4FHVA

Crystal structures of the cid1 poly (u) polymerase reveal the mechanism for utp selectivity - mgctp bound
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
338
structure length
323
Chain Sequence
SHKEFTKFCYEVYNEIKISDKEFKEKRAALDTLRLCLKRISPDAELVAFGSLESGLALKNSDMDLCVLMDSRVQSDTIALQFYEELIAEGFEGKFLQRARIPIIKLTSDTKNGFGASFQCDIGFNNRLAIHNTLLLSSYTKLDARLKPMVLLVKHWAKRKQINSPYFGTLSSYGYVLMVLYYLIHVIKPPVFPNLLLSPLKQEKIVDGFDVGFDDKLEDIPPSQNYSSLGSLLHGFFRFYAYKFEPREKVVTFRRPDGYLTKQEKGWTRYILAIEDPFEISHNVGRTVSSSGLYRIRGEFMAASRLLNSRSYPIPYDSLFEEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the Cid1 poly (U) polymerase reveal the mechanism for UTP selectivity.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transferase
molecule keywords Poly(A) RNA polymerase protein cid1
total genus 109
structure length 323
sequence length 338
ec nomenclature ec 2.7.7.19: Polynucleotide adenylyltransferase.
pdb deposition date 2012-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01909 NTP_transf_2 Nucleotidyltransferase domain
A PF03828 PAP_assoc Cid1 family poly A polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.10 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain Poly(a)-polymerase, middle domain 4fhvA01
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4fhvA02
2M2VA 2PFQA 3RJHA 2M2TA 9ICFA 4YMMA 3MGHA 1ZQLA 2BCVA 4NLNA 4X4NA 4K4HA 3H38A 4R65A 8ICZA 1ZQEA 4RT2A 1TV9A 8ICOA 5J29A 5DB9A 4KLEA 3K75D 4NLZA 5J2GA 2BPFA 1ZQTA 5J0XA 4I2CA 1RPLA 5DECA 4PH5A 4I2BA 3H39A 2ZH1A 5HREA 3AUOA 4X4UA 4AT8A 3UXOA 5J2BA 2M2WA 4X4PA 1MIYA 2DR5A 1KNYA 4RQ3A 3MBYA 1TVAA 4UB1A 2ISOA 2ZH9A 4NM1A 7ICFA 1HUZA 4JWMA 4QZDA 4QZEA 4MFAA 1MIVA 4P2HA 1NO5A 7ICLA 1ZQYA 1KDHA 3UQ2A 9ICLA 5BOLA 4Z6FA 4XUSA 9ICOA 4TUSA 4FHYA 8ICHA 2Q66A 1XSNA 5DB7A 4XQ8A 5CB1A 1ZQFA 3RJKA 2BCRA 3PMLA 1VJ7A 7ICGA 