4FHVA

Crystal structures of the cid1 poly (u) polymerase reveal the mechanism for utp selectivity - mgctp bound
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
338
structure length
323
Chain Sequence
SHKEFTKFCYEVYNEIKISDKEFKEKRAALDTLRLCLKRISPDAELVAFGSLESGLALKNSDMDLCVLMDSRVQSDTIALQFYEELIAEGFEGKFLQRARIPIIKLTSDTKNGFGASFQCDIGFNNRLAIHNTLLLSSYTKLDARLKPMVLLVKHWAKRKQINSPYFGTLSSYGYVLMVLYYLIHVIKPPVFPNLLLSPLKQEKIVDGFDVGFDDKLEDIPPSQNYSSLGSLLHGFFRFYAYKFEPREKVVTFRRPDGYLTKQEKGWTRYILAIEDPFEISHNVGRTVSSSGLYRIRGEFMAASRLLNSRSYPIPYDSLFEEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Poly(A) RNA polymerase protein cid1
publication title Crystal structures of the Cid1 poly (U) polymerase reveal the mechanism for UTP selectivity.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transferase
total genus 109
structure length 323
sequence length 338
ec nomenclature ec 2.7.7.19: Polynucleotide adenylyltransferase.
pdb deposition date 2012-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01909 NTP_transf_2 Nucleotidyltransferase domain
A PF03828 PAP_assoc Cid1 family poly A polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.10 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain Poly(a)-polymerase, middle domain 4fhvA01
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4fhvA02
4WBYA 5J2BA 2DR5A 2BPFA 5DDMA 8ICZA 8ICXA 3LQCB 4RWOA 8ICAA 1Q78A 9ICHA 1F5AA 4UB1A 4YCXA 3RJHA 4QZCA 5TZVA 4LZDA 4QZGA 2PFPA 4MFCA 5F2VO 7ICRA 4EP7A 4NLNA 4I2BA 1ZQVA 4X5VA 4QZEA 5CHGA 4I29A 4P2HA 2M2WA 5J0QA 1RZTA 2DVIA 5DBAA 8ICYA 2M2UA 4WBZA 4LT6A 5J2HA 4I2FA 4WC3A 7ICQA 5CR0A 1WOTA 4FHVA 4AT8B 1R8AA 7ICNA 5HRKA 4F5QA 5CA7A 3PMLA 5CWRA 4EBJA 3UPQA 2PFNA 1JQRA 8ICIA 4IQTA 2ZHAA 5J2DA 4M9LA 3JPPA 9ICQA 3H38A 1BPYA 4NLZA 1KNYA 4LZGA 1NO5A 7ICHA 9ICOA 4M47A 3WFSC 2ISPA 4GXIA 4I2CA 1PX5A 4UB5A 7ICKA 4XUSA 3OVAA 2ZH8A 2PFQA 3OUYA 4PH5A 3RJKA 5DKWA 8ICUA 4UAWA 1YLQA 1ZQRA 1TFYA 4R65A 4RQ7A 4K4GA 4GXKA 2ISOA 1HUOA 4PGXA 4WC2A 2ID1A 5BOMA 4X4NA 2PFOA 9ICBA 1ZQBA 2O5AA 2ZH7A 4RPXA 3WFQE 4AT9A 4I2DA 5HRBA 3HIYA 8ICNA 4X4PA 9ICSA 3B0XA 4UBCA 4I2IA 4X4TA 4FHPA 1UEUA 3C5GA 4KLIA 4IQVA 1MQ2A 3C2LA 4PHDA 4TURA 3ISBA 5BOLA 4S3NA 5HHHA 1V4AA 4M0AA 9ICNA 2ZH2A 1RPLA 1ZQMA 8ICTA 5CJ7A 4UAYA 4DO9A 3V7LA 4KLJA 5HREA 4ATBA 4I2GA 3AUOA 8ICBA 2M2TA 4UB4A 4MFAA 4PGYA 3AQLA 1ZQDA 2FMQA 2DRAA 1ZQUA 1ZJMA 2O1PA 4QZIA 1BPZA 2W9MA 2VANA 3HWTA 1HUZA 1NOMA 4YD1A 1XSNA 4I28A 4KLQA 4Z6DA 2BPCA 3JPNA 4F5OA 3RJFA 8ICKA 8ICVA 1R8CA 2ZH1A 3UXNA 1JMSA 4QZ9A 4RQ5A 4RWQA 5HRGA 2PXIA 3JPRA 2DR9A 3MGIA 9ICKA 2BCSA 3JPQA 4NKTA 2DRBA 1KEJA 4RQ3A 4NKUA 3HW8A 3OUYB 5DDYA 3AQNA 4RWPA 4F5PA 3MDCA 4FH3A 1UETA 3RH4A 4UD5A 7ICEA 2Q66A 7ICFA 3H37A 4JWNA 1ZQTA 1ZQQA 5IIIA 4UB2A 1ZQSA 3LK9A 3C5FA 3RJGA 8ICWA 4Z6FA 4O5EA 9ICLA 3H39A 3AQKA 9ICXA 4FO6A 4RT3A 7ICJA 4XA5A 4AT9B 8ICOA 4QZBA 1ZQFA 4PGQA 2HHPA 4P4OA 3HJ4A 1ZQZA 5J2GA 4MFFA 7ICVA 4QZHA 4WC0A 4EBKA 2IHMA 3UQ2A 5HRHA 3RH5A 1BPXA 4P4MA 1ZQWA 9ICIA 2ZH6A 3C66A 4JWMA 8ICFA 1ZQKA 4RQ6A 4X0AA 3ISCA 4ATBB 3PMNA 2BCRA 5HR9A 4I2EA 4XRHA 5HRDA 4KLTA 3OV7A 4M9NA 4TUPA 1ZQAA 1ZQJA 5IIKA 3AU2A 5HRFA 2I9GA 1ZQEA 2BCQA 3WFOA 1FA0A 4FHXA 4PPXA 5DECA 4O5CA 4XQ8A 8ICSA 7ICTA 4KLGA 7ICIA 4NM2A 7ICUA 5DBBA 5DBCA 4YMMA 3C2MA 1JN3A 3WFPA 5J2IA 1OU5A 2BCVA 4TUSA 2M2VA 4M9JA 4QZDA 4AT7A 7ICLA 9ICRA 3V7KA 4NXZA 4Z6EA 4RPYA 1BPEA 1XSLA 4RT2A 3AQMA 1TVAA 4DOAA 4NY8A 3MBYA 1ZQNA 2BCUA 5J2FA 4R66A 9ICMA 3AU6A 4WCWA 1MIVA 2ZH4A 1ZQPA 3TFRA 4FHWA 4PHAA 3OGUA 2ZH5A 2DR8A 9ICPA 5EOZA 3RJIA 9ICJA 4I2HA 4RQ4A 4X4QA 4M2YA 4K4IA 3C18A 4X4OA 4DOCA 8ICRA 5J2EA 4E80A 4E8FA 3H3AA 4MF8A 1MQ3A 3MGHA 1UEVA 4KLHA 5J29A 4YN4A 3UXPA 3WFRE 7ICMA 2B56A 5J0WA 4RQ2A 4NM1A 