A;  3LK9 A;  4K99 A;  5TZV A;  3C5F A;  4E8F A;  4KLU A;  1FA0 A;  4KLQ A;  3B0X A;  4GXJ A;  1ZQA A;  3NWI A;  3WFS C;  2DR7 A;  1JMS A;  4QZD A;  1UEV A;  3C66 A;  4KB6 A;  2ZHA A;  4WC7 A;  2BPC A;  5HHH A;  4MF2 A;  4FH3 A;  2ZH9 A;  1YLQ A;  5J2J A;  4O69 A;  4NKT A;  1BPE A;  1XSL A;  4KLL A;  4YMN A;  2PBE A;  4WQK A;  1ZQR A;  4ATB A;  4Z6C A;  2ZH6 A;  3HW8 A;  3RJH A;  1TV9 A;  3AQN A;  3JPQ A;  4NXU A;  1BPX A;  5DKW A;  9ICA A;  2M2V A;  3RH5 A;  2ZHB A;  3H38 A;  5DBB A;  1ZQQ A;  5J2I A;  4PH5 A;  8ICY A;  3PHZ A;  4WC1 A;  4QZ8 A;  4DOB A;  4KLH A;  1BPD A;  3C2L A;  2ZH4 A;  4NXT A;  7ICM A;  4RPY A;  8ICW A;  1ZQN A;  4I2A A;  5DB9 A;  2BPF A;  4QZF A;  8ICH A;  1Q79 A;  4E80 A;  8ICA A;  3ISD A;  2O1P A;  4K97 A;  3OVA A;  3CK6 A;  5J0R A;  1ZQP A;  4LZG A;  9ICF A;  5J2C A;  5J2G A;  4O67 A;  5CJ7 A;  1UET A;  4EEB A;  5J0T A;  2Q66 A;  4UB3 A;  3HJ1 A;  2M2U A;  4M9N A;  7ICJ A;  3PNC A;  4K4G A;  1ZQX A;  4QZ9 A;  3AQM A;  2FMS A;  4UD4 A;  1ZQG A;  3L9D A;  2GAF D;  3MCR A;  4P4P A;  4AT7 A;  4NXV A;  8ICV A;  8ICT A;  4KLF A;  3V7L A;  4MFA A;  5DBC A;  1VFG A;  9ICK A;  4WC3 A;  2I9G A;  4R63 A;  5J0P A;  4RQ0 A;  4K4I A;  4FHW A;  4I2G A;  4FH5 A;  4OAH A;  5HRE A;  4DOC A;  5HRF A;  4JLX A;  3OVS A;  4P4O A;  3H37 A;  7ICN A;  2NRK A;  4PPX A;  5HC9 A;  4EBJ A;  4NM1 A;  8ICK A;  4K4H A;  4FHY A;  4F5N A;  5J0U A;  4E7X A;  5HRD A;  4K8V A;  1HUZ A;  5HR9 A;  4WOY A;  1ZQZ A;  4AT8 A;  3UXP A;  3JPT A;  3UXO A;  2M2T A;  3OGU A;  1ZQD A;  4RT2 A;  4RPX A;  4F5O A;  1ZQY A;  5DEC A;  4NM2 A;  7ICL A;  5IIO A;  2PFP A;  1NOM A;  4M9H A;  4X0B A;  4MFC A;  5DDM A;  9ICW A;  4K9A A;  4K96 A;  4NXZ A;  4IQW A;  4QZG A;  3OUY B;  5J0Q A;  4KM5 A;  9ICH A;  4QZB A;  4EED A;  4UB4 A;  3MDC A;  3JPR A;  1R8C A;  4Z6F A;  5D62 A;  2ID1 A;  2BPG A;  4I2C A;  2FCL A;  2FMQ A;  3PMN A;  1HUO A;  3WFP A;  2BE3 A;  5J0S A;  1TFY A;  5CHE A;  3MDA A;  8ICF A;  4F5Q A;  4UB5 A;  2IHM A;  