5CWRA 4EP7A 5HHHA 8ICGA 5HRIA 7ICSA 1ZQUA 2ZH7A 4R63A 4WC3A 4PHDA 2ZH6A 8ICVA 1ZQMA 2DRBA 4QZCA 8ICRA 4DOCA 4KLGA 4YMOA 2DR8A 5CR0A 5DDMA 1ZQOA 8ICMA 3C5FA 4M5DA 2W9MA 3OUYA 7ICEA 1WOTA 5J0QA 5J0PA 8ICPA 5J0SA 3C2LA 5D4BA 1ZQPA 3V7JA 4WC7A 4GXKA 8ICTA 4M0AA 4NKUA 3JPTA 1JQRA 1FA0A 1ZQXA 8ICAA 4E80A 3JZ0A 1XSPA 4DOBA 1UEUA 4QZFA 4KLSA 8ICNA 5J0OA 8ICEA 2PFNA 4EBKA 5IIMA 4I2IA 4RPYA 3OVAA 5J0RA 4X5VA 1BPZA 9ICIA 4KLIA 4UBCA 5J2FA 4YCXA 2BE3A 4WC0A 4UB2A 1BPBA 4PHPA 3V72A 5DBBA 3OGUA 5HRGA 3TFSA 2DRAA 7ICKA 5J2KA 5DBAA 4KLDA 3PNCA 2M2UA 5D46A 5J2EA 1MQ2A 4R64A 4M9JA 3WFSC 7ICOA 5J2IA 1ZQHA 1ZQSA 8ICUA 2ZH8A 1Q79A 2ZH4A 5DKWA 4UB5A 4M9HA 1PX5A 5DB8A 4Z6CA 4NLKA 4ATBB 4AT7A 3HWTA 1MQ3A 4FHXA 3AQLA 1RZTA 4FO6A 4TURA 1BPXA 4PPXA 5DEDA 4JWNA 5IIOA 4X0AA 4Z6EA 1BPEA 5CA7A 4RWPA 3OUYB 2ISPA 1ZQDA 3C66A 4I28A 4FHVA 3LK9A 5J2AA 4O5CA 4XQ7A 5J0TA 7ICUA 3JYYA 4UAWA 8ICLA 4IG8A 4M2YA 2BCSA 8ICIA 4IQVA 4X4OA 4X4QA 2ZH3A 1VFGA 5HRDA 5HHIA 4KLUA 5IINA 4F5QA 3WFQE 3HX0A 1YLQA 4I29A 1ZQBA 4I2DA 4UD5A 5F2VO 4PHEA 3V7LA 4XA5A 1JAJA 4I27A 8ICQA 9ICNA 3UPSA 7ICTA 4PHAA 4X0BA 3WFRE 2DR7A 2FMSA 4F5PA 4R66A 1KEJA 4KLMA 4RWNA 1R8CA 4NXZA 3C18A 5J2DA 3NYBA 5J0WA 9ICEA 2GWSA 8ICBA 3L9DA 3RJGA 2HHPA 4RPZA 2FMPA 1ZQKA 4QZ9A 4YD2A 7ICVA 1MIWA 4F5OA 1ZQCA 5CHGA 7ICMA 4QZGA 4O5EA 3RJFA 3MGIA 1ZQWA 9ICWA 4NKTA 5J0YA 2ZH2A 5CJ7A 4KLLA 7ICHA 3JPSA 4UBBA 4RQ7A 4KLJA 1UEVA 5IILA 2ID1A 4M04A 4AT9B 3H37A 1R8BA 4WC1A 4UB3A 3AU6A 8ICYA 4E8FA 2B4VA 4IQWA 3RJEA 4K4IA 1ZQJA 4AT9A 4EBJA 3TFRA 3JPQA 5TZVA 9ICSA 4X4RA 5IIIA 3UXNA 3UPQA 1ZQAA 4LZGA 4QZIA 3JPPA 4DO9A 1UETA 2I9GA 5HR9A 1ZQNA 4ATBA 4AT7B 3HJ1A 4I2EA 9ICJA 8ICXA 4I2GA 2NRKA 5BPCA 3UQ0A 5J0UA 4FHPA 2VANA 7ICRA 9ICXA 4M47A 4IQTA 1TFWA 5EOZA 2PFOA 5HRKA 4E7XA 1ZQVA 4K4GA 3HJ4A 5DDYA 3RJJA 4F5NA 7ICPA 4I2FA 1JN3A 1BPDA 4WC4A 4RT3A 3RH6A 4KLQA 3PMNA 1Q78A 