2NRKA 4I2AA 4R64A 4UBBA 4RWNA 4Z6CA 4PHEA 1ZQCA 2B51A 3HJ1A 3B0YA 4IG8A 4X4UA 4M04A 4UB3A 4LVSA 8ICPA 9ICCA 1BPBA 1ZQLA 4IQUA 4WC5A 4WC7A 3TFSA 9ICVA 4WC4A 5J0YA 4DOBA 4X4SA 4F5RA 4YMNA 4RQ1A 5IIOA 3UQ0A 4M5DA 2ZH3A 4I27A 3JYYA 5IIJA 3GDXA 3C2KA 5J0UA 3NYBA 4KLFA 1ZQHA 3ISDA 9ICTA 2RFFA 1R8BA 5IINA 5DB9A 2ZH9A 5CB1A 3RH6A 4KLOA 2BE3A 8ICMA 4GXJA 4PHPA 1XSPA 8ICJA 3RJJA 9ICGA 1JAJA 3UPSA 5D4BA 4WC1A 4KLSA 4AT7B 4QZFA 8ICEA 1MIWA 3V7JA 2PBEA 4KLMA 3UXOA 4QZAA 3OVSA 4I2JA 9ICAA 3OVBA 4X0BA 5J0XA 5IILA 1Q79A 1ZQOA 4YD2A 2B4VA 4M9HA 4O9MA 4M9GA 5CP2A 8ICHA 5HC9A 5J2CA 1KDHA 2FMSA 1BPDA 4RPZA 4FH5A 3RJEA 4KLUA 2FMPA 5J0TA 3K75D 4XQ7A 5D49A 7ICSA 4AT8A 1MIYA 4F5NA 4KLEA 5J0PA 5IIMA 3JPTA 5HHIA 4X4RA 3HX0A 9ICFA 1ZQYA 4KLLA 4UAZA 4P4PA 4KLDA 1ZQIA 8ICCA 8ICLA 5J0OA 4K4HA 4YMOA 5DEDA 3PNCA 3JPSA 2P66A 3V72A 5D46A 5HRLA 7ICPA 1ZJNA 9ICUA 4R63A 5HRIA 2BPGA 1ZQXA 5J0RA 4WC6A 8ICGA 1TFWA 4E7XA 4X4VA 5DB7A 2GWSA 1VFGA 9ICWA 8ICQA 5DB8A 5J2AA 2ZHBA 1VJ7A 5DB6A 4QZ8A 4UD4A 5J0SA 7ICOA 4TUQA 7ICGA 3JZ0A 1TV9A 5J2JA 4RQ0A 9ICEA 5J2KA 4O5KA 1R89A 3L9DA 2DR7A 4NLKA 3JPOA 4MF2A 5BPCA 4IQWA 1ZQGA 4RQ8A 4FHYA 3MDAA
chains in the Genus database with same CATH superfamily
4WBYA 2DR5A 5J2BA 2BPFA 3ER8C 5DDMA 8ICZA 8ICXA 3LQCB 4RWOA 8ICAA 1Q78A 9ICHA 1F5AA 4UB1A 4JLXA 4YCXA 3RJHA 4QZCA 5TZVA 4LZDA 4QZGA 2PFPA 4MFCA 5F2VO 7ICRA 4EP7A 4NLNA 4I2BA 1ZQVA 4X5VA 4QZEA 4OAIZ 5CHGA 4I29A 4P2HA 2M2WA 5J0QA 2DVIA 1RZTA 5DBAA 8ICYA 2M2UA 4WBZA 4LT6A 2EWRA 5J2HA 4I2FA 4WC3A 7ICQA 5CR0A 1WOTA 4FHVA 4AT8B 1R8AA 7ICNA 4NXVA 5HRKA 4F5QA 5CA7A 3PMLA 5CWRA 4EBJA 3UPQA 2PFNA 4NXXA 1JQRA 8ICIA 4IQTA 2ZHAA 5J2DA 4M9LA 3JPPA 9ICQA 3H38A 2HN1A 5JTGA 1BPYA 4NLZA 1KNYA 4LZGA 1NO5A 7ICHA 9ICOA 4M47A 3WFSC 2ISPA 4GXIA 3NKUA 4I2CA 1PX5A 5B3PA 4UB5A 7ICKA 3OVAA 4XUSA 2ZH8A 2PFQA 3OUYA 4PH5A 3RJKA 5DKWA 2FCLA 8ICUA 4UAWA 1YLQA 1ZQRA 1TFYA 4R65A 4RQ7A 4K4GA 4GXKA 2ISOA 1HUOA 4PGXA 4WC2A 2ID1A 5BOMA 4X4NA 2PFOA 9ICBA 4K9BA 1ZQBA 2O5AA 4EGWA 4WH5A 2ZH7A 4RPXA 3WFQE 4AT9A 4I2DA 5HRBA 3HIYA 8ICNA 4WQKA 4X4PA 9ICSA 3B0XA 4UBCA 4I2IA 4X4TA 4FHPA 1UEUA 3C5GA 4KLIA 4IQVA 2HN2A 1MQ2A 3C2LA 4PHDA 4TURA 1GPJA 3ISBA 5BOLA 4S3NA 5HHHA 1V4AA 4M0AA 9ICNA 2ZH2A 1RPLA 1ZQMA 8ICTA 5CJ7A 4UAYA 4DO9A 3V7LA 4KLJA 5HREA 4OAGA 4ATBA 2GA9D 4I2GA 3AUOA 8ICBA 2M2TA 4UB4A 4MFAA 4EV6A 4PGYA 3AQLA 1ZQDA 2FMQA 2DRAA 1ZQUA 1ZJMA 2O1PA 4QZIA 4KB6A 1BPZA 5CFUA 2W9MA 2VANA 3HWTA 1HUZA 1NOMA 4YD1A 1XSNA 4I28A 4KLQA 4Z6DA 2BPCA 3JPNA 4F5OA 3RJFA 8ICKA 8ICVA 1R8CA 2ZH1A 3UXNA 1JMSA 4QZ9A 4RQ5A 4RWQA 5HRGA 2PXIA 2DR9A 3JPRA 3MGIA 4NXUA 2BCSA 9ICKA 3JPQA 4NKTA 2DRBA 1KEJA 4RQ3A 4NKUA 3HW8A 3OUYB 5DDYA 3AQNA 4RWPA 4K9AA 4F5PA 3MDCA 4FH3A 1UETA 3RH4A 4UD5A 7ICEA 2Q66A 7ICFA 3H37A 3OWGA 4JWNA 1ZQTA 1ZQQA 5IIIA 4MKPA 4UB2A 1ZQSA 3LK9A 3C5FA 3RJGA 8ICWA 4Z6FA 4OAFA 4O5EA 9ICLA 3H39A 4O68A 3AQKA 9ICXA 4FO6A 4RT3A 7ICJA 4AT9B 4XA5A 8ICOA 4QZBA 1ZQFA 4LEVA 4PGQA 2HHPA 4P4OA 3HJ4A 3ERCC 1ZQZA 5J2GA 4MFFA 7ICVA 4QZHA 4WC0A 4EBKA 2IHMA 3UQ2A 5HRHA 3RH5A 1BPXA 4P4MA 1ZQWA 9ICIA 2ZH6A 3C66A 4JWMA 8ICFA 4K96A 5CFTA 1ZQKA 4RQ6A 4X0AA 3ISCA 4ATBB 3PMNA 2BCRA 5HR9A 4I2EA 4FO1A 4XRHA 5HRDA 4KLTA 3OV7A 4M9NA 4TUPA 1ZQAA 1ZQJA 5IIKA 3AU2A 4O69A 5HRFA 2I9GA 1ZQEA 2BCQA 3WFOA 1FA0A 4FHXA 3NWIA 4PPXA 5DECA 4O5CA 4XQ8A 8ICSA 7ICTA 4K99A 4KLGA 7ICIA 4NM2A 7ICUA 5DBBA 5DBCA 4O67A 4YMMA 5B3QA 3C2MA 1JN3A 3WFPA 5J2IA 1OU5A 2BCVA 4TUSA 2M2VA 4M9JA 4K8VA 4QZDA 4AT7A 7ICLA 3NVOA 9ICRA 3V7KA 4NXZA 4Z6EA 4RPYA 1BPEA 1XSLA 4RT2A 3AQMA 1TVAA 4DOAA 4NY8A 3MBYA 1ZQNA 2BCUA 5J2FA 4R66A 9ICMA 5D62A 3AU6A 4EEDA 4WCWA 1MIVA 2ZH4A 3CK6A 1ZQPA 3TFRA 4FHWA 4PHAA 2IHOA 3OGUA 2ZH5A 2DR8A 9ICPA 5EOZA 4JLZA 3RJIA 9ICJA 4I2HA 4RQ4A 4X4QA 5D63A 