4X4N A;  5HRH A;  1ZQF A;  7ICI A;  1MIW A;  4TUS A;  1ZQH A;  5HRI A;  4DO9 A;  4OAI Z;  3RJF A;  5DB8 A;  9ICV A;  4LEW A;  1PX5 A;  2HN1 A;  4WH5 A;  4Z6E A;  1ZJN A;  4XA5 A;  1ZQC A;  4I2I A;  4RQ1 A;  5CR0 A;  2B51 A;  1F5A A;  1ZQS A;  4WQL A;  2BBJ A;  5BOL A;  4M9L A;  5CFU A;  1RZT A;  5J0Y A;  3ER8 C;  4RQ3 A;  5IIK A;  4UAY A;  4UBB A;  9ICQ A;  8ICX A;  4RQ4 A;  4P4M A;  4JWM A;  4MKP A;  2BBH A;  8ICR A;  3HX0 A;  2PXI A;  5HRK A;  4LEY A;  5IIN A;  4NLK A;  3C5G A;  3UPQ A;  3JZ0 A;  7ICP A;  4I2F A;  4EP7 A;  7ICR A;  2HN2 A;  4RQ8 A;  1MQ2 A;  4X4V A;  1R8A A;  4QZA A;  4IQV A;  5J2K A;  4MF8 A;  5J29 A;  1XSN A;  2ZH5 A;  4EBK A;  4JLZ A;  3JPP A;  4I2B A;  3JCF A;  4M9G A;  3H3A A;  2ISO A;  2BCQ A;  4I2H A;  4O9M A;  3V7K A;  1BPB A;  3RJK A;  4M0A A;  4AT8 B;  4UAZ A;  2ZH7 A;  5D49 A;  5IIM A;  1OU5 A;  7ICG A;  1ZQK A;  3MGH A;  4DOA A;  1JAJ A;  2IHO A;  3WFO A;  4QZC A;  4YCX A;  1VJ7 A;  2GA9 D;  4RWN A;  4N7R A;  7ICQ A;  3V72 A;  4PGX A;  4XJE A;  4X4U A;  5HHI A;  4ATB B;  5DB7 A;  5J0W A;  4R64 A;  9ICR A;  4XQ8 A;  1V4A A;  4FO1 A;  1JN3 A;  3OUY A;  2ZH1 A;  5IIJ A;  5J2F A;  4I2J A;  5DDY A;  1MQ3 A;  3WFR E;  4P2H A;  4WCW A;  5CA7 A;  4KLD A;  1JQR A;  1GPJ A;  4WC2 A;  2GWS A;  1ZQL A;  9ICO A;  1XSP A;  3H39 A;  4RWQ A;  8ICU A;  4LZD A;  3AU6 A;  3AUO A;  3OV7 A;  3AQK A;  5CWR A;  4X4T A;  9ICC A;  5DBA A;  4PHA A;  3NYB A;  2EWR A;  2RFF A;  4YD2 A;  4KLM A;  4X4S A;  5DED A;  4RQ5 A;  4OAF A;  3RH4 A;  9ICX A;  3RJE A;  5F2V O;  4R65 A;  3MGI A;  9ICN A;  4M04 A;  9ICB A;  3UXN A;  2BCS A;  7ICO A;  3AQL A;  9ICG A;  4X0A A;  8ICI A;  3PML A;  4GXK A;  2DR8 A;  3NKU A;  4RQ2 A;  3OWG A;  2BCV A;  3AU2 A;  4UBC A;  4RWP A;  4R66 A;  4TUQ A;  9ICJ A;  4KLJ A;  4AT7 B;  3UQ0 A;  4KLI A;  5DB6 A;  5B3Q A;  5J2A A;  4FHV A;  3RJI A;  4RWO A;  2VAN A;  9ICL A;  2DR5 A;  4RQ7 A;  2PFO A;  4LVS A;  4K98 A;  4UB1 A;  4QZI A;  9ICE A;  7ICU A;  4IQT A;  4RPZ A;  4WC5 