5DB6A 4O5KA 1TFYA 4PGQA 3HW8A 3MDCA 1ZQIA 3JPNA 4UD4A 2B56A 5D49A 1ZJNA 4UB4A 4P4OA 3ISDA 2IHMA 5HRBA 4X4SA 5J2JA 1XSLA 2RFFA 4UAYA 8ICSA 3B0YA 9ICBA 9ICUA 4PGYA 4KLOA 4M9NA 4WBZA 1HUOA 4DOAA 9ICRA 8ICFA 2B51A 2O1PA 3C2MA 3GDXA 1R89A 9ICGA 4X4VA 9ICPA 1ZQZA 5DBCA 3ISCA 7ICNA 4RQ5A 3ISBA 4P4MA 5J2CA 4LT6A 4GXJA 4QZHA 3OVSA 3LQCB 4QZ8A 4X4TA 4RQ1A 4UAZA 5BOMA 4RPXA 4QZAA 3JPRA 3OV7A 4I2HA 4TUQA 4WC6A 4GXIA 4RWOA 9ICHA 4RQ6A 2ZHBA 3RH4A 1V4AA 1NOMA 2PFPA 9ICTA 1ZJMA 4FH3A 1F5AA 1R8AA 4YMNA 2ZHAA 4RQ8A 4YN4A 2BCUA 3WFPA 9ICCA 1OU5A 4FH5A 3RH5A 4LZDA 3B0XA 3UXPA 4Z6DA 3V7KA 4RQ4A 3HIYA 4S3NA 4WC5A 3AU2A 9ICAA 4MF8A 5IIJA 4KLHA 1ZQQA 4I2JA 4M9GA 4O9MA 5HRFA 2BPGA 4MFCA 4WCWA 8ICCA 5HRHA 2PBEA 4M9LA 2DR9A 4QZBA 2BPCA 3WFOA 4RQ0A 5CP2A 4MF2A 3AQKA 3C2KA 4RWQA 7ICIA 4IQUA 4LVSA 2P66A 2O5AA 5IIKA 3OVBA 4WC2A 4NY8A 3C5GA 3RJIA 4AT8B 4PGXA 4NM2A 3AQNA 9ICVA 5HC9A 9ICMA 3MDAA 3AQMA 2ZH5A 4FHWA 4MFFA 5HRLA 8ICJA 1BPYA 8ICWA 4KLTA 7ICJA 8ICKA 4YD1A 4P4PA 2FMQA 2PXIA 1JMSA 4TUPA 4F5RA 5J2HA 4KLFA 7ICQA 4RQ2A 1ZQGA 2BCQA 4I2AA 1ZQRA 3H3AA 3JPOA 9ICKA 4XRHA 4WBYA 2DVIA 9ICQA
chains in the Genus database with same CATH superfamily
2M2VA 4OAGA 4HX0A 2PFQA 3RJHA 2M2TA 9ICFA 4YMMA 3MGHA 1ZQLA 4K9AA 2BCVA 4NLNA 4X4NA 4K97A 4K4HA 3H38A 4R65A 8ICZA 1ZQEA 4RT2A 1TV9A 8ICOA 5J29A 5DB9A 4KLEA 3K75D 5JTGA 4NLZA 5J2GA 2BPFA 1ZQTA 5J0XA 4I2CA 4N7RA 1RPLA 5DECA 4PH5A 4I2BA 2ZH1A 3H39A 5HREA 4X4UA 5CFUA 4AT8A 3AUOA 3UXOA 5J2BA 2M2WA 4X4PA 1MIYA 2DR5A 3PHZA 4O6AA 1KNYA 4RQ3A 3MBYA 5B3PA 1TVAA 4UB1A 2ISOA 2ZH9A 4NM1A 7ICFA 1HUZA 4JWMA 4QZDA 4QZEA 4MFAA 1MIVA 4P2HA 1NO5A 7ICLA 1ZQYA 1KDHA 3UQ2A 9ICLA 5BOLA 4Z6FA 4XUSA 5B3QA 9ICOA 4TUSA 4FHYA 8ICHA 2Q66A 1XSNA 5DB7A 4NXXA 4OAHA 4XQ8A 5CB1A 1ZQFA 2BCRA 3RJKA 5D62A 3PMLA 1VJ7A 7ICGA 5CWRA 4EP7A 5HHHA 1GPJA 4O69A 8ICGA 5HRIA 7ICSA 1ZQUA 2ZH7A 4R63A 