4M2YA 4K4IA 3C18A 4X4OA 5CHEA 4DOCA 8ICRA 5J2EA 4E80A 4E8FA 2IUBA 3H3AA 4MF8A 1MQ3A 4K98A 4NXTA 3MGHA 5CFSA 5D61A 1UEVA 3JCFA 4KLHA 5J29A 4KM5A 4YN4A 3UXPA 3WFRE 4N7RA 2B56A 5J0WA 7ICMA 4RQ2A 4NM1A 2NRKA 4I2AA 2BBHA 4R64A 4RWNA 4UBBA 4Z6CA 4PHEA 1ZQCA 4LEZA 2B51A 3HJ1A 3B0YA 4IG8A 4X4UA 4M04A 4LEYA 4UB3A 4LVSA 8ICPA 9ICCA 1BPBA 1ZQLA 4IQUA 4WC5A 4XJEA 4WC7A 3TFSA 9ICVA 4WC4A 5J0YA 4DOBA 4X4SA 4F5RA 4YMNA 4RQ1A 5IIOA 3UQ0A 4M5DA 2ZH3A 4I27A 3JYYA 5IIJA 4O6AA 3GDXA 3C2KA 5J0UA 3NYBA 4KLFA 1ZQHA 3ISDA 9ICTA 4I0UA 2RFFA 1R8BA 5IINA 5DB9A 2ZH9A 5CB1A 3RH6A 2GAFD 4KLOA 2BE3A 8ICMA 4GXJA 4PHPA 1XSPA 8ICJA 3RJJA 9ICGA 1JAJA 3UPSA 5D4BA 4WC1A 4KLSA 4AT7B 4QZFA 8ICEA 4EEBA 1MIWA 3V7JA 2PBEA 4KLMA 3UXOA 4WQLA 4QZAA 3OVSA 4I2JA 9ICAA 3OVBA 4X0BA 5J0XA 5IILA 1Q79A 1ZQOA 4YD2A 2B4VA 4M9HA 4O9MA 4M9GA 5CP2A 8ICHA 5HC9A 3EF2A 5J2CA 1KDHA 2FMSA 1BPDA 4RPZA 4FH5A 3K7DA 4HX0A 3RJEA 4KLUA 2FMPA 5J0TA 3K75D 4XQ7A 5D49A 7ICSA 4AT8A 1MIYA 4F5NA 4KLEA 5J0PA 5IIMA 2BBJA 4X4RA 5HHIA 3JPTA 3HX0A 9ICFA 1ZQYA 4KLLA 4UAZA 4P4PA 4KLDA 1ZQIA 8ICCA 8ICLA 5J0OA 4K4HA 4YMOA 5DEDA 3PNCA 3JPSA 2P66A 3V72A 4NXWA 4WOYA 3PHZA 5D46A 5HRLA 3ER9B 7ICPA 1ZJNA 9ICUA 4R63A 5HRIA 2BPGA 1ZQXA 5J0RA 4WC6A 8ICGA 1TFWA 4E7XA 4X4VA 5DB7A 2GWSA 1VFGA 9ICWA 8ICQA 5DB8A 2ZHBA 5J2AA 1VJ7A 5DB6A 4QZ8A 4UD4A 5J0SA 7ICOA 4K97A 4TUQA 3MCRA 4OAHA 3JZ0A 1TV9A 7ICGA 5J2JA 4RQ0A 9ICEA 5J2KA 4O5KA 1R89A 2DR7A 3L9DA 4NLKA 3JPOA 4MF2A 5BPCA 4IQWA 4LEWA 1ZQGA 4RQ8A 4FHYA 3MDAA
chains in the Genus database with same CATH topology
4WBYA 2DR5A 5J2BA 2BPFA 5DDMA 8ICZA 8ICXA 3LQCB 4RWOA 8ICAA 1Q78A 9ICHA 1F5AA 4UB1A 4JLXA 4YCXA 3RJHA 4QZCA 5TZVA 4LZDA 4QZGA 2PFPA 4MFCA 5F2VO 7ICRA 4EP7A 4NLNA 4I2BA 1ZQVA 4X5VA 4QZEA 4OAIZ 5CHGA 4I29A 4P2HA 2M2WA 5J0QA 2DVIA 1RZTA 5DBAA 8ICYA 2M2UA 4WBZA 4LT6A 5J2HA 4I2FA 4WC3A 7ICQA 5CR0A 1WOTA 4FHVA 4AT8B 1R8AA 7ICNA 4NXVA 5HRKA 4F5QA 5CA7A 3PMLA 5CWRA 4EBJA 3UPQA 2PFNA 4NXXA 1JQRA 8ICIA 4IQTA 2ZHAA 5J2DA 4M9LA 3JPPA 9ICQA 3H38A 1BPYA 4NLZA 1KNYA 4LZGA 1NO5A 7ICHA 9ICOA 4M47A 3WFSC 2ISPA 4GXIA 4I2CA 1PX5A 4UB5A 7ICKA 3OVAA 4XUSA 2ZH8A 2PFQA 3OUYA 4PH5A 3RJKA 5DKWA 8ICUA 4UAWA 1YLQA 1ZQRA 1TFYA 4R65A 4RQ7A 4K4GA 4GXKA 2ISOA 1HUOA 4PGXA 4WC2A 2ID1A 5BOMA 4X4NA 2PFOA 9ICBA 4K9BA 1ZQBA 2O5AA 2ZH7A 4RPXA 3WFQE 4AT9A 4I2DA 5HRBA 3HIYA 8ICNA 4X4PA 9ICSA 3B0XA 4UBCA 4I2IA 4X4TA 4FHPA 1UEUA 3C5GA 4KLIA 4IQVA 1MQ2A 3C2LA 4PHDA 4TURA 3ISBA 5BOLA 4S3NA 5HHHA 1V4AA 4M0AA 9ICNA 2ZH2A 1RPLA 1ZQMA 8ICTA 5CJ7A 4UAYA 4DO9A 3V7LA 4KLJA 5HREA 4OAGA 4ATBA 4I2GA 3AUOA 8ICBA 2M2TA 4UB4A 4MFAA 4PGYA 3AQLA 1ZQDA 2FMQA 2DRAA 1ZQUA 1ZJMA 2O1PA 4QZIA 4KB6A 1BPZA 2W9MA 2VANA 3HWTA 1HUZA 1NOMA 4YD1A 1XSNA 4I28A 4KLQA 4Z6DA 2BPCA 3JPNA 4F5OA 3RJFA 8ICKA 8ICVA 1R8CA 2ZH1A 3UXNA 1JMSA 4QZ9A 4RQ5A 4RWQA 5HRGA 2PXIA 2DR9A 3JPRA 3MGIA 4NXUA 2BCSA 9ICKA 3JPQA 4NKTA 2DRBA 1KEJA 4RQ3A 4NKUA 3HW8A 3OUYB 5DDYA 3AQNA 4RWPA 4K9AA 4F5PA 3MDCA 4FH3A 1UETA 3RH4A 4UD5A 7ICEA 2Q66A 7ICFA 3H37A 4JWNA 1ZQTA 1ZQQA 5IIIA 4MKPA 4UB2A 1ZQSA 3LK9A 3C5FA 3RJGA 8ICWA 4Z6FA 4OAFA 4O5EA 9ICLA 3H39A 4O68A 3AQKA 9ICXA 4FO6A 4RT3A 7ICJA 4AT9B 4XA5A 8ICOA 4QZBA 1ZQFA 4LEVA 4PGQA 2HHPA 4P4OA 3HJ4A 1ZQZA 5J2GA 4MFFA 7ICVA 4QZHA 4WC0A 4EBKA 2IHMA 3UQ2A 5HRHA 3RH5A 1BPXA 4P4MA 1ZQWA 9ICIA 2ZH6A 3C66A 4JWMA 8ICFA 4K96A 1ZQKA 4RQ6A 4X0AA 3ISCA 4ATBB 3PMNA 2BCRA 5HR9A 4I2EA 4XRHA 5HRDA 4KLTA 3OV7A 4M9NA 4TUPA 1ZQAA 1ZQJA 5IIKA 3AU2A 4O69A 5HRFA 2I9GA 1ZQEA 2BCQA 3WFOA 1FA0A 4FHXA 4PPXA 5DECA 4O5CA 4XQ8A 8ICSA 7ICTA 4K99A 4KLGA 7ICIA 4NM2A 7ICUA 5DBBA 5DBCA 4O67A 4YMMA 3C2MA 1JN3A 3WFPA 5J2IA 1OU5A 2BCVA 4TUSA 2M2VA 4M9JA 4K8VA 4QZDA 4AT7A 7ICLA 9ICRA 3V7KA 4NXZA 4Z6EA 4RPYA 1BPEA 1XSLA 4RT2A 3AQMA 1TVAA 4DOAA 