4FHVA

Crystal structures of the cid1 poly (u) polymerase reveal the mechanism for utp selectivity - mgctp bound
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
338
structure length
323
Chain Sequence
SHKEFTKFCYEVYNEIKISDKEFKEKRAALDTLRLCLKRISPDAELVAFGSLESGLALKNSDMDLCVLMDSRVQSDTIALQFYEELIAEGFEGKFLQRARIPIIKLTSDTKNGFGASFQCDIGFNNRLAIHNTLLLSSYTKLDARLKPMVLLVKHWAKRKQINSPYFGTLSSYGYVLMVLYYLIHVIKPPVFPNLLLSPLKQEKIVDGFDVGFDDKLEDIPPSQNYSSLGSLLHGFFRFYAYKFEPREKVVTFRRPDGYLTKQEKGWTRYILAIEDPFEISHNVGRTVSSSGLYRIRGEFMAASRLLNSRSYPIPYDSLFEEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Poly(A) RNA polymerase protein cid1
publication title Crystal structures of the Cid1 poly (U) polymerase reveal the mechanism for UTP selectivity.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transferase
total genus 109
structure length 323
sequence length 338
ec nomenclature ec 2.7.7.19: Polynucleotide adenylyltransferase.
pdb deposition date 2012-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01909 NTP_transf_2 Nucleotidyltransferase domain
A PF03828 PAP_assoc Cid1 family poly A polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.10 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain Poly(a)-polymerase, middle domain 4fhvA01
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4fhvA02
4WC0A 9ICEA 9ICFA 8ICHA 4X4QA 4EBJA 3JPSA 3B0XA 3V7LA 5J0WA 3WFRE 4M2YA 5CB1A 4I2JA 2RFFA 4YN4A 4RT2A 4PH5A 4I27A 2FMPA 5IIOA 5J2EA 5HRDA 9ICLA 5HRBA 5D4BA 4YD2A 9ICKA 2GWSA 3MGIA 3C5GA 5DBCA 7ICOA 5J2BA 4WCWA 4I2FA 3HIYA 8ICNA 4X4VA 4KLMA 8ICZA 2P66A 4AT7B 4QZFA 4TUSA 8ICXA 5J2JA 1ZQXA 3HW8A 8ICTA 4RQ5A 5DDMA 4RWPA 4UAZA 4WC2A 4KLHA 4RT3A 4F5QA 2DRBA 1HUZA 1BPZA 1UEUA 2PFPA 4PHPA 2M2TA 1ZQTA 4M9NA 1Q78A 1ZJNA 4QZ9A 1KDHA 5J0RA 3JPPA 4UAYA 4WC3A 4GXIA 4DOCA 3UQ0A 3PMNA 3UXNA 4RWNA 3OUYA 8ICPA 1F5AA 2FMSA 7ICGA 4WC7A 1ZQLA 4MFCA 4FHXA 1RPLA 3WFOA 4F5RA 8ICKA 9ICVA 4NLNA 4KLGA 3TFRA 5HREA 7ICEA 1ZQNA 8ICLA 1VJ7A 4PHEA 8ICFA 8ICBA 4UB1A 3MDAA 4LZGA 2O5AA 4I2BA 4MF2A 4E7XA 5DB6A 5D49A 2ZH1A 5J0YA 4FH3A 7ICLA 3HJ1A 4FH5A 3C2KA 4O9MA 4Z6FA 3RJKA 5CP2A 1ZQSA 5CWRA 4PGYA 9ICRA 4NY8A 5HHIA 8ICOA 4QZDA 4X5VA 4XRHA 2ZH5A 3WFPA 1ZQVA 5DBAA 4FHYA 4PHDA 4UD5A 5DBBA 4X4TA 3NYBA 4UB2A 3AQKA 2PFNA 4WC4A 2PFQA 1KEJA 4X4RA 4IQTA 3OGUA 3UPSA 4FO6A 1ZQQA 2DR9A 4RWQA 1PX5A 2ZH3A 4KLQA 3PMLA 4IQUA 3AU2A 4UB5A 4RQ6A 9ICTA 5DB9A 1ZQWA 8ICWA 2PFOA 4KLLA 1MIYA 2NRKA 1R8BA 5J2GA 2M2VA 4UB3A 4O5KA 9ICIA 4LVSA 5BOLA 3MGHA 4AT9B 2BCUA 1R89A 3JPQA 4IQVA 1MQ2A 9ICHA 4JWNA 2Q66A 4E80A 5J0UA 3JZ0A 7ICVA 4P4PA 2M2UA 5J2DA 4FHPA 4S3NA 3OUYB 2DVIA 9ICBA 1XSNA 3OV7A 4UD4A 4O5EA 3AUOA 8ICQA 5J2KA 4WC5A 4WBZA 3C5FA 4XUSA 4KLFA 4RQ8A 4QZGA 2B4VA 4NM1A 2B51A 3H3AA 4GXKA 2IHMA 5IIJA 4XA5A 4TUQA 1MIWA 1ZQRA 5DEDA 4MF8A 5TZVA 4NM2A 4DO9A 4WC6A 4RQ0A 1OU5A 1ZQCA 8ICRA 1R8CA 2BCSA 3MDCA 4R63A 2ZH8A 1ZQPA 1WOTA 4R64A 4AT9A 1JN3A 4MFFA 7ICNA 4I2IA 9ICUA 2M2WA 4KLIA 1JAJA 4XQ7A 1ZQKA 8ICMA 3V7KA 5J0OA 4F5OA 8ICCA 5DECA 7ICTA 8ICJA 5HRHA 8ICSA 3UQ2A 4R65A 2ZHAA 3JYYA 2ISOA 5DB8A 5CA7A 3ISCA 3RJGA 4I2EA 4QZIA 1ZQIA 1TFWA 1UEVA 3UPQA 2ZH7A 2BPFA 4QZ8A 4P4MA 4QZBA 4I28A 5J0PA 8ICVA 5CHGA 4XQ8A 4UAWA 4DOAA 7ICJA 4QZCA 4NLKA 3GDXA 4QZEA 2ZH4A 4DOBA 2HHPA 2DR7A 4NXZA 4EBKA 2DR5A 3AU6A 4PGQA 1TVAA 4YMMA 2FMQA 5J0QA 3OVAA 1XSPA 1Q79A 4M9HA 3LQCB 4I2GA 3RJJA 3H37A 4PPXA 3RJEA 5HRGA 2BPGA 3AQMA 9ICPA 4I2DA 1ZQBA 4I29A 3JPOA 8ICAA 3WFSC 9ICXA 5J2AA 2BCVA 3K75D 5HHHA 3UXPA 2BCQA 4KLOA 1BPBA 7ICUA 5BPCA 4FHWA 4Z6DA 3RH6A 1ZQAA 3C66A 4I2HA 2O1PA 4PHAA 5J2IA 1ZQOA 4LT6A 9ICMA 4Z6CA 5J29A 7ICSA 4KLSA 5HRLA 3H38A 4NKTA 4X0AA 4IG8A 4X0BA 5HRIA 5HR9A 4AT8B 3L9DA 4YMOA 1ZQFA 4EP7A 4O5CA 1NO5A 4RQ3A 