4WC3A 4PHDA 2ZH6A 8ICVA 1ZQMA 2DRBA 4QZCA 8ICRA 4DOCA 4KLGA 4YMOA 2DR8A 5CR0A 5DDMA 1ZQOA 8ICMA 4M5DA 2W9MA 3OUYA 3C5FA 7ICEA 1WOTA 5J0QA 5J0PA 8ICPA 5J0SA 3C2LA 5D4BA 2GAFD 1ZQPA 4JLXA 3V7JA 4WC7A 2EWRA 4EV6A 4GXKA 8ICTA 4M0AA 4NKUA 3JPTA 1JQRA 1FA0A 1ZQXA 8ICAA 4E80A 3JZ0A 1XSPA 4DOBA 1UEUA 4QZFA 4KLSA 8ICNA 5J0OA 8ICEA 2PFNA 4K96A 4EBKA 5IIMA 4I2IA 4RPYA 3OVAA 5J0RA 4X5VA 1BPZA 9ICIA 4KLIA 4UBCA 4WQLA 5J2FA 4YCXA 2BE3A 4WC0A 4UB2A 4EEBA 1BPBA 4PHPA 3V72A 5DBBA 3OGUA 5HRGA 2DRAA 3TFSA 7ICKA 5J2KA 2GA9D 5DBAA 4KLDA 3PNCA 2M2UA 5D46A 5J2EA 1MQ2A 4R64A 4K9BA 4M9JA 3WFSC 7ICOA 5J2IA 5CFSA 1ZQSA 1ZQHA 8ICUA 2ZH8A 1Q79A 2ZH4A 4JLZA 5DKWA 4UB5A 4M9HA 1PX5A 5DB8A 4Z6CA 4K8VA 4NLKA 4ATBB 4AT7A 3HWTA 1MQ3A 4FHXA 5D61A 3AQLA 1RZTA 4FO6A 4TURA 1BPXA 4PPXA 4K99A 5DEDA 4JWNA 5IIOA 4X0AA 4Z6EA 4OAFA 1BPEA 5CA7A 4RWPA 3OUYB 2ISPA 1ZQDA 3C66A 4I28A 4FHVA 3LK9A 5J2AA 4O5CA 4XQ7A 5J0TA 7ICUA 3JYYA 4UAWA 3JCFA 8ICLA 4IG8A 3ER9B 4M2YA 2BCSA 8ICIA 4IQVA 4X4OA 4X4QA 2ZH3A 1VFGA 5HRDA 3NKUA 5HHIA 4KLUA 2BBJA 5IINA 4LEYA 4F5QA 3WFQE 3HX0A 2IHOA 2HN1A 4EGWA 1YLQA 4EEDA 4I29A 1ZQBA 4I2DA 4UD5A 5F2VO 4PHEA 3V7LA 4XA5A 1JAJA 4O68A 4I27A 8ICQA 4NXUA 9ICNA 3UPSA 3EF2A 7ICTA 4PHAA 4X0BA 3WFRE 2DR7A 2FMSA 4NXTA 4F5PA 4R66A 4RWNA 1KEJA 4KLMA 1R8CA 4NXZA 3C18A 5J2DA 3NYBA 3MCRA 5J0WA 9ICEA 2GWSA 8ICBA 3L9DA 3RJGA 2HHPA 4RPZA 2FMPA 1ZQKA 4QZ9A 4YD2A 7ICVA 1MIWA 4F5OA 1ZQCA 4KM5A 5CHGA 7ICMA 4QZGA 4O5EA 3RJFA 3MGIA 1ZQWA 9ICWA 4NKTA 5J0YA 2ZH2A 5CJ7A 4KLLA 7ICHA 4O67A 3JPSA 4UBBA 4WQKA 4WH5A 4RQ7A 2HN2A 4KLJA 1UEVA 3K7DA 2ID1A 5IILA 4M04A 4AT9B 3H37A 1R8BA 4WC1A 4UB3A 3AU6A 3ER8C 8ICYA 4E8FA 2B4VA 4IQWA 3RJEA 4K4IA 1ZQJA 4AT9A 4EBJA 3TFRA 3JPQA 5TZVA 9ICSA 4LEWA 4X4RA 5IIIA 3UXNA 5CFTA 3UPQA 1ZQAA 4LZGA 4QZIA 3JPPA 4DO9A 1UETA 3NWIA 5D63A 2I9GA 5HR9A 4KB6A 1ZQNA 4ATBA 4AT7B 3HJ1A 4MKPA 4I2EA 