4NY8A 3MBYA 1ZQNA 2BCUA 5J2FA 4R66A 9ICMA 3AU6A 4WCWA 1MIVA 2ZH4A 1ZQPA 3TFRA 4FHWA 4PHAA 3OGUA 2ZH5A 2DR8A 9ICPA 5EOZA 4JLZA 3RJIA 9ICJA 4I2HA 4RQ4A 4X4QA 4M2YA 4K4IA 3C18A 4X4OA 4DOCA 8ICRA 5J2EA 4E80A 4E8FA 3H3AA 4MF8A 1MQ3A 4K98A 4NXTA 3MGHA 1UEVA 4KLHA 5J29A 4KM5A 4YN4A 3UXPA 3WFRE 7ICMA 2B56A 5J0WA 4RQ2A 4NM1A 2NRKA 4I2AA 4R64A 4UBBA 4RWNA 4Z6CA 4PHEA 1ZQCA 4LEZA 2B51A 3HJ1A 3B0YA 4IG8A 4X4UA 4M04A 4LEYA 4UB3A 4LVSA 8ICPA 9ICCA 1BPBA 1ZQLA 4IQUA 4WC5A 4WC7A 3TFSA 9ICVA 4WC4A 5J0YA 4DOBA 4X4SA 4F5RA 4YMNA 4RQ1A 5IIOA 3UQ0A 4M5DA 2ZH3A 4I27A 3JYYA 5IIJA 4O6AA 3GDXA 3C2KA 5J0UA 3NYBA 4KLFA 1ZQHA 3ISDA 9ICTA 2RFFA 1R8BA 5IINA 5DB9A 2ZH9A 5CB1A 3RH6A 4KLOA 2BE3A 8ICMA 4GXJA 4PHPA 1XSPA 8ICJA 3RJJA 9ICGA 1JAJA 3UPSA 5D4BA 4WC1A 4KLSA 4AT7B 4QZFA 8ICEA 1MIWA 3V7JA 2PBEA 4KLMA 3UXOA 4QZAA 3OVSA 4I2JA 9ICAA 3OVBA 4X0BA 5J0XA 5IILA 1Q79A 1ZQOA 4YD2A 2B4VA 4M9HA 4O9MA 4M9GA 5CP2A 8ICHA 5HC9A 5J2CA 1KDHA 2FMSA 1BPDA 4RPZA 4FH5A 3RJEA 4KLUA 2FMPA 5J0TA 3K75D 4XQ7A 5D49A 7ICSA 4AT8A 1MIYA 4F5NA 4KLEA 5J0PA 5IIMA 3JPTA 4X4RA 5HHIA 3HX0A 9ICFA 1ZQYA 4KLLA 4UAZA 4P4PA 4KLDA 1ZQIA 8ICCA 8ICLA 5J0OA 4K4HA 4YMOA 5DEDA 3PNCA 3JPSA 2P66A 3V72A 4NXWA 4WOYA 5D46A 5HRLA 7ICPA 1ZJNA 9ICUA 4R63A 5HRIA 2BPGA 1ZQXA 5J0RA 4WC6A 8ICGA 1TFWA 4E7XA 4X4VA 5DB7A 2GWSA 1VFGA 9ICWA 8ICQA 5DB8A 2ZHBA 5J2AA 1VJ7A 5DB6A 4QZ8A 4UD4A 5J0SA 7ICOA 4K97A 4TUQA 7ICGA 4OAHA 3JZ0A 1TV9A 5J2JA 4RQ0A 9ICEA 5J2KA 4O5KA 1R89A 2DR7A 3L9DA 4NLKA 3JPOA 4MF2A 5BPCA 4IQWA 4LEWA 1ZQGA 4RQ8A 4FHYA 3MDAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WBY A;  5J2B A;  2DR5 A;  2BPF A;  5DDM A;  8ICZ A;  8ICX A;  3LQC B;  4RWO A;  8ICA A;  1Q78 A;  9ICH A;  1F5A A;  4UB1 A;  4YCX A;  3RJH A;  4QZC A;  5TZV A;  4LZD A;  4QZG A;  2PFP A;  4MFC A;  5F2V O;  7ICR A;  4EP7 A;  4NLN A;  4I2B A;  1ZQV A;  4X5V A;  4QZE A;  5CHG A;  4I29 A;  4P2H A;  2M2W A;  5J0Q A;  1RZT A;  2DVI A;  5DBA A;  8ICY A;  2M2U A;  4WBZ A;  4LT6 A;  5J2H A;  4I2F A;  4WC3 A;  7ICQ A;  5CR0 A;  1WOT A;  4FHV A;  4AT8 B;  1R8A A;  7ICN A;  5HRK A;  4F5Q A;  5CA7 A;  3PML A;  5CWR A;  4EBJ A;  3UPQ A;  2PFN A;  1JQR A;  8ICI A;  4IQT A;  2ZHA A;  5J2D A;  4M9L A;  3JPP A;  9ICQ A;  3H38 A;  1BPY A;  4NLZ A;  1KNY A;  4LZG A;  1NO5 A;  7ICH A;  9ICO A;  4M47 A;  3WFS C;  2ISP A;  4GXI A;  4I2C A;  1PX5 A;  4UB5 A;  7ICK A;  4XUS A;  3OVA A;  2ZH8 A;  2PFQ A;  3OUY A;  4PH5 A;  3RJK A;  5DKW A;  8ICU A;  4UAW A;  1YLQ A;  1ZQR A;  1TFY A;  4R65 A;  4RQ7 A;  4K4G A;  4GXK A;  2ISO A;  1HUO A;  4PGX A;  4WC2 A;  2ID1 A;  5BOM A;  4X4N A;  2PFO A;  9ICB A;  1ZQB A;  2O5A A;  2ZH7 A;  4RPX A;  3WFQ E;  4AT9 A;  4I2D A;  5HRB A;  3HIY A;  8ICN A;  4X4P A;  9ICS A;  3B0X A;  4UBC A;  4I2I A;  4X4T A;  4FHP A;  1UEU A;  3C5G A;  4KLI A;  4IQV A;  1MQ2 A;  3C2L A;  4PHD A;  4TUR A;  3ISB A;  5BOL A;  4S3N A;  5HHH A;  1V4A A;  4M0A A;  9ICN A;  2ZH2 A;  1RPL A;  1ZQM A;  8ICT A;  5CJ7 A;  4UAY A;  4DO9 A;  3V7L A;  4KLJ A;  5HRE A;  4ATB A;  4I2G A;  3AUO A;  8ICB A;  2M2T A;  4UB4 A;  4MFA A;  4PGY A;  3AQL A;  1ZQD A;  2FMQ A;  2DRA A;  1ZQU A;  1ZJM A;  2O1P A;  4QZI A;  1BPZ A;  2W9M A;  2VAN A;  3HWT A;  1HUZ A;  1NOM A;  4YD1 A;  1XSN A;  4I28 A;  4KLQ A;  4Z6D A;  2BPC A;  3JPN A;  4F5O A;  3RJF A;  8ICK A;  8ICV A;  1R8C A;  2ZH1 A;  3UXN A;  1JMS A;  4QZ9 A;  4RQ5 A;  4RWQ A;  5HRG A;  2PXI A;  3JPR A;  2DR9 A;  3MGI A;  9ICK A;  2BCS A;  3JPQ A;  4NKT A;  2DRB A;  1KEJ A;  4RQ3 A;  4NKU A;  3HW8 A;  3OUY B;  5DDY A;  3AQN A;  4RWP A;  4F5P A;  3MDC A;  4FH3 A;  1UET A;  3RH4 A;  4UD5 A;  7ICE A;  2Q66 A;  7ICF A;  3H37 A;  4JWN A;  1ZQT A;  1ZQQ A;  5III A;  4UB2 A;  1ZQS A;  3LK9 A;  