5DKWA 9ICGA 5HRFA 5DDYA 2ZH2A 3LK9A 4LZDA 4K4GA 7ICFA 4X4SA 4X4UA 9ICNA 3HWTA 1UETA 3C2LA 4YMNA 1ZQMA 1RZTA 4KLDA 3H39A 4K4IA 5BOMA 2ZH6A 8ICGA 4K4HA 3AQLA 1ZQEA 1ZJMA 7ICQA 4RWOA 4UB4A 4ATBB 2PXIA 4I2AA 9ICSA 4IQWA 1ZQUA 1FA0A 3TFSA 1ZQYA 4GXJA 5IIMA 1ZQDA 2B56A 7ICHA 3RJFA 4RQ2A 5J0TA 5D46A 3ISBA 1YLQA 2ZH9A 4AT8A 1V4AA 2I9GA 4F5PA 2ID1A 1XSLA 3C18A 5IIKA 4QZHA 7ICIA 1ZQJA 4KLUA 4M9JA 1MIVA 3B0YA 2BE3A 2DR8A 4UBBA 1TV9A 4M47A 4MFAA 9ICAA 4RPZA 5J0XA 5J2CA 1TFYA 5J2FA 3OVBA 2PBEA 5F2VO 5CJ7A 3V7JA 4JWMA 5J2HA 4X4NA 3C2MA 4ATBA 4RQ7A 4RPYA 4RPXA 1NOMA 1VFGA 1ZQHA 4UBCA 3HX0A 3ISDA 8ICUA 7ICKA 3MBYA 4KLJA 4M9GA 4KLEA 4M04A 2VANA 9ICWA 8ICYA 3JPTA 2W9MA 4NKUA 4YCXA 4AT7A 3OVSA 4WC1A 8ICEA 2BPCA 5EOZA 4R66A 4Z6EA 2BCRA 3WFQE 5HRKA 1BPXA 4RQ4A 4F5NA 4TURA 9ICOA 1R8AA 3RH5A 5J0SA 3JPRA 4I2CA 4YD1A 4PGXA 1BPEA 4TUPA 8ICIA 5IILA 4X4OA 5HC9A 4M9LA 4FHVA 4NLZA 4WBYA 3V72A 1BPYA 2ISPA 5IIIA 3HJ4A 2DRAA 3RJIA 3RH4A 1HUOA 1JMSA 1MQ3A 4X4PA 7ICPA 3JPNA 4M5DA 1BPDA 5CR0A 4QZAA 9ICJA 1KNYA 2ZHBA 1JQRA 4E8FA 5DB7A 1ZQGA 4KLTA 9ICQA 7ICMA 3RJHA 4RQ1A 5IINA 4P4OA 3PNCA 4M0AA 7ICRA 3UXOA 9ICCA 3AQNA 1ZQZA 4P2HA
chains in the Genus database with same CATH superfamily
4WC0A 9ICEA 9ICFA 8ICHA 4K8VA 4X4QA 4LEYA 4EBJA 3JPSA 3B0XA 2HN1A 3V7LA 5J0WA 3WFRE 4K98A 4M2YA 4K99A 5CB1A 4I2JA 2RFFA 2GAFD 4YN4A 4RT2A 4PH5A 4I27A 2FMPA 5IIOA 5J2EA 5HRDA 9ICLA 5HRBA 5D4BA 4YD2A 9ICKA 2GWSA 3MGIA 3C5GA 5DBCA 7ICOA 4WQLA 5J2BA 4WCWA 4I2FA 3HIYA 8ICNA 4X4VA 4KLMA 8ICZA 2P66A 4AT7B 4QZFA 4TUSA 8ICXA 5J2JA 1ZQXA 3HW8A 8ICTA 4RQ5A 5D63A 4RWPA 5DDMA 4UAZA 4WC2A 4KLHA 2DRBA 4RT3A 4F5QA 4K9AA 1HUZA 1BPZA 1UEUA 2PFPA 4PHPA 2M2TA 4N7RA 5D61A 1ZQTA 4M9NA 1Q78A 1ZJNA 4QZ9A 1KDHA 5J0RA 3JPPA 4UAYA 4WC3A 4GXIA 4XJEA 3UQ0A 4DOCA 3PMNA 3UXNA 4RWNA 3OUYA 8ICPA 1F5AA 2FMSA 7ICGA 4EEDA 4WC7A 4LEZA 1ZQLA 2HN2A 4MFCA 4FHXA 1RPLA 3WFOA 4K9BA 4F5RA 8ICKA 9ICVA 4NLNA 4KLGA 2BBJA 5HREA 3TFRA 1ZQNA 7ICEA 8ICLA 1VJ7A 4PHEA 8ICFA 8ICBA 4UB1A 3MDAA 4LZGA 2O5AA 4I2BA 4MF2A 4E7XA 5DB6A 5D49A 2ZH1A 5J0YA 4FH3A 7ICLA 3HJ1A 4FH5A 3C2KA 4O9MA 4Z6FA 3RJKA 5CP2A 1ZQSA 4LEVA 4PGYA 5CWRA 9ICRA 4MKPA 4NY8A 4EGWA 5HHIA 4QZDA 4X5VA 8ICOA 4XRHA 4OAIZ 2ZH5A 3WFPA 1ZQVA 5DBAA 4FHYA 4PHDA 4UD5A 5DBBA 3PHZA 4X4TA 3NYBA 4UB2A 3AQKA 4NXUA 4FO1A 2PFNA 4WC4A 3NKUA 2PFQA 2DR9A 4X4RA 1KEJA 4IQTA 3UPSA 3OGUA 4FO6A 1ZQQA 2IHOA 4NXTA 4RWQA 1PX5A 2ZH3A 4KLQA 3PMLA 4IQUA 4EEBA 3AU2A 4UB5A 4RQ6A 9ICTA 5DB9A 1ZQWA 8ICWA 2PFOA 4KLLA 1MIYA 4O68A 2NRKA 1R8BA 5J2GA 2M2VA 4UB3A 4O5KA 9ICIA 4LVSA 5BOLA 3MGHA 4AT9B 2BCUA 1R89A 3JPQA 4IQVA 1MQ2A 9ICHA 4JWNA 2Q66A 4E80A 5J0UA 3JZ0A 7ICVA 4P4PA 2M2UA 5J2DA 4FHPA 4S3NA 3OUYB 4KB6A 2DVIA 9ICBA 1XSNA 3OV7A 4UD4A 4O5EA 3AUOA 8ICQA 5J2KA 4O69A 4WC5A 4WBZA 3C5FA 3OWGA 5D62A 4XUSA 4O6AA 4RQ8A 4KLFA 3JCFA 4QZGA 2B4VA 4NM1A 2B51A 3H3AA 4GXKA 2IHMA 5IIJA 4XA5A 4TUQA 1MIWA 4WOYA 1ZQRA 2IUBA 5DEDA 4MF8A 5TZVA 4NM2A 4DO9A 4WC6A 4RQ0A 1OU5A 1ZQCA 8ICRA 1R8CA 2BCSA 3MDCA 4R63A 2ZH8A 4K96A 5JTGA 1WOTA 1ZQPA 3K7DA 4R64A 4AT9A 1JN3A 4MFFA 3NVOA 7ICNA 3ER9B 4I2IA 9ICUA 2M2WA 4KLIA 1JAJA 4XQ7A 4WH5A 3ER8C 1ZQKA 8ICMA 3V7KA 5J0OA 4F5OA 8ICCA 5DECA 7ICTA 8ICJA 5HRHA 8ICSA 3UQ2A 4NXXA 2FCLA 2ZHAA 4I0UA 3JYYA 4R65A 2ISOA 5DB8A 5CA7A 3ISCA 3RJGA 4I2EA 4QZIA 1ZQIA 1TFWA 1UEVA 3UPQA 3ERCC 2ZH7A 2BPFA 4QZ8A 4P4MA 4QZBA 4I28A 5J0PA 8ICVA 5CHGA 5CFUA 4XQ8A 4UAWA 4DOAA 7ICJA 4QZCA 4NLKA 3GDXA 4QZEA 4LEWA 2ZH4A 4DOBA 2HHPA 2DR7A 4OAFA 4NXZA 2DR5A 4EBKA 3AU6A 4PGQA 1TVAA 4YMMA 2FMQA 5J0QA 3OVAA 1XSPA 1Q79A 4M9HA 3LQCB 4I2GA 3RJJA 3H37A 4PPXA 3RJEA 5HRGA 2BPGA 3AQMA 4KM5A 9ICPA 4I2DA 1ZQBA 4I29A 3JPOA 8ICAA 3WFSC 9ICXA 5J2AA 2BCVA 3K75D 5HHHA 3UXPA 2BCQA 5CFSA 4KLOA 1BPBA 7ICUA 5BPCA 4FHWA 