A;  5CP2 A;  4OAG A;  5D46 A;  4YMM A;  1TFW A;  3RH6 A;  4I28 A;  4KLS A;  2IUB A;  5BOM A;  9ICM A;  4UAW A;  1ZQW A;  4O68 A;  2DRA A;  3V7J A;  3UPS A;  1ZQJ A;  4F5P A;  4NY8 A;  5J0X A;  4KLO A;  3EF2 A;  3JPS A;  4I27 A;  4AT9 A;  1R8B A;  4LT6 A;  5CFS A;  5J0O A;  4S3N A;  4FO6 A;  7ICE A;  2B56 A;  1MIV A;  3B0Y A;  4UB2 A;  2DRB A; 
#chains in the Genus database with same CATH homology
 3GDX A;  9ICS A;  3ISC A;  4I2D A;  1UEU A;  2ZH8 A;  4TUR A;  4YN4 A;  8ICB A;  4K9B A;  1ZQV A;  2PFN A;  3UQ2 A;  1NO5 A;  1MIY A;  2ZH2 A;  4AT9 B;  4JWN A;  4IG8 A;  4O5E A;  1ZQI A;  4MFF A;  9ICT A;  4WC4 A;  8ICC A;  4TUP A;  1TVA A;  5HRG A;  2DVI A;  1ZQU A;  4M2Y A;  8ICL A;  4YD1 A;  3HWT A;  4X4O A;  4XRH A;  8ICZ A;  5IIL A;  3C2M A;  3WFQ E;  3HJ4 A;  3RJJ A;  3JPO A;  4LEV A;  1ZQM A;  4GXI A;  1KDH A;  4IQU A;  3ISB A;  3RJG A;  2ISP A;  4WC0 A;  4WC6 A;  1ZQB A;  5D4B A;  4KLT A;  7ICF A;  7ICH A;  4WBZ A;  5CHG A;  8ICM A;  3JYY A;  5HRL A;  1Q78 A;  2DR9 A;  2FMP A;  3MBY A;  1WOT A;  2M2W A;  4PHD A;  2P66 A;  4YMO A;  5J2E A;  4LEZ A;  4WBY A;  4KLE A;  4QZH A;  2B4V A;  4UD5 A;  1BPY A;  4I2E A;  8ICS A;  8ICG A;  4F5R A;  4PGY A;  2BCU A;  1R89 A;  8ICE A;  5BPC A;  4M5D A;  4XUS A;  2W9M A;  8ICP A;  4NLZ A;  5J2D A;  4KLG A;  4M47 A;  1KEJ A;  4FHX A;  3OVB A;  2O5A A;  3K75 D;  4RQ6 A;  3C2K A;  4I29 A;  1ZJM A;  4Z6D A;  2PFQ A;  4X5V A;  4PHP A;  4QZE A;  8ICQ A;  4NKU A;  2ZH3 A;  4PGQ A;  7ICS A;  8ICJ A;  4X4R A;  1RPL A;  3TFS A;  3TFR A;  7ICK A;  3C18 A;  4X4P A;  3LQC B;  4FHP A;  9ICP A;  1ZQE A;  4M9J A;  8ICN A;  4PHE A;  4O6A A;  5J2H A;  4O5C A;  7ICT A;  5J2B A;  1BPZ A;  5CB1 A;  2BCR A;  9ICI A;  4O5K A;  4XQ7 A;  4NXW A;  1KNY A;  4NLN A;  1ZQO A;  2HHP A;  5III A;  8ICO A;  5HRB A;  1ZQT A;  9ICU A;  7ICV A;  4X4Q A;  3HIY A;  4NXX A;  4RT3 A;  3JPN A;  5EOZ A;  3LK9 A;  4K99 A;  5TZV A;  3C5F A;  4E8F A;  4KLU A;  1FA0 A;  4KLQ A;  3B0X A;  4GXJ A;  1ZQA