3C5F A;  3RJG A;  8ICW A;  4Z6F A;  4O5E A;  9ICL A;  3H39 A;  3AQK A;  9ICX A;  4FO6 A;  4RT3 A;  7ICJ A;  4XA5 A;  4AT9 B;  8ICO A;  4QZB A;  1ZQF A;  4PGQ A;  2HHP A;  4P4O A;  3HJ4 A;  1ZQZ A;  5J2G A;  4MFF A;  7ICV A;  4QZH A;  4WC0 A;  4EBK A;  2IHM A;  3UQ2 A;  5HRH A;  3RH5 A;  1BPX A;  4P4M A;  1ZQW A;  9ICI A;  2ZH6 A;  3C66 A;  4JWM A;  8ICF A;  1ZQK A;  4RQ6 A;  4X0A A;  3ISC A;  4ATB B;  3PMN A;  2BCR A;  5HR9 A;  4I2E A;  4XRH A;  5HRD A;  4KLT A;  3OV7 A;  4M9N A;  4TUP A;  1ZQA A;  1ZQJ A;  5IIK A;  3AU2 A;  5HRF A;  2I9G A;  1ZQE A;  2BCQ A;  3WFO A;  1FA0 A;  4FHX A;  4PPX A;  5DEC A;  4O5C A;  4XQ8 A;  8ICS A;  7ICT A;  4KLG A;  7ICI A;  4NM2 A;  7ICU A;  5DBB A;  5DBC A;  4YMM A;  3C2M A;  1JN3 A;  3WFP A;  5J2I A;  1OU5 A;  2BCV A;  4TUS A;  2M2V A;  4M9J A;  4QZD A;  4AT7 A;  7ICL A;  9ICR A;  3V7K A;  4NXZ A;  4Z6E A;  4RPY A;  1BPE A;  1XSL A;  4RT2 A;  3AQM A;  1TVA A;  4DOA A;  4NY8 A;  3MBY A;  1ZQN A;  2BCU A;  5J2F A;  4R66 A;  9ICM A;  3AU6 A;  4WCW A;  1MIV A;  2ZH4 A;  1ZQP A;  3TFR A;  4FHW A;  4PHA A;  3OGU A;  2ZH5 A;  2DR8 A;  9ICP A;  5EOZ A;  3RJI A;  9ICJ A;  4I2H A;  4RQ4 A;  4X4Q A;  4M2Y A;  4K4I A;  3C18 A;  4X4O A;  4DOC A;  8ICR A;  5J2E A;  4E80 A;  4E8F A;  3H3A A;  4MF8 A;  1MQ3 A;  3MGH A;  1UEV A;  4KLH A;  5J29 A;  4YN4 A;  3UXP A;  3WFR E;  7ICM A;  2B56 A;  5J0W A;  4RQ2 A;  4NM1 A;  2NRK A;  4I2A A;  4R64 A;  4UBB A;  4RWN A;  4Z6C A;  4PHE A;  1ZQC A;  2B51 A;  3HJ1 A;  3B0Y A;  4IG8 A;  4X4U A;  4M04 A;  4UB3 A;  4LVS A;  8ICP A;  9ICC A;  1BPB A;  1ZQL A;  4IQU A;  4WC5 A;  4WC7 A;  3TFS A;  9ICV A;  4WC4 A;  5J0Y A;  4DOB A;  4X4S A;  4F5R A;  4YMN A;  4RQ1 A;  5IIO A;  3UQ0 A;  4M5D A;  2ZH3 A;  4I27 A;  3JYY A;  5IIJ A;  3GDX A;  3C2K A;  5J0U A;  3NYB A;  4KLF A;  1ZQH A;  3ISD A;  9ICT A;  2RFF A;  1R8B A;  5IIN A;  5DB9 A;  2ZH9 A;  5CB1 A;  3RH6 A;  4KLO A;  2BE3 A;  8ICM A;  4GXJ A;  4PHP A;  1XSP A;  8ICJ A;  3RJJ A;  9ICG A;  1JAJ A;  3UPS A;  5D4B A;  4WC1 A;  4KLS A;  4AT7 B;  4QZF A;  8ICE A;  1MIW A;  3V7J A;  2PBE A;  4KLM A;  3UXO A;  4QZA A;  3OVS A;  4I2J A;  9ICA A;  3OVB A;  4X0B A;  5J0X A;  5IIL A;  1Q79 A;  1ZQO A;  4YD2 A;  2B4V A;  4M9H A;  4O9M A;  4M9G A;  5CP2 A;  8ICH A;  5HC9 A;  5J2C A;  1KDH A;  2FMS A;  1BPD A;  4RPZ A;  4FH5 A;  3RJE A;  4KLU A;  2FMP A;  5J0T A;  3K75 D;  4XQ7 A;  5D49 A;  7ICS A;  4AT8 A;  1MIY A;  4F5N A;  4KLE A;  5J0P A;  5IIM A;  3JPT A;  5HHI A;  4X4R A;  3HX0 A;  9ICF A;  1ZQY A;  4KLL A;  4UAZ A;  4P4P A;  4KLD A;  1ZQI A;  8ICC A;  8ICL A;  5J0O A;  4K4H A;  4YMO A;  5DED A;  3PNC A;  3JPS A;  2P66 A;  3V72 A;  5D46 A;  5HRL A;  7ICP A;  1ZJN A;  9ICU A;  4R63 A;  5HRI A;  2BPG A;  1ZQX A;  5J0R A;  4WC6 A;  8ICG A;  1TFW A;  4E7X A;  4X4V A;  5DB7 A;  2GWS A;  1VFG A;  9ICW A;  8ICQ A;  5DB8 A;  5J2A A;  2ZHB A;  1VJ7 A;  5DB6 A;  4QZ8 A;  4UD4 A;  5J0S A;  7ICO A;  4TUQ A;  7ICG A;  3JZ0 A;  1TV9 A;  5J2J A;  4RQ0 A;  9ICE A;  5J2K A;  4O5K A;  1R89 A;  3L9D A;  2DR7 A;  4NLK A;  3JPO A;  4MF2 A;  5BPC A;  4IQW A;  1ZQG A;  4RQ8 A;  4FHY A;  3MDA A; 
#chains in the Genus database with same CATH topology