4Z6DA 3RH6A 1ZQAA 2BBHA 3C66A 4I2HA 3MCRA 2O1PA 4PHAA 5J2IA 1ZQOA 4LT6A 9ICMA 4Z6CA 5J29A 7ICSA 4KLSA 5HRLA 2GA9D 3H38A 4NKTA 4X0AA 4IG8A 4X0BA 5HRIA 4JLXA 3CK6A 5HR9A 4AT8B 3L9DA 4YMOA 1ZQFA 4WQKA 4EP7A 4O5CA 1NO5A 4RQ3A 5DKWA 9ICGA 5HRFA 5DDYA 2ZH2A 3LK9A 4LZDA 4K4GA 7ICFA 4X4SA 4X4UA 9ICNA 3HWTA 1UETA 3C2LA 4YMNA 1ZQMA 1RZTA 4KLDA 3H39A 4K4IA 5BOMA 2ZH6A 8ICGA 5CFTA 4K4HA 3AQLA 1ZQEA 1ZJMA 7ICQA 4RWOA 4UB4A 4ATBB 2PXIA 4I2AA 9ICSA 4IQWA 1ZQUA 1FA0A 3TFSA 1ZQYA 4GXJA 5IIMA 1ZQDA 2B56A 5CHEA 7ICHA 4NXVA 3RJFA 4RQ2A 5J0TA 5D46A 3ISBA 1YLQA 2ZH9A 4AT8A 1V4AA 2I9GA 4F5PA 2ID1A 1XSLA 3C18A 5IIKA 4QZHA 4O67A 7ICIA 1ZQJA 4KLUA 4M9JA 1MIVA 3B0YA 2BE3A 2DR8A 4UBBA 4OAHA 3EF2A 1TV9A 4M47A 4MFAA 9ICAA 4RPZA 5J0XA 5J2CA 1TFYA 5J2FA 3OVBA 2PBEA 5F2VO 5CJ7A 3V7JA 4JWMA 4X4NA 5J2HA 3NWIA 3C2MA 4ATBA 4RQ7A 4RPYA 4RPXA 1NOMA 1VFGA 1ZQHA 4UBCA 3HX0A 3ISDA 8ICUA 7ICKA 3MBYA 4KLJA 4M9GA 4KLEA 4M04A 2VANA 9ICWA 8ICYA 4OAGA 4NKUA 4YCXA 2W9MA 4AT7A 3JPTA 3OVSA 4WC1A 8ICEA 2BPCA 5EOZA 4R66A 4Z6EA 2BCRA 3WFQE 5HRKA 1BPXA 4RQ4A 5B3QA 4F5NA 4TURA 9ICOA 1R8AA 3RH5A 5J0SA 3JPRA 4I2CA 4YD1A 4PGXA 1BPEA 4TUPA 8ICIA 5IILA 4X4OA 5HC9A 4M9LA 4HX0A 4FHVA 4NLZA 4WBYA 3V72A 1BPYA 2ISPA 5IIIA 3HJ4A 2DRAA 3RJIA 3RH4A 1HUOA 4JLZA 1JMSA 1MQ3A 4X4PA 4K97A 7ICPA 3JPNA 4M5DA 1BPDA 5CR0A 4QZAA 9ICJA 1KNYA 2ZHBA 1JQRA 5B3PA 4EV6A 4E8FA 5DB7A 2EWRA 1ZQGA 4KLTA 9ICQA 7ICMA 3RJHA 4RQ1A 5IINA 1GPJA 4P4OA 3PNCA 4M0AA 7ICRA 3UXOA 4NXWA 9ICCA 3AQNA 1ZQZA 4P2HA
chains in the Genus database with same CATH topology
4WC0A 9ICEA 9ICFA 8ICHA 4K8VA 4X4QA 4LEYA 4EBJA 3JPSA 3B0XA 3V7LA 5J0WA 3WFRE 4K98A 4M2YA 4K99A 5CB1A 4I2JA 2RFFA 4YN4A 4RT2A 4PH5A 4I27A 2FMPA 5IIOA 5J2EA 5HRDA 9ICLA 5HRBA 5D4BA 4YD2A 9ICKA 2GWSA 3MGIA 3C5GA 5DBCA 7ICOA 5J2BA 4WCWA 4I2FA 3HIYA 8ICNA 4X4VA 4KLMA 8ICZA 2P66A 4AT7B 4QZFA 4TUSA 8ICXA 5J2JA 1ZQXA 3HW8A 8ICTA 4RQ5A 5DDMA 4RWPA 4UAZA 4WC2A 4KLHA 2DRBA 4RT3A 4F5QA 4K9AA 1HUZA 1BPZA 1UEUA 2PFPA 4PHPA 2M2TA 1ZQTA 4M9NA 1Q78A 1ZJNA 4QZ9A 1KDHA 5J0RA 3JPPA 4UAYA 4WC3A 4GXIA 4DOCA 3UQ0A 3PMNA 3UXNA 4RWNA 3OUYA 8ICPA 1F5AA 2FMSA 7ICGA 4WC7A 4LEZA 1ZQLA 4MFCA 4FHXA 1RPLA 3WFOA 4K9BA 4F5RA 8ICKA 9ICVA 4NLNA 4KLGA 3TFRA 5HREA 7ICEA 1ZQNA 8ICLA 1VJ7A 4PHEA 8ICFA 8ICBA 4UB1A 3MDAA 4LZGA 2O5AA 4I2BA 4MF2A 4E7XA 5DB6A 5D49A 2ZH1A 5J0YA 4FH3A 7ICLA 3HJ1A 4FH5A 3C2KA 4O9MA 4Z6FA 3RJKA 5CP2A 1ZQSA 4LEVA 4PGYA 5CWRA 9ICRA 4MKPA 4NY8A 5HHIA 8ICOA 4QZDA 4X5VA 4XRHA 4OAIZ 2ZH5A 3WFPA 1ZQVA 5DBAA 4FHYA 4PHDA 4UD5A 5DBBA 4X4TA 3NYBA 4UB2A 3AQKA 4NXUA 2PFNA 4WC4A 2PFQA 2DR9A 4X4RA 1KEJA 4IQTA 3UPSA 3OGUA 4FO6A 1ZQQA 4NXTA 4RWQA 1PX5A 2ZH3A 4KLQA 3PMLA 4IQUA 3AU2A 4UB5A 4RQ6A 9ICTA 5DB9A 1ZQWA 8ICWA 2PFOA 4KLLA 1MIYA 4O68A 2NRKA 1R8BA 5J2GA 2M2VA 4UB3A 4O5KA 9ICIA 4LVSA 5BOLA 3MGHA 4AT9B 2BCUA 1R89A 3JPQA 4IQVA 1MQ2A 9ICHA 4JWNA 2Q66A 4E80A 5J0UA 3JZ0A 7ICVA 4P4PA 2M2UA 5J2DA 4FHPA 4S3NA 3OUYB 4KB6A 2DVIA 9ICBA 1XSNA 3OV7A 4UD4A 4O5EA 3AUOA 8ICQA 5J2KA 4O69A 4WC5A 4WBZA 3C5FA 4XUSA 4O6AA 4RQ8A 4KLFA 4QZGA 2B4VA 4NM1A 2B51A 3H3AA 4GXKA 2IHMA 5IIJA 4XA5A 4TUQA 1MIWA 4WOYA 1ZQRA 5DEDA 4MF8A 5TZVA 4NM2A 4DO9A 4WC6A 4RQ0A 1OU5A 1ZQCA 8ICRA 1R8CA 2BCSA 3MDCA 4R63A 2ZH8A 4K96A 1ZQPA 1WOTA 4R64A 4AT9A 1JN3A 4MFFA 7ICNA 4I2IA 9ICUA 2M2WA 4KLIA 1JAJA 4XQ7A 1ZQKA 8ICMA 3V7KA 5J0OA 4F5OA 8ICCA 5DECA 7ICTA 8ICJA 5HRHA 8ICSA 3UQ2A 4NXXA 2ZHAA 4R65A 3JYYA 2ISOA 5DB8A 5CA7A 3ISCA 3RJGA 4I2EA 4QZIA 1ZQIA 1TFWA 1UEVA 3UPQA 2ZH7A 2BPFA 4QZ8A 4P4MA 4QZBA 4I28A 5J0PA 8ICVA 5CHGA 4XQ8A 4UAWA 4DOAA 7ICJA 4QZCA 4NLKA 3GDXA 4QZEA 4LEWA 2ZH4A 4DOBA 2HHPA 2DR7A 4OAFA 4NXZA 2DR5A 4EBKA 3AU6A 4PGQA 1TVAA 4YMMA 2FMQA 5J0QA 3OVAA 1XSPA 1Q79A 4M9HA 3LQCB 4I2GA 3RJJA 3H37A 4PPXA 3RJEA 5HRGA 