A;  3WFS C;  2DR7 A;  1JMS A;  4QZD A;  1UEV A;  3C66 A;  4KB6 A;  2ZHA A;  4WC7 A;  2BPC A;  5HHH A;  4MF2 A;  4FH3 A;  2ZH9 A;  1YLQ A;  5J2J A;  4O69 A;  4NKT A;  1BPE A;  1XSL A;  4KLL A;  4YMN A;  2PBE A;  1ZQR A;  4ATB A;  4Z6C A;  2ZH6 A;  3HW8 A;  3RJH A;  1TV9 A;  3AQN A;  3JPQ A;  4NXU A;  1BPX A;  5DKW A;  9ICA A;  2M2V A;  3RH5 A;  2ZHB A;  3H38 A;  5DBB A;  1ZQQ A;  5J2I A;  4PH5 A;  8ICY A;  4WC1 A;  4QZ8 A;  4DOB A;  4KLH A;  1BPD A;  3C2L A;  2ZH4 A;  4NXT A;  7ICM A;  4RPY A;  8ICW A;  1ZQN A;  4I2A A;  5DB9 A;  2BPF A;  4QZF A;  8ICH A;  1Q79 A;  4E80 A;  8ICA A;  3ISD A;  2O1P A;  4K97 A;  3OVA A;  5J0R A;  1ZQP A;  4LZG A;  9ICF A;  5J2C A;  5J2G A;  4O67 A;  5CJ7 A;  1UET A;  5J0T A;  2Q66 A;  4UB3 A;  3HJ1 A;  2M2U A;  4M9N A;  7ICJ A;  3PNC A;  4K4G A;  1ZQX A;  4QZ9 A;  3AQM A;  2FMS A;  4UD4 A;  1ZQG A;  3L9D A;  4P4P A;  4AT7 A;  4NXV A;  8ICV A;  8ICT A;  4KLF A;  3V7L A;  4MFA A;  5DBC A;  1VFG A;  9ICK A;  4WC3 A;  2I9G A;  4R63 A;  5J0P A;  4RQ0 A;  4K4I A;  4FHW A;  4I2G A;  4FH5 A;  4OAH A;  5HRE A;  4DOC A;  5HRF A;  4JLX A;  3OVS A;  4P4O A;  3H37 A;  7ICN A;  2NRK A;  4PPX A;  5HC9 A;  4EBJ A;  4NM1 A;  8ICK A;  4K4H A;  4FHY A;  4F5N A;  5J0U A;  4E7X A;  5HRD A;  4K8V A;  1HUZ A;  5HR9 A;  4WOY A;  1ZQZ A;  4AT8 A;  3UXP A;  3JPT A;  3UXO A;  2M2T A;  3OGU A;  1ZQD A;  4RT2 A;  4RPX A;  4F5O A;  1ZQY A;  5DEC A;  4NM2 A;  7ICL A;  5IIO A;  2PFP A;  1NOM A;  4M9H A;  4X0B A;  4MFC A;  5DDM A;  9ICW A;  4K9A A;  4K96 A;  4NXZ A;  4IQW A;  4QZG A;  3OUY B;  5J0Q A;  4KM5 A;  9ICH A;  4QZB A;  4UB4 A;  3MDC A;  3JPR A;  1R8C A;  4Z6F A;  2ID1 A;  2BPG A;  4I2C A;  2FMQ A;  3PMN A;  1HUO A;  3WFP A;  2BE3 A;  5J0S A;  1TFY A;  3MDA A;  8ICF A;  4F5Q A;  4UB5 A;  2IHM A;  4X4N A;  5HRH A;  1ZQF A;  7ICI A;  1MIW A;  4TUS A;  1ZQH A;  5HRI A;  4DO9 A;  4OAI Z;  3RJF A;  5DB8 A;  9ICV A;  4LEW A;  1PX5 A;  4Z6E A;  1ZJN A;  4XA5 A;  1ZQC A;  4I2I A;  4RQ1 A;  5CR0 A;  