 4WBY A;  2DR5 A;  5J2B A;  2BPF A;  3ER8 C;  5DDM A;  8ICZ A;  8ICX A;  3LQC B;  4RWO A;  8ICA A;  1Q78 A;  9ICH A;  1F5A A;  4UB1 A;  4JLX A;  4YCX A;  3RJH A;  4QZC A;  5TZV A;  4LZD A;  4QZG A;  2PFP A;  4MFC A;  5F2V O;  7ICR A;  4EP7 A;  4NLN A;  4I2B A;  1ZQV A;  4X5V A;  4QZE A;  4OAI Z;  5CHG A;  4I29 A;  4P2H A;  2M2W A;  5J0Q A;  2DVI A;  1RZT A;  5DBA A;  8ICY A;  2M2U A;  4WBZ A;  4LT6 A;  2EWR A;  5J2H A;  4I2F A;  4WC3 A;  7ICQ A;  5CR0 A;  1WOT A;  4FHV A;  4AT8 B;  1R8A A;  7ICN A;  4NXV A;  5HRK A;  4F5Q A;  5CA7 A;  3PML A;  5CWR A;  4EBJ A;  3UPQ A;  2PFN A;  4NXX A;  1JQR A;  8ICI A;  4IQT A;  2ZHA A;  5J2D A;  4M9L A;  3JPP A;  9ICQ A;  3H38 A;  2HN1 A;  5JTG A;  1BPY A;  4NLZ A;  1KNY A;  4LZG A;  1NO5 A;  7ICH A;  9ICO A;  4M47 A;  3WFS C;  2ISP A;  4GXI A;  3NKU A;  4I2C A;  1PX5 A;  5B3P A;  4UB5 A;  7ICK A;  3OVA A;  4XUS A;  2ZH8 A;  2PFQ A;  3OUY A;  4PH5 A;  3RJK A;  5DKW A;  2FCL A;  8ICU A;  4UAW A;  1YLQ A;  1ZQR A;  1TFY A;  4R65 A;  4RQ7 A;  4K4G A;  4GXK A;  2ISO A;  1HUO A;  4PGX A;  4WC2 A;  2ID1 A;  5BOM A;  4X4N A;  2PFO A;  9ICB A;  4K9B A;  1ZQB A;  2O5A A;  4EGW A;  4WH5 A;  2ZH7 A;  4RPX A;  3WFQ E;  4AT9 A;  4I2D A;  5HRB A;  3HIY A;  8ICN A;  4WQK A;  4X4P A;  9ICS A;  3B0X A;  4UBC A;  4I2I A;  4X4T A;  4FHP A;  1UEU A;  3C5G A;  4KLI A;  4IQV A;  2HN2 A;  1MQ2 A;  3C2L A;  4PHD A;  4TUR A;  1GPJ A;  3ISB A;  5BOL A;  4S3N A;  5HHH A;  1V4A A;  4M0A A;  9ICN A;  2ZH2 A;  1RPL A;  1ZQM A;  8ICT A;  5CJ7 A;  4UAY A;  4DO9 A;  3V7L A;  4KLJ A;  5HRE A;  4OAG A;  4ATB A;  2GA9 D;  4I2G A;  3AUO A;  8ICB A;  2M2T A;  4UB4 A;  4MFA A;  4EV6 A;  4PGY A;  3AQL A;  1ZQD A;  2FMQ A;  2DRA A;  1ZQU A;  1ZJM A;  2O1P A;  4QZI A;  4KB6 A;  1BPZ A;  5CFU A;  2W9M A;  2VAN A;  3HWT A;  1HUZ A;  1NOM A;  4YD1 A;  1XSN A;  4I28 A;  4KLQ A;  4Z6D A;  2BPC A;  3JPN A;  4F5O A;  3RJF A;  8ICK A;  8ICV A;  1R8C A;  2ZH1 A;  3UXN A;  1JMS A;  4QZ9 A;  4RQ5 A;  4RWQ A;  5HRG A;  2PXI A;  2DR9 A;  3JPR A;  3MGI A;  4NXU A;  2BCS A;  9ICK A;  3JPQ A;  4NKT A;  2DRB A;  1KEJ A;  4RQ3 A;  4NKU A;  3HW8 A;  3OUY B;  5DDY A;  3AQN A;  4RWP A;  4K9A A;  4F5P A;  3MDC A;  4FH3 A;  1UET A;  3RH4 A;  4UD5 A;  7ICE A;  2Q66 A;  7ICF A;  3H37 A;  3OWG A;  4JWN A;  1ZQT A;  1ZQQ A;  5III A;  4MKP A;  4UB2 A;  1ZQS A;  3LK9 A;  3C5F A;  3RJG A;  8ICW A;  4Z6F A;  4OAF A;  4O5E A;  9ICL A;  3H39 A;  4O68 A;  3AQK A;  9ICX A;  4FO6 A;  4RT3 A;  7ICJ A;  4AT9 B;  4XA5 A;  8ICO A;  4QZB A;  1ZQF A;  4LEV A;  4PGQ A;  2HHP A;  4P4O A;  3HJ4 A;  3ERC C;  1ZQZ A;  5J2G A;  4MFF A;  7ICV A;  4QZH A;  4WC0 A;  4EBK A;  2IHM A;  3UQ2 A;  5HRH A;  3RH5 A;  1BPX A;  4P4M A;  1ZQW A;  9ICI A;  2ZH6 A;  3C66 A;  4JWM A;  8ICF A;  4K96 A;  5CFT A;  1ZQK A;  4RQ6 A;  4X0A A;  3ISC A;  4ATB B;  3PMN A;  2BCR A;  5HR9 A;  4I2E A;  4FO1 A;  4XRH A;  5HRD A;  4KLT A;  3OV7 A;  4M9N A;  4TUP A;  1ZQA A;  1ZQJ A;  5IIK A;  3AU2 A;  4O69 A;  5HRF A;  2I9G A;  1ZQE A;  2BCQ A;  3WFO A;  1FA0 A;  4FHX A;  3NWI A;  4PPX A;  5DEC A;  4O5C A;  4XQ8 A;  8ICS A;  7ICT A;  4K99 A;  4KLG A;  7ICI A;  4NM2 A;  7ICU A;  5DBB A;  5DBC A;  4O67 A;  4YMM A;  5B3Q A;  3C2M A;  1JN3 A;  3WFP A;  5J2I A;  1OU5 A;  2BCV A;  4TUS A;  2M2V A;  4M9J A;  4K8V A;  4QZD A;  4AT7 A;  7ICL A;  3NVO A;  9ICR A;  3V7K A;  4NXZ A;  4Z6E A;  4RPY A;  1BPE A;  1XSL A;  4RT2 A;  3AQM A;  1TVA A;  4DOA A;  4NY8 A;  3MBY A;  1ZQN A;  2BCU A;  5J2F A;  4R66 A;  9ICM A;  5D62 A;  3AU6 A;  4EED A;  4WCW A;  1MIV A;  2ZH4 A;  3CK6 A;  1ZQP A;  3TFR A;  4FHW A;  4PHA A;  2IHO A;  3OGU A;  2ZH5 A;  2DR8 A;  9ICP A;  5EOZ A;  4JLZ A;  3RJI A;  9ICJ A;  4I2H A;  4RQ4 A;  4X4Q A;  5D63 A;  4M2Y A;  4K4I A;  3C18 A;  4X4O A;  5CHE A;  4DOC A;  8ICR A;  5J2E A;  4E80 A;  4E8F A;  2IUB A;  3H3A A;  4MF8 A;  1MQ3 A;  4K98 A;  4NXT A;  3MGH A;  5CFS A;  5D61 A;  1UEV A;  3JCF A;  4KLH A;  5J29 A;  4KM5 A;  4YN4 A;  3UXP A;  3WFR E;  4N7R A;  2B56 A;  5J0W A;  7ICM A;  4RQ2 A;  4NM1 A;  2NRK A;  4I2A A;  2BBH A;  4R64 A;  4RWN A;  4UBB A;  4Z6C A;  4PHE A;  1ZQC A;  4LEZ A;  2B51 A;  3HJ1 A;  3B0Y A;  4IG8 A;  4X4U A;  4M04 A;  4LEY A;  4UB3 A;  