2BPGA 3AQMA 4KM5A 9ICPA 4I2DA 1ZQBA 4I29A 3JPOA 8ICAA 3WFSC 9ICXA 5J2AA 2BCVA 3K75D 5HHHA 3UXPA 2BCQA 4KLOA 1BPBA 7ICUA 5BPCA 4FHWA 4Z6DA 3RH6A 1ZQAA 3C66A 4I2HA 2O1PA 4PHAA 5J2IA 1ZQOA 4LT6A 9ICMA 4Z6CA 5J29A 7ICSA 4KLSA 5HRLA 3H38A 4NKTA 4X0AA 4IG8A 4X0BA 5HRIA 4JLXA 5HR9A 4AT8B 3L9DA 4YMOA 1ZQFA 4EP7A 4O5CA 1NO5A 4RQ3A 5DKWA 9ICGA 5HRFA 5DDYA 2ZH2A 3LK9A 4LZDA 4K4GA 7ICFA 4X4SA 4X4UA 9ICNA 3HWTA 1UETA 3C2LA 4YMNA 1ZQMA 1RZTA 4KLDA 3H39A 4K4IA 5BOMA 2ZH6A 8ICGA 4K4HA 3AQLA 1ZQEA 1ZJMA 7ICQA 4RWOA 4UB4A 4ATBB 2PXIA 4I2AA 9ICSA 4IQWA 1ZQUA 1FA0A 3TFSA 1ZQYA 4GXJA 5IIMA 1ZQDA 2B56A 7ICHA 4NXVA 3RJFA 4RQ2A 5J0TA 5D46A 3ISBA 1YLQA 2ZH9A 4AT8A 1V4AA 2I9GA 4F5PA 2ID1A 1XSLA 3C18A 5IIKA 4QZHA 4O67A 7ICIA 1ZQJA 4KLUA 4M9JA 1MIVA 3B0YA 2BE3A 2DR8A 4UBBA 4OAHA 1TV9A 4M47A 4MFAA 9ICAA 4RPZA 5J0XA 5J2CA 1TFYA 5J2FA 3OVBA 2PBEA 5F2VO 5CJ7A 3V7JA 4JWMA 4X4NA 5J2HA 3C2MA 4ATBA 4RQ7A 4RPYA 4RPXA 1NOMA 1VFGA 1ZQHA 4UBCA 3HX0A 3ISDA 8ICUA 7ICKA 3MBYA 4KLJA 4M9GA 4KLEA 4M04A 2VANA 9ICWA 8ICYA 4OAGA 4NKUA 2W9MA 4YCXA 4AT7A 3JPTA 3OVSA 4WC1A 8ICEA 2BPCA 5EOZA 4R66A 4Z6EA 2BCRA 3WFQE 5HRKA 1BPXA 4RQ4A 4F5NA 4TURA 9ICOA 1R8AA 3RH5A 5J0SA 3JPRA 4I2CA 4YD1A 4PGXA 1BPEA 4TUPA 8ICIA 5IILA 4X4OA 5HC9A 4M9LA 4FHVA 4NLZA 4WBYA 3V72A 1BPYA 2ISPA 5IIIA 3HJ4A 2DRAA 3RJIA 3RH4A 1HUOA 4JLZA 1JMSA 1MQ3A 4X4PA 4K97A 7ICPA 3JPNA 4M5DA 1BPDA 5CR0A 4QZAA 9ICJA 1KNYA 2ZHBA 1JQRA 4E8FA 5DB7A 1ZQGA 4KLTA 9ICQA 7ICMA 3RJHA 4RQ1A 5IINA 4P4OA 3PNCA 4M0AA 7ICRA 3UXOA 4NXWA 9ICCA 3AQNA 1ZQZA 4P2HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WC0 A;  9ICE A;  9ICF A;  8ICH A;  4X4Q A;  4EBJ A;  3JPS A;  3B0X A;  3V7L A;  5J0W A;  3WFR E;  4M2Y A;  5CB1 A;  4I2J A;  2RFF A;  4YN4 A;  4RT2 A;  4PH5 A;  4I27 A;  2FMP A;  5IIO A;  5J2E A;  5HRD A;  9ICL A;  5HRB A;  5D4B A;  4YD2 A;  9ICK A;  2GWS A;  3MGI A;  3C5G A;  5DBC A;  7ICO A;  5J2B A;  4WCW A;  4I2F A;  3HIY A;  8ICN A;  4X4V A;  4KLM A;  8ICZ A;  2P66 A;  4AT7 B;  4QZF A;  4TUS A;  8ICX A;  5J2J A;  1ZQX A;  3HW8 A;  8ICT A;  4RQ5 A;  5DDM A;  4RWP A;  4UAZ A;  4WC2 A;  4KLH A;  4RT3 A;  4F5Q A;  2DRB A;  1HUZ A;  1BPZ A;  1UEU A;  2PFP A;  4PHP A;  2M2T A;  1ZQT A;  4M9N A;  1Q78 A;  1ZJN A;  4QZ9 A;  1KDH A;  5J0R A;  3JPP A;  4UAY A;  4WC3 A;  4GXI A;  4DOC A;  3UQ0 A;  3PMN A;  3UXN A;  4RWN A;  3OUY A;  8ICP A;  1F5A A;  2FMS A;  7ICG A;  4WC7 A;  1ZQL A;  4MFC A;  4FHX A;  1RPL A;  3WFO A;  4F5R A;  8ICK A;  9ICV A;  4NLN A;  4KLG A;  3TFR A;  5HRE A;  7ICE A;  1ZQN A;  8ICL A;  1VJ7 A;  4PHE A;  8ICF A;  8ICB A;  4UB1 A;  3MDA A;  4LZG A;  2O5A A;  4I2B A;  4MF2 A;  4E7X A;  5DB6 A;  5D49 A;  2ZH1 A;  5J0Y A;  4FH3 A;  7ICL A;  3HJ1 A;  4FH5 A;  3C2K A;  4O9M A;  4Z6F A;  3RJK A;  5CP2 A;  1ZQS A;  5CWR A;  4PGY A;  9ICR A;  4NY8 A;  5HHI A;  8ICO A;  4QZD A;  4X5V A;  4XRH A;  2ZH5 A;  3WFP A;  1ZQV A;  5DBA A;  4FHY A;  4PHD A;  4UD5 A;  5DBB A;  4X4T A;  3NYB A;  4UB2 A;  3AQK A;  2PFN A;  4WC4 A;  2PFQ A;  1KEJ A;  4X4R A;  4IQT A;  3OGU A;  3UPS A;  4FO6 A;  1ZQQ A;  2DR9 A;  4RWQ A;  1PX5 A;  2ZH3 A;  4KLQ A;  3PML A;  4IQU A;  3AU2 A;  4UB5 A;  4RQ6 A;  9ICT A;  5DB9 A;  1ZQW A;  8ICW A;  2PFO A;  4KLL A;  1MIY A;  2NRK A;  1R8B A;  5J2G A;  2M2V A;  4UB3 A;  4O5K A;  9ICI A;  4LVS A;  5BOL A;  3MGH A;  4AT9 B;  2BCU A;  1R89 A;  3JPQ A;  4IQV A;  1MQ2 A;  9ICH A;  4JWN A;  2Q66 A;  4E80 A;  5J0U A;  3JZ0 A;  7ICV A;  4P4P A;  2M2U A;  5J2D A;  4FHP A;  4S3N A;  3OUY B;  2DVI A;  9ICB A;  1XSN A;  3OV7 A;  4UD4 A;  4O5E A;  3AUO A;  8ICQ A;  5J2K A;  4WC5 A;  4WBZ A;  3C5F A;  4XUS A;  4KLF A;  4RQ8 A;  4QZG A;  2B4V A;  4NM1 A;  2B51 A;  3H3A A;  4GXK A;  2IHM A;  5IIJ A;  