2B51 A;  1F5A A;  1ZQS A;  5BOL A;  4M9L A;  1RZT A;  5J0Y A;  4RQ3 A;  5IIK A;  4UAY A;  4UBB A;  9ICQ A;  8ICX A;  4RQ4 A;  4P4M A;  4JWM A;  4MKP A;  8ICR A;  3HX0 A;  2PXI A;  5HRK A;  4LEY A;  5IIN A;  4NLK A;  3C5G A;  3UPQ A;  3JZ0 A;  7ICP A;  4I2F A;  4EP7 A;  7ICR A;  4RQ8 A;  1MQ2 A;  4X4V A;  1R8A A;  4QZA A;  4IQV A;  5J2K A;  4MF8 A;  5J29 A;  1XSN A;  2ZH5 A;  4EBK A;  4JLZ A;  3JPP A;  4I2B A;  4M9G A;  3H3A A;  2ISO A;  2BCQ A;  4I2H A;  4O9M A;  3V7K A;  1BPB A;  3RJK A;  4M0A A;  4UAZ A;  4AT8 B;  2ZH7 A;  5D49 A;  5IIM A;  1OU5 A;  7ICG A;  1ZQK A;  3MGH A;  4DOA A;  1JAJ A;  3WFO A;  4QZC A;  4YCX A;  1VJ7 A;  4RWN A;  7ICQ A;  3V72 A;  4PGX A;  4X4U A;  5HHI A;  4ATB B;  5DB7 A;  5J0W A;  4R64 A;  9ICR A;  4XQ8 A;  1V4A A;  1JN3 A;  3OUY A;  2ZH1 A;  5IIJ A;  5J2F A;  4I2J A;  5DDY A;  1MQ3 A;  3WFR E;  4P2H A;  4WCW A;  5CA7 A;  4KLD A;  1JQR A;  4WC2 A;  2GWS A;  1ZQL A;  9ICO A;  1XSP A;  3H39 A;  4RWQ A;  8ICU A;  4LZD A;  3AU6 A;  3AUO A;  3OV7 A;  3AQK A;  5CWR A;  4X4T A;  9ICC A;  5DBA A;  4PHA A;  3NYB A;  4YD2 A;  2RFF A;  4KLM A;  4X4S A;  5DED A;  4RQ5 A;  4OAF A;  3RH4 A;  9ICX A;  3RJE A;  5F2V O;  4R65 A;  3MGI A;  9ICN A;  4M04 A;  9ICB A;  3UXN A;  2BCS A;  7ICO A;  3AQL A;  9ICG A;  4X0A A;  8ICI A;  3PML A;  4GXK A;  2DR8 A;  4RQ2 A;  2BCV A;  3AU2 A;  4UBC A;  4RWP A;  4R66 A;  4TUQ A;  9ICJ A;  4KLJ A;  4AT7 B;  3UQ0 A;  4KLI A;  5DB6 A;  5J2A A;  4FHV A;  3RJI A;  2VAN A;  4RWO A;  9ICL A;  2DR5 A;  4RQ7 A;  2PFO A;  4LVS A;  4K98 A;  4UB1 A;  4QZI A;  9ICE A;  7ICU A;  4IQT A;  4RPZ A;  4WC5 A;  5CP2 A;  4OAG A;  5D46 A;  4YMM A;  1TFW A;  3RH6 A;  4I28 A;  4KLS A;  5BOM A;  9ICM A;  4UAW A;  1ZQW A;  4O68 A;  2DRA A;  3V7J A;  3UPS A;  1ZQJ A;  4F5P A;  4NY8 A;  5J0X A;  4KLO A;  3JPS A;  4I27 A;  4AT9 A;  1R8B A;  4LT6 A;  5J0O A;  4S3N A;  4FO6 A;  7ICE A;  2B56 A;  1MIV A;  3B0Y A;  4UB2 A;  2DRB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...