4LVS A;  8ICP A;  9ICC A;  1BPB A;  1ZQL A;  4IQU A;  4WC5 A;  4XJE A;  4WC7 A;  3TFS A;  9ICV A;  4WC4 A;  5J0Y A;  4DOB A;  4X4S A;  4F5R A;  4YMN A;  4RQ1 A;  5IIO A;  3UQ0 A;  4M5D A;  2ZH3 A;  4I27 A;  3JYY A;  5IIJ A;  4O6A A;  3GDX A;  3C2K A;  5J0U A;  3NYB A;  4KLF A;  1ZQH A;  3ISD A;  9ICT A;  4I0U A;  2RFF A;  1R8B A;  5IIN A;  5DB9 A;  2ZH9 A;  5CB1 A;  3RH6 A;  2GAF D;  4KLO A;  2BE3 A;  8ICM A;  4GXJ A;  4PHP A;  1XSP A;  8ICJ A;  3RJJ A;  9ICG A;  1JAJ A;  3UPS A;  5D4B A;  4WC1 A;  4KLS A;  4AT7 B;  4QZF A;  8ICE A;  4EEB A;  1MIW A;  3V7J A;  2PBE A;  4KLM A;  3UXO A;  4WQL A;  4QZA A;  3OVS A;  4I2J A;  9ICA A;  3OVB A;  4X0B A;  5J0X A;  5IIL A;  1Q79 A;  1ZQO A;  4YD2 A;  2B4V A;  4M9H A;  4O9M A;  4M9G A;  5CP2 A;  8ICH A;  5HC9 A;  3EF2 A;  5J2C A;  1KDH A;  2FMS A;  1BPD A;  4RPZ A;  4FH5 A;  3K7D A;  4HX0 A;  3RJE A;  4KLU A;  2FMP A;  5J0T A;  3K75 D;  4XQ7 A;  5D49 A;  7ICS A;  4AT8 A;  1MIY A;  4F5N A;  4KLE A;  5J0P A;  5IIM A;  2BBJ A;  4X4R A;  5HHI A;  3JPT A;  3HX0 A;  9ICF A;  1ZQY A;  4KLL A;  4UAZ A;  4P4P A;  4KLD A;  1ZQI A;  8ICC A;  8ICL A;  5J0O A;  4K4H A;  4YMO A;  5DED A;  3PNC A;  3JPS A;  2P66 A;  3V72 A;  4NXW A;  4WOY A;  3PHZ A;  5D46 A;  5HRL A;  3ER9 B;  7ICP A;  1ZJN A;  9ICU A;  4R63 A;  5HRI A;  2BPG A;  1ZQX A;  5J0R A;  4WC6 A;  8ICG A;  1TFW A;  4E7X A;  4X4V A;  5DB7 A;  2GWS A;  1VFG A;  9ICW A;  8ICQ A;  5DB8 A;  2ZHB A;  5J2A A;  1VJ7 A;  5DB6 A;  4QZ8 A;  4UD4 A;  5J0S A;  7ICO A;  4K97 A;  4TUQ A;  3MCR A;  4OAH A;  3JZ0 A;  1TV9 A;  7ICG A;  5J2J A;  4RQ0 A;  9ICE A;  5J2K A;  4O5K A;  1R89 A;  2DR7 A;  3L9D A;  4NLK A;  3JPO A;  4MF2 A;  5BPC A;  4IQW A;  4LEW A;  1ZQG A;  4RQ8 A;  4FHY A;  3MDA A; 
#chains in the Genus database with same CATH homology
 4WBY A;  2DR5 A;  5J2B A;  2BPF A;  5DDM A;  8ICZ A;  8ICX A;  3LQC B;  4RWO A;  8ICA A;  1Q78 A;  9ICH A;  1F5A A;  4UB1 A;  4JLX A;  4YCX A;  3RJH A;  4QZC A;  5TZV A;  4LZD A;  4QZG A;  2PFP A;  4MFC A;  5F2V O;  7ICR A;  4EP7 A;  4NLN A;  4I2B A;  1ZQV A;  4X5V A;  4QZE A;  4OAI Z;  5CHG A;  4I29 A;  4P2H A;  2M2W A;  5J0Q A;  2DVI A;  1RZT A;  5DBA A;  8ICY A;  2M2U A;  4WBZ A;  4LT6 A;  5J2H A;  4I2F A;  4WC3 A;  7ICQ A;  5CR0 A;  1WOT A;  4FHV A;  4AT8 B;  1R8A A;  7ICN A;  4NXV A;  5HRK A;  4F5Q A;  5CA7 A;  3PML A;  5CWR A;  4EBJ A;  3UPQ A;  2PFN A;  4NXX A;  1JQR A;  8ICI A;  4IQT A;  2ZHA A;  5J2D A;  4M9L A;  3JPP A;  9ICQ A;  3H38 A;  1BPY A;  4NLZ A;  1KNY A;  4LZG A;  1NO5 A;  7ICH A;  9ICO A;  4M47 A;  3WFS C;  2ISP A;  4GXI A;  4I2C A;  1PX5 A;  4UB5 A;  7ICK A;  3OVA A;  4XUS A;  2ZH8 A;  2PFQ A;  3OUY A;  4PH5 A;  3RJK A;  5DKW A;  8ICU A;  4UAW A;  1YLQ A;  1ZQR A;  1TFY A;  4R65 A;  4RQ7 A;  4K4G A;  4GXK A;  2ISO A;  1HUO A;  4PGX A;  4WC2 A;  2ID1 A;  5BOM A;  4X4N A;  2PFO A;  9ICB A;  4K9B A;  1ZQB A;  2O5A A;  2ZH7 A;  4RPX A;  3WFQ E;  4AT9 A;  4I2D A;  5HRB A;  3HIY A;  8ICN A;  4X4P A;  9ICS A;  3B0X A;  4UBC A;  4I2I A;  4X4T A;  4FHP A;  1UEU A;  3C5G A;  4KLI A;  4IQV A;  1MQ2 A;  3C2L A;  4PHD A;  4TUR A;  3ISB A;  5BOL A;  4S3N A;  5HHH A;  1V4A A;  4M0A A;  9ICN A;  2ZH2 A;  1RPL A;  1ZQM A;  8ICT A;  5CJ7 A;  4UAY A;  4DO9 A;  3V7L A;  4KLJ A;  5HRE A;  4OAG A;  4ATB A;  4I2G A;  3AUO A;  8ICB A;  2M2T A;  4UB4 A;  4MFA A;  4PGY A;  3AQL A;  1ZQD A;  2FMQ A;  2DRA A;  1ZQU A;  1ZJM A;  2O1P A;  4QZI A;  4KB6 A;  1BPZ A;  2W9M A;  2VAN A;  3HWT A;  1HUZ A;  1NOM A;  4YD1 A;  1XSN A;  4I28 A;  4KLQ A;  4Z6D A;  2BPC A;  3JPN A;  4F5O A;  3RJF A;  8ICK A;  8ICV A;  1R8C A;  2ZH1 A;  3UXN A;  1JMS A;  4QZ9 A;  4RQ5 A;  4RWQ A;  5HRG A;  2PXI A;  2DR9 A;  