4XA5 A;  4TUQ A;  1MIW A;  1ZQR A;  5DED A;  4MF8 A;  5TZV A;  4NM2 A;  4DO9 A;  4WC6 A;  4RQ0 A;  1OU5 A;  1ZQC A;  8ICR A;  1R8C A;  2BCS A;  3MDC A;  4R63 A;  2ZH8 A;  1ZQP A;  1WOT A;  4R64 A;  4AT9 A;  1JN3 A;  4MFF A;  7ICN A;  4I2I A;  9ICU A;  2M2W A;  4KLI A;  1JAJ A;  4XQ7 A;  1ZQK A;  8ICM A;  3V7K A;  5J0O A;  4F5O A;  8ICC A;  5DEC A;  7ICT A;  8ICJ A;  5HRH A;  8ICS A;  3UQ2 A;  4R65 A;  2ZHA A;  3JYY A;  2ISO A;  5DB8 A;  5CA7 A;  3ISC A;  3RJG A;  4I2E A;  4QZI A;  1ZQI A;  1TFW A;  1UEV A;  3UPQ A;  2ZH7 A;  2BPF A;  4QZ8 A;  4P4M A;  4QZB A;  4I28 A;  5J0P A;  8ICV A;  5CHG A;  4XQ8 A;  4UAW A;  4DOA A;  7ICJ A;  4QZC A;  4NLK A;  3GDX A;  4QZE A;  2ZH4 A;  4DOB A;  2HHP A;  2DR7 A;  4NXZ A;  4EBK A;  2DR5 A;  3AU6 A;  4PGQ A;  1TVA A;  4YMM A;  2FMQ A;  5J0Q A;  3OVA A;  1XSP A;  1Q79 A;  4M9H A;  3LQC B;  4I2G A;  3RJJ A;  3H37 A;  4PPX A;  3RJE A;  5HRG A;  2BPG A;  3AQM A;  9ICP A;  4I2D A;  1ZQB A;  4I29 A;  3JPO A;  8ICA A;  3WFS C;  9ICX A;  5J2A A;  2BCV A;  3K75 D;  5HHH A;  3UXP A;  2BCQ A;  4KLO A;  1BPB A;  7ICU A;  5BPC A;  4FHW A;  4Z6D A;  3RH6 A;  1ZQA A;  3C66 A;  4I2H A;  2O1P A;  4PHA A;  5J2I A;  1ZQO A;  4LT6 A;  9ICM A;  4Z6C A;  5J29 A;  7ICS A;  4KLS A;  5HRL A;  3H38 A;  4NKT A;  4X0A A;  4IG8 A;  4X0B A;  5HRI A;  5HR9 A;  4AT8 B;  3L9D A;  4YMO A;  1ZQF A;  4EP7 A;  4O5C A;  1NO5 A;  4RQ3 A;  5DKW A;  9ICG A;  5HRF A;  5DDY A;  2ZH2 A;  3LK9 A;  4LZD A;  4K4G A;  7ICF A;  4X4S A;  4X4U A;  9ICN A;  3HWT A;  1UET A;  3C2L A;  4YMN A;  1ZQM A;  1RZT A;  4KLD A;  3H39 A;  4K4I A;  5BOM A;  2ZH6 A;  8ICG A;  4K4H A;  3AQL A;  1ZQE A;  1ZJM A;  7ICQ A;  4RWO A;  4UB4 A;  4ATB B;  2PXI A;  4I2A A;  9ICS A;  4IQW A;  1ZQU A;  1FA0 A;  3TFS A;  1ZQY A;  4GXJ A;  5IIM A;  1ZQD A;  2B56 A;  7ICH A;  3RJF A;  4RQ2 A;  5J0T A;  5D46 A;  3ISB A;  1YLQ A;  2ZH9 A;  4AT8 A;  1V4A A;  2I9G A;  4F5P A;  2ID1 A;  1XSL A;  3C18 A;  5IIK A;  4QZH A;  7ICI A;  1ZQJ A;  4KLU A;  4M9J A;  1MIV A;  3B0Y A;  2BE3 A;  2DR8 A;  4UBB A;  1TV9 A;  4M47 A;  4MFA A;  9ICA A;  4RPZ A;  5J0X A;  5J2C A;  1TFY A;  5J2F A;  3OVB A;  2PBE A;  5F2V O;  5CJ7 A;  3V7J A;  4JWM A;  5J2H A;  4X4N A;  3C2M A;  4ATB A;  4RQ7 A;  4RPY A;  4RPX A;  1NOM A;  1VFG A;  1ZQH A;  4UBC A;  3HX0 A;  3ISD A;  8ICU A;  7ICK A;  3MBY A;  4KLJ A;  4M9G A;  4KLE A;  4M04 A;  2VAN A;  9ICW A;  8ICY A;  3JPT A;  2W9M A;  4NKU A;  4YCX A;  4AT7 A;  3OVS A;  4WC1 A;  8ICE A;  2BPC A;  5EOZ A;  4R66 A;  4Z6E A;  2BCR A;  3WFQ E;  5HRK A;  1BPX A;  4RQ4 A;  4F5N A;  4TUR A;  9ICO A;  1R8A A;  3RH5 A;  5J0S A;  3JPR A;  4I2C A;  4YD1 A;  4PGX A;  1BPE A;  4TUP A;  8ICI A;  5IIL A;  4X4O A;  5HC9 A;  4M9L A;  4FHV A;  4NLZ A;  4WBY A;  3V72 A;  1BPY A;  2ISP A;  5III A;  3HJ4 A;  2DRA A;  3RJI A;  3RH4 A;  1HUO A;  1JMS A;  1MQ3 A;  4X4P A;  7ICP A;  3JPN A;  4M5D A;  1BPD A;  5CR0 A;  4QZA A;  9ICJ A;  1KNY A;  2ZHB A;  1JQR A;  4E8F A;  5DB7 A;  1ZQG A;  4KLT A;  9ICQ A;  7ICM A;  3RJH A;  4RQ1 A;  5IIN A;  4P4O A;  3PNC A;  4M0A A;  7ICR A;  3UXO A;  9ICC A;  3AQN A;  1ZQZ A;  4P2H A; 
#chains in the Genus database with same CATH topology
 4WC0 A;  9ICE A;  9ICF A;  8ICH A;  4K8V A;  4X4Q A;  4LEY A;  4EBJ A;  3JPS A;  3B0X A;  2HN1 A;  3V7L A;  5J0W A;  3WFR E;  4K98 A;  4M2Y A;  4K99 A;  5CB1 A;  4I2J A;  2RFF A;  2GAF D;  4YN4 A;  4RT2 A;  4PH5 A;  4I27 A;  2FMP A;  5IIO A;  5J2E A;  5HRD A;  9ICL A;  5HRB A;  5D4B A;  4YD2 A;  9ICK A;  2GWS A;  3MGI A;  3C5G A;  5DBC A;  7ICO A;  4WQL A;  5J2B A;  4WCW A;  4I2F A;  3HIY A;  8ICN A;  4X4V A;  4KLM A;  8ICZ A;  2P66 A;  4AT7 B;  4QZF A;  4TUS A;  8ICX A;  5J2J A;  1ZQX A;  3HW8 A;  8ICT A;  4RQ5 A;  5D63 A;  4RWP A;  5DDM A;  4UAZ A;  4WC2 A;  4KLH A;  2DRB A;  4RT3 A;  4F5Q A;  4K9A A;  1HUZ A;  1BPZ A;  1UEU A;  2PFP A;  4PHP A;  2M2T A;  4N7R A;  5D61 A;  1ZQT A;  4M9N A;  1Q78 A;  1ZJN A;  4QZ9 A;  1KDH A;  5J0R A;  3JPP A;  4UAY A;  4WC3 A;  4GXI A;  4XJE A;  3UQ0 A;  4DOC A;  3PMN A;  3UXN A;  4RWN A;  3OUY A;  8ICP A;  1F5A A;  2FMS A;  7ICG A;  4EED A;  4WC7 A;  4LEZ A;  1ZQL A;  2HN2 A;  4MFC A;  4FHX A;  1RPL A;  3WFO A;  4K9B A;  4F5R A;  8ICK A;  9ICV A;  4NLN A;  4KLG A;  2BBJ A;  5HRE A;  3TFR A;  1ZQN A;  7ICE A;  8ICL A;  1VJ7 A;  4PHE A;  8ICF A;  8ICB A;  4UB1 A;  3MDA A;  4LZG A;  2O5A A;  4I2B A;  4MF2 A;  4E7X A;  5DB6 A;  5D49 A;  2ZH1 A;  5J0Y A;  4FH3 A;  7ICL A;  3HJ1 A;  4FH5 A;  3C2K A;  4O9M A;  4Z6F A;  3RJK A;  5CP2 A;  1ZQS A;  4LEV A;  4PGY A;  5CWR A;  9ICR A;  4MKP A;  4NY8 A;  4EGW A;  5HHI A;  4QZD A;  4X5V A;  8ICO A;  4XRH A;  4OAI Z;  2ZH5 A;  3WFP A;  1ZQV A;  5DBA A;  4FHY A;  4PHD A;  4UD5 A;  5DBB A;  3PHZ A;  4X4T A;  3NYB A;  4UB2 A;  3AQK A;  4NXU A;  4FO1 A;  2PFN A;  4WC4 A;  3NKU A;  2PFQ A;  2DR9 A;  4X4R A;  1KEJ A;  4IQT A;  3UPS A;  3OGU A;  4FO6 A;  1ZQQ A;  2IHO A;  4NXT A;  4RWQ A;  1PX5 A;  2ZH3 A;  4KLQ A;  3PML A;  4IQU A;  4EEB A;  3AU2 A;  4UB5 A;  4RQ6 A;  9ICT A;  5DB9 A;  1ZQW A;  8ICW A;  2PFO A;  4KLL A;  1MIY A;  4O68 A;  2NRK A;  1R8B A;  5J2G A;  2M2V A;  4UB3 A;  4O5K A;  9ICI A;  4LVS A;  5BOL A;  3MGH A;  4AT9 B;  2BCU A;  1R89 A;  3JPQ A;  4IQV A;  1MQ2 A;  9ICH A;  4JWN A;  2Q66 A;  4E80 A;  5J0U A;  3JZ0 A;  7ICV A;  4P4P A;  2M2U A;  5J2D A;  4FHP A;  4S3N A;  3OUY B;  4KB6 A;  2DVI A;  9ICB A;  1XSN A;  3OV7 A;  4UD4 A;  4O5E A;  3AUO A;  8ICQ A;  5J2K A;  4O69 A;  4WC5 A;  4WBZ A;  3C5F A;  3OWG A;  5D62 A;  4XUS A;  4O6A A;  4RQ8 A;  4KLF A;  3JCF A;  4QZG A;  2B4V A;  4NM1 A;  2B51 A;  3H3A A;  4GXK A;  2IHM A;  5IIJ A;  4XA5 A;  4TUQ A;  1MIW A;  4WOY A;  1ZQR A;  2IUB A;  5DED A;  4MF8 A;  5TZV A;  4NM2 A;  4DO9 A;  4WC6 A;  4RQ0 A;  1OU5 A;  1ZQC A;  8ICR A;  1R8C A;  2BCS A;  3MDC A;  4R63 A;  2ZH8 A;  4K96 A;  5JTG A;  1WOT A;  1ZQP A;  3K7D A;  4R64 A;  4AT9 A;  1JN3 A;  4MFF A;  3NVO A;  7ICN A;  3ER9 B;  4I2I A;  9ICU A;  2M2W A;  4KLI A;  1JAJ A;  4XQ7 A;  4WH5 A;  3ER8 C;  1ZQK A;  8ICM A;  3V7K A;  5J0O A;  4F5O A;  8ICC A;  5DEC A;  7ICT A;  8ICJ A;  5HRH A;  8ICS A;  3UQ2 A;  4NXX A;  2FCL A;  2ZHA A;  4I0U A;  3JYY A;  4R65 A;  2ISO A;  5DB8 A;  5CA7 A;  3ISC A;  3RJG A;  4I2E A;  4QZI A;  1ZQI A;  1TFW A;  1UEV A;  3UPQ A;  3ERC C;  2ZH7 A;  2BPF A;  4QZ8 A;  4P4M A;  4QZB A;  4I28 A;  5J0P A;  8ICV A;  5CHG A;  5CFU A;  4XQ8 A;  4UAW A;  4DOA A;  7ICJ A;  4QZC A;  4NLK A;  3GDX A;  4QZE A;  4LEW A;  2ZH4 A;  4DOB A;  2HHP A;  2DR7 A;  4OAF A;  4NXZ A;  2DR5 A;  4EBK A;  3AU6 A;  4PGQ A;  1TVA A;  4YMM A;  2FMQ A;  5J0Q A;  3OVA A;  1XSP A;  1Q79 A;  4M9H A;  3LQC B;  4I2G A;  3RJJ A;  3H37 A;  4PPX A;  3RJE A;  5HRG A;  2BPG A;  3AQM A;  4KM5 A;  9ICP A;  4I2D A;  1ZQB A;  4I29 A;  3JPO A;  8ICA A;  3WFS C;  9ICX A;  5J2A A;  2BCV A;  3K75 D;  5HHH A;  3UXP A;  2BCQ A;  5CFS A;  4KLO A;  1BPB A;  7ICU A;  5BPC A;  4FHW A;  4Z6D A;  3RH6 A;  1ZQA A;  2BBH A;  3C66 A;  4I2H A;  3MCR A;  2O1P A;  4PHA A;  5J2I A;  1ZQO A;  4LT6 A;  9ICM A;  4Z6C A;  5J29 A;  7ICS A;  4KLS A;  5HRL A;  2GA9 D;  3H38 A;  4NKT A;  4X0A A;  4IG8 A;  4X0B A;  5HRI A;  4JLX A;  3CK6 A;  5HR9 A;  4AT8 B;  3L9D A;  4YMO A;  1ZQF A;  4WQK A;  4EP7 A;  4O5C A;  1NO5 A;  4RQ3 A;  5DKW A;  9ICG A;  5HRF A;  5DDY A;  2ZH2 A;  3LK9 A;  4LZD A;  4K4G A;  7ICF A;  4X4S A;  4X4U A;  9ICN A;  3HWT A;  1UET A;  