3JPR A;  3MGI A;  4NXU A;  2BCS A;  9ICK A;  3JPQ A;  4NKT A;  2DRB A;  1KEJ A;  4RQ3 A;  4NKU A;  3HW8 A;  3OUY B;  5DDY A;  3AQN A;  4RWP A;  4K9A A;  4F5P A;  3MDC A;  4FH3 A;  1UET A;  3RH4 A;  4UD5 A;  7ICE A;  2Q66 A;  7ICF A;  3H37 A;  4JWN A;  1ZQT A;  1ZQQ A;  5III A;  4MKP A;  4UB2 A;  1ZQS A;  3LK9 A;  3C5F A;  3RJG A;  8ICW A;  4Z6F A;  4OAF A;  4O5E A;  9ICL A;  3H39 A;  4O68 A;  3AQK A;  9ICX A;  4FO6 A;  4RT3 A;  7ICJ A;  4AT9 B;  4XA5 A;  8ICO A;  4QZB A;  1ZQF A;  4LEV A;  4PGQ A;  2HHP A;  4P4O A;  3HJ4 A;  1ZQZ A;  5J2G A;  4MFF A;  7ICV A;  4QZH A;  4WC0 A;  4EBK A;  2IHM A;  3UQ2 A;  5HRH A;  3RH5 A;  1BPX A;  4P4M A;  1ZQW A;  9ICI A;  2ZH6 A;  3C66 A;  4JWM A;  8ICF A;  4K96 A;  1ZQK A;  4RQ6 A;  4X0A A;  3ISC A;  4ATB B;  3PMN A;  2BCR A;  5HR9 A;  4I2E A;  4XRH A;  5HRD A;  4KLT A;  3OV7 A;  4M9N A;  4TUP A;  1ZQA A;  1ZQJ A;  5IIK A;  3AU2 A;  4O69 A;  5HRF A;  2I9G A;  1ZQE A;  2BCQ A;  3WFO A;  1FA0 A;  4FHX A;  4PPX A;  5DEC A;  4O5C A;  4XQ8 A;  8ICS A;  7ICT A;  4K99 A;  4KLG A;  7ICI A;  4NM2 A;  7ICU A;  5DBB A;  5DBC A;  4O67 A;  4YMM A;  3C2M A;  1JN3 A;  3WFP A;  5J2I A;  1OU5 A;  2BCV A;  4TUS A;  2M2V A;  4M9J A;  4K8V A;  4QZD A;  4AT7 A;  7ICL A;  9ICR A;  3V7K A;  4NXZ A;  4Z6E A;  4RPY A;  1BPE A;  1XSL A;  4RT2 A;  3AQM A;  1TVA A;  4DOA A;  4NY8 A;  3MBY A;  1ZQN A;  2BCU A;  5J2F A;  4R66 A;  9ICM A;  3AU6 A;  4WCW A;  1MIV A;  2ZH4 A;  1ZQP A;  3TFR A;  4FHW A;  4PHA A;  3OGU A;  2ZH5 A;  2DR8 A;  9ICP A;  5EOZ A;  4JLZ A;  3RJI A;  9ICJ A;  4I2H A;  4RQ4 A;  4X4Q A;  4M2Y A;  4K4I A;  3C18 A;  4X4O A;  4DOC A;  8ICR A;  5J2E A;  4E80 A;  4E8F A;  3H3A A;  4MF8 A;  1MQ3 A;  4K98 A;  4NXT A;  3MGH A;  1UEV A;  4KLH A;  5J29 A;  4KM5 A;  4YN4 A;  3UXP A;  3WFR E;  7ICM A;  2B56 A;  5J0W A;  4RQ2 A;  4NM1 A;  2NRK A;  4I2A A;  4R64 A;  4UBB A;  4RWN A;  4Z6C A;  4PHE A;  1ZQC A;  4LEZ A;  2B51 A;  3HJ1 A;  3B0Y A;  4IG8 A;  4X4U A;  4M04 A;  4LEY A;  4UB3 A;  4LVS A;  8ICP A;  9ICC A;  1BPB A;  1ZQL A;  4IQU A;  4WC5 A;  4WC7 A;  3TFS A;  9ICV A;  4WC4 A;  5J0Y A;  4DOB A;  4X4S A;  4F5R A;  4YMN A;  4RQ1 A;  5IIO A;  3UQ0 A;  4M5D A;  2ZH3 A;  4I27 A;  3JYY A;  5IIJ A;  4O6A A;  3GDX A;  3C2K A;  5J0U A;  3NYB A;  4KLF A;  1ZQH A;  3ISD A;  9ICT A;  2RFF A;  1R8B A;  5IIN A;  5DB9 A;  2ZH9 A;  5CB1 A;  3RH6 A;  4KLO A;  2BE3 A;  8ICM A;  4GXJ A;  4PHP A;  1XSP A;  8ICJ A;  3RJJ A;  9ICG A;  1JAJ A;  3UPS A;  5D4B A;  4WC1 A;  4KLS A;  4AT7 B;  4QZF A;  8ICE A;  1MIW A;  3V7J A;  2PBE A;  4KLM A;  3UXO A;  4QZA A;  3OVS A;  4I2J A;  9ICA A;  3OVB A;  4X0B A;  5J0X A;  5IIL A;  1Q79 A;  1ZQO A;  4YD2 A;  2B4V A;  4M9H A;  4O9M A;  4M9G A;  5CP2 A;  8ICH A;  5HC9 A;  5J2C A;  1KDH A;  2FMS A;  1BPD A;  4RPZ A;  4FH5 A;  3RJE A;  4KLU A;  2FMP A;  5J0T A;  3K75 D;  4XQ7 A;  5D49 A;  7ICS A;  4AT8 A;  1MIY A;  4F5N A;  4KLE A;  5J0P A;  5IIM A;  3JPT A;  4X4R A;  5HHI A;  3HX0 A;  9ICF A;  1ZQY A;  4KLL A;  4UAZ A;  4P4P A;  4KLD A;  1ZQI A;  8ICC A;  8ICL A;  5J0O A;  4K4H A;  4YMO A;  5DED A;  3PNC A;  3JPS A;  2P66 A;  3V72 A;  4NXW A;  4WOY A;  5D46 A;  5HRL A;  7ICP A;  1ZJN A;  9ICU A;  4R63 A;  5HRI A;  2BPG A;  1ZQX A;  5J0R A;  4WC6 A;  8ICG A;  1TFW A;  4E7X A;  4X4V A;  5DB7 A;  2GWS A;  1VFG A;  9ICW A;  8ICQ A;  5DB8 A;  2ZHB A;  5J2A A;  1VJ7 A;  5DB6 A;  4QZ8 A;  4UD4 A;  5J0S A;  7ICO A;  4K97 A;  4TUQ A;  7ICG A;  4OAH A;  3JZ0 A;  1TV9 A;  5J2J A;  4RQ0 A;  9ICE A;  5J2K A;  4O5K A;  1R89 A;  2DR7 A;  3L9D A;  4NLK A;  3JPO A;  4MF2 A;  5BPC A;  4IQW A;  4LEW A;  1ZQG A;  4RQ8 A;  4FHY A;  3MDA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...