3C2L A;  4YMN A;  1ZQM A;  1RZT A;  4KLD A;  3H39 A;  4K4I A;  5BOM A;  2ZH6 A;  8ICG A;  5CFT A;  4K4H A;  3AQL A;  1ZQE A;  1ZJM A;  7ICQ A;  4RWO A;  4UB4 A;  4ATB B;  2PXI A;  4I2A A;  9ICS A;  4IQW A;  1ZQU A;  1FA0 A;  3TFS A;  1ZQY A;  4GXJ A;  5IIM A;  1ZQD A;  2B56 A;  5CHE A;  7ICH A;  4NXV A;  3RJF A;  4RQ2 A;  5J0T A;  5D46 A;  3ISB A;  1YLQ A;  2ZH9 A;  4AT8 A;  1V4A A;  2I9G A;  4F5P A;  2ID1 A;  1XSL A;  3C18 A;  5IIK A;  4QZH A;  4O67 A;  7ICI A;  1ZQJ A;  4KLU A;  4M9J A;  1MIV A;  3B0Y A;  2BE3 A;  2DR8 A;  4UBB A;  4OAH A;  3EF2 A;  1TV9 A;  4M47 A;  4MFA A;  9ICA A;  4RPZ A;  5J0X A;  5J2C A;  1TFY A;  5J2F A;  3OVB A;  2PBE A;  5F2V O;  5CJ7 A;  3V7J A;  4JWM A;  4X4N A;  5J2H A;  3NWI A;  3C2M A;  4ATB A;  4RQ7 A;  4RPY A;  4RPX A;  1NOM A;  1VFG A;  1ZQH A;  4UBC A;  3HX0 A;  3ISD A;  8ICU A;  7ICK A;  3MBY A;  4KLJ A;  4M9G A;  4KLE A;  4M04 A;  2VAN A;  9ICW A;  8ICY A;  4OAG A;  4NKU A;  4YCX A;  2W9M A;  4AT7 A;  3JPT A;  3OVS A;  4WC1 A;  8ICE A;  2BPC A;  5EOZ A;  4R66 A;  4Z6E A;  2BCR A;  3WFQ E;  5HRK A;  1BPX A;  4RQ4 A;  5B3Q A;  4F5N A;  4TUR A;  9ICO A;  1R8A A;  3RH5 A;  5J0S A;  3JPR A;  4I2C A;  4YD1 A;  4PGX A;  1BPE A;  4TUP A;  8ICI A;  5IIL A;  4X4O A;  5HC9 A;  4M9L A;  4HX0 A;  4FHV A;  4NLZ A;  4WBY A;  3V72 A;  1BPY A;  2ISP A;  5III A;  3HJ4 A;  2DRA A;  3RJI A;  3RH4 A;  1HUO A;  4JLZ A;  1JMS A;  1MQ3 A;  4X4P A;  4K97 A;  7ICP A;  3JPN A;  4M5D A;  1BPD A;  5CR0 A;  4QZA A;  9ICJ A;  1KNY A;  2ZHB A;  1JQR A;  5B3P A;  4EV6 A;  4E8F A;  5DB7 A;  2EWR A;  1ZQG A;  4KLT A;  9ICQ A;  7ICM A;  3RJH A;  4RQ1 A;  5IIN A;  1GPJ A;  4P4O A;  3PNC A;  4M0A A;  7ICR A;  3UXO A;  4NXW A;  9ICC A;  3AQN A;  1ZQZ A;  4P2H A; 
#chains in the Genus database with same CATH homology
 4WC0 A;  9ICE A;  9ICF A;  8ICH A;  4K8V A;  4X4Q A;  4LEY A;  4EBJ A;  3JPS A;  3B0X A;  3V7L A;  5J0W A;  3WFR E;  4K98 A;  4M2Y A;  4K99 A;  5CB1 A;  4I2J A;  2RFF A;  4YN4 A;  4RT2 A;  4PH5 A;  4I27 A;  2FMP A;  5IIO A;  5J2E A;  5HRD A;  9ICL A;  5HRB A;  5D4B A;  4YD2 A;  9ICK A;  2GWS A;  3MGI A;  3C5G A;  5DBC A;  7ICO A;  5J2B A;  4WCW A;  4I2F A;  3HIY A;  8ICN A;  4X4V A;  4KLM A;  8ICZ A;  2P66 A;  4AT7 B;  4QZF A;  4TUS A;  8ICX A;  5J2J A;  1ZQX A;  3HW8 A;  8ICT A;  4RQ5 A;  5DDM A;  4RWP A;  4UAZ A;  4WC2 A;  4KLH A;  2DRB A;  4RT3 A;  4F5Q A;  4K9A A;  1HUZ A;  1BPZ A;  1UEU A;  2PFP A;  4PHP A;  2M2T A;  1ZQT A;  4M9N A;  1Q78 A;  1ZJN A;  4QZ9 A;  1KDH A;  5J0R A;  3JPP A;  4UAY A;  4WC3 A;  4GXI A;  4DOC A;  3UQ0 A;  3PMN A;  3UXN A;  4RWN A;  3OUY A;  8ICP A;  1F5A A;  2FMS A;  7ICG A;  4WC7 A;  4LEZ A;  1ZQL A;  4MFC A;  4FHX A;  1RPL A;  3WFO A;  4K9B A;  4F5R A;  8ICK A;  9ICV A;  4NLN A;  4KLG A;  3TFR A;  5HRE A;  7ICE A;  1ZQN A;  8ICL A;  1VJ7 A;  4PHE A;  8ICF A;  8ICB A;  4UB1 A;  3MDA A;  4LZG A;  2O5A A;  4I2B A;  4MF2 A;  4E7X A;  5DB6 A;  5D49 A;  2ZH1 A;  5J0Y A;  4FH3 A;  7ICL A;  3HJ1 A;  4FH5 A;  3C2K A;  4O9M A;  4Z6F A;  3RJK A;  5CP2 A;  1ZQS A;  4LEV A;  4PGY A;  5CWR A;  9ICR A;  4MKP A;  4NY8 A;  5HHI A;  8ICO A;  4QZD A;  4X5V A;  4XRH A;  4OAI Z;  2ZH5 A;  3WFP A;  1ZQV A;  5DBA A;  4FHY A;  4PHD A;  4UD5 A;  5DBB A;  4X4T A;  3NYB A;  4UB2 A;  3AQK A;  4NXU A;  2PFN A;  4WC4 A;  2PFQ A;  2DR9 A;  4X4R A;  1KEJ A;  4IQT A;  3UPS A;  3OGU A;  4FO6 A;  1ZQQ A;  4NXT A;  4RWQ A;  1PX5 A;  2ZH3 A;  4KLQ A;  3PML A;  4IQU A;  3AU2 A;  4UB5 A;  4RQ6 A;  9ICT A;  5DB9 A;  1ZQW A;  8ICW A;  2PFO A;  4KLL A;  1MIY A;  4O68 A;  2NRK A;  1R8B A;  5J2G A;  2M2V A;  4UB3 A;  4O5K A;  9ICI A;  4LVS A;  5BOL A;  3MGH A;  4AT9 B;  2BCU A;  1R89 A;  3JPQ A;  4IQV A;  1MQ2 A;  9ICH A;  4JWN A;  2Q66 A;  4E80 A;  5J0U A;  3JZ0 A;  7ICV A;  4P4P A;  2M2U A;  5J2D A;  4FHP A;  4S3N A;  3OUY B;  4KB6 A;  2DVI A;  9ICB A;  1XSN A;  3OV7 A;  4UD4 A;  4O5E A;  3AUO A;  8ICQ A;  5J2K A;  4O69 A;  4WC5 A;  4WBZ A;  3C5F A;  4XUS A;  4O6A A;  4RQ8 A;  4KLF A;  4QZG A;  2B4V A;  4NM1 A;  2B51 A;  3H3A A;  4GXK A;  2IHM A;  5IIJ A;  4XA5 A;  4TUQ A;  1MIW A;  4WOY A;  1ZQR A;  5DED A;  4MF8 A;  5TZV A;  4NM2 A;  4DO9 A;  4WC6 A;  4RQ0 A;  1OU5 A;  1ZQC A;  8ICR A;  1R8C A;  2BCS A;  3MDC A;  4R63 A;  2ZH8 A;  4K96 A;  1ZQP A;  1WOT A;  4R64 A;  4AT9 A;  1JN3 A;  4MFF A;  7ICN A;  4I2I A;  9ICU A;  2M2W A;  4KLI A;  1JAJ A;  4XQ7 A;  1ZQK A;  8ICM A;  3V7K A;  5J0O A;  4F5O A;  8ICC A;  5DEC A;  7ICT A;  8ICJ A;  5HRH A;  8ICS A;  3UQ2 A;  4NXX A;  2ZHA A;  4R65 A;  3JYY A;  2ISO A;  5DB8 A;  5CA7 A;  3ISC A;  3RJG A;  4I2E A;  4QZI A;  1ZQI A;  1TFW A;  1UEV A;  3UPQ A;  2ZH7 A;  2BPF A;  4QZ8 A;  4P4M A;  4QZB A;  4I28 A;  5J0P A;  8ICV A;  5CHG A;  4XQ8 A;  4UAW A;  4DOA A;  7ICJ A;  4QZC A;  4NLK A;  3GDX A;  4QZE A;  4LEW A;  2ZH4 A;  4DOB A;  2HHP A;  2DR7 A;  4OAF A;  4NXZ A;  2DR5 A;  4EBK A;  3AU6 A;  4PGQ A;  1TVA A;  4YMM A;  2FMQ A;  5J0Q A;  3OVA A;  1XSP A;  1Q79 A;  4M9H A;  3LQC B;  4I2G A;  3RJJ A;  3H37 A;  4PPX A;  3RJE A;  5HRG A;  2BPG A;  3AQM A;  4KM5 A;  9ICP A;  4I2D A;  1ZQB A;  4I29 A;  3JPO A;  8ICA A;  3WFS C;  9ICX A;  5J2A A;  2BCV A;  3K75 D;  5HHH A;  3UXP A;  2BCQ A;  4KLO A;  1BPB A;  7ICU A;  5BPC A;  4FHW A;  4Z6D A;  3RH6 A;  1ZQA A;  3C66 A;  4I2H A;  2O1P A;  4PHA A;  5J2I A;  1ZQO A;  4LT6 A;  9ICM A;  4Z6C A;  5J29 A;  7ICS A;  4KLS A;  5HRL A;  3H38 A;  4NKT A;  4X0A A;  4IG8 A;  4X0B A;  5HRI A;  4JLX A;  5HR9 A;  4AT8 B;  3L9D A;  4YMO A;  1ZQF A;  4EP7 A;  4O5C A;  1NO5 A;  4RQ3 A;  5DKW A;  9ICG A;  5HRF A;  5DDY A;  2ZH2 A;  3LK9 A;  4LZD A;  4K4G A;  7ICF A;  4X4S A;  4X4U A;  9ICN A;  3HWT A;  1UET A;  3C2L A;  4YMN A;  1ZQM A;  1RZT A;  4KLD A;  3H39 A;  4K4I A;  5BOM A;  2ZH6 A;  8ICG A;  4K4H A;  3AQL A;  1ZQE A;  1ZJM A;  7ICQ A;  4RWO A;  4UB4 A;  4ATB B;  2PXI A;  4I2A A;  9ICS A;  4IQW A;  1ZQU A;  1FA0 A;  3TFS A;  1ZQY A;  4GXJ A;  5IIM A;  1ZQD A;  2B56 A;  7ICH A;  4NXV A;  3RJF A;  4RQ2 A;  5J0T A;  5D46 A;  3ISB A;  1YLQ A;  2ZH9 A;  4AT8 A;  1V4A A;  2I9G A;  4F5P A;  2ID1 A;  1XSL A;  3C18 A;  5IIK A;  4QZH A;  4O67 A;  7ICI A;  1ZQJ A;  4KLU A;  4M9J A;  1MIV A;  3B0Y A;  2BE3 A;  2DR8 A;  4UBB A;  4OAH A;  1TV9 A;  4M47 A;  4MFA A;  9ICA A;  4RPZ A;  5J0X A;  5J2C A;  1TFY A;  5J2F A;  3OVB A;  2PBE A;  5F2V O;  5CJ7 A;  3V7J A;  4JWM A;  4X4N A;  5J2H A;  3C2M A;  4ATB A;  4RQ7 A;  4RPY A;  4RPX A;  1NOM A;  1VFG A;  1ZQH A;  4UBC A;  3HX0 A;  3ISD A;  8ICU A;  7ICK A;  3MBY A;  4KLJ A;  4M9G A;  4KLE A;  4M04 A;  2VAN A;  9ICW A;  8ICY A;  4OAG A;  4NKU A;  2W9M A;  4YCX A;  4AT7 A;  3JPT A;  3OVS A;  4WC1 A;  8ICE A;  2BPC A;  5EOZ A;  4R66 A;  4Z6E A;  2BCR A;  3WFQ E;  5HRK A;  1BPX A;  4RQ4 A;  4F5N A;  4TUR A;  9ICO A;  1R8A A;  3RH5 A;  5J0S A;  3JPR A;  4I2C A;  4YD1 A;  4PGX A;  1BPE A;  4TUP A;  8ICI A;  5IIL A;  4X4O A;  5HC9 A;  4M9L A;  4FHV A;  4NLZ A;  4WBY A;  3V72 A;  1BPY A;  2ISP A;  5III A;  3HJ4 A;  2DRA A;  3RJI A;  3RH4 A;  1HUO A;  4JLZ A;  1JMS A;  1MQ3 A;  4X4P A;  4K97 A;  7ICP A;  3JPN A;  4M5D A;  1BPD A;  5CR0 A;  4QZA A;  9ICJ A;  1KNY A;  2ZHB A;  1JQR A;  4E8F A;  5DB7 A;  1ZQG A;  4KLT A;  9ICQ A;  7ICM A;  3RJH A;  4RQ1 A;  5IIN A;  4P4O A;  3PNC A;  4M0A A;  7ICR A;  3UXO A;  4NXW A;  9ICC A;  3AQN A;  1ZQZ A;  4P2H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...