9ICJA 8ICXA 4I2GA 2BBHA 2NRKA 5BPCA 3UQ0A 5J0UA 4FHPA 2VANA 7ICRA 9ICXA 4M47A 4IQTA 3NVOA 1TFWA 5EOZA 2PFOA 5HRKA 4E7XA 1ZQVA 4K4GA 3HJ4A 5DDYA 3RJJA 4F5NA 7ICPA 4I2FA 1JN3A 1BPDA 4WC4A 4RT3A 3RH6A 4KLQA 3PMNA 1Q78A 5DB6A 4O5KA 1TFYA 4PGQA 3HW8A 3MDCA 4OAIZ 3JPNA 4UD4A 1ZQIA 2B56A 5D49A 1ZJNA 4UB4A 4P4OA 2IUBA 3ISDA 3OWGA 2IHMA 4XJEA 4X4SA 5HRBA 5J2JA 1XSLA 2RFFA 4UAYA 8ICSA 3B0YA 9ICBA 9ICUA 4PGYA 4KLOA 4LEZA 4M9NA 4WBZA 1HUOA 4DOAA 9ICRA 8ICFA 2B51A 2O1PA 3C2MA 3GDXA 1R89A 9ICGA 4X4VA 9ICPA 1ZQZA 5DBCA 3ISCA 4NXVA 7ICNA 4RQ5A 3ISBA 4P4MA 5J2CA 4LT6A 4GXJA 4QZHA 3OVSA 3LQCB 4X4TA 4QZ8A 4RQ1A 4UAZA 5BOMA 4RPXA 4QZAA 3JPRA 3OV7A 5CHEA 4TUQA 4WC6A 4I2HA 4GXIA 4RWOA 9ICHA 4RQ6A 2ZHBA 4K98A 1V4AA 3RH4A 1NOMA 4FO1A 2PFPA 9ICTA 1ZJMA 4I0UA 4FH3A 1F5AA 1R8AA 2ZHAA 4YMNA 4RQ8A 4YN4A 2BCUA 3WFPA 9ICCA 3CK6A 1OU5A 4FH5A 3RH5A 4LZDA 3B0XA 3UXPA 4Z6DA 3V7KA 4RQ4A 3HIYA 4S3NA 4WC5A 3AU2A 9ICAA 4MF8A 5IIJA 4KLHA 1ZQQA 4I2JA 4M9GA 4O9MA 5HRFA 2BPGA 4MFCA 4NXWA 4WCWA 8ICCA 5HRHA 2PBEA 4M9LA 2DR9A 4QZBA 2BPCA 3WFOA 4RQ0A 5CP2A 4MF2A 3AQKA 3C2KA 4RWQA 7ICIA 4IQUA 3ERCC 4LVSA 2P66A 2O5AA 5IIKA 3OVBA 4WC2A 4NY8A 3C5GA 3RJIA 4AT8B 4PGXA 4NM2A 3AQNA 9ICVA 5HC9A 9ICMA 3MDAA 3AQMA 2ZH5A 4LEVA 4FHWA 2FCLA 4MFFA 5HRLA 4WOYA 8ICJA 1BPYA 8ICWA 4KLTA 7ICJA 8ICKA 4YD1A 4P4PA 2FMQA 2PXIA 1JMSA 4TUPA 4F5RA 5J2HA 4KLFA 7ICQA 4RQ2A 1ZQGA 2BCQA 4I2AA 1ZQRA 3H3AA 3JPOA 9ICKA 2DVIA 4WBYA 4XRHA 9ICQA
chains in the Genus database with same CATH topology
2M2VA 4OAGA 2PFQA 3RJHA 2M2TA 9ICFA 4YMMA 3MGHA 1ZQLA 4K9AA 2BCVA 4NLNA 4X4NA 4K97A 4K4HA 3H38A 4R65A 8ICZA 1ZQEA 4RT2A 1TV9A 8ICOA 5J29A 5DB9A 4KLEA 3K75D 4NLZA 5J2GA 2BPFA 1ZQTA 5J0XA 4I2CA 1RPLA 5DECA 4PH5A 4I2BA 2ZH1A 3H39A 4X4UA 5HREA 3AUOA 4AT8A 3UXOA 5J2BA 2M2WA 4X4PA 1MIYA 2DR5A 4O6AA 1KNYA 4RQ3A 3MBYA 1TVAA 4UB1A 2ISOA 2ZH9A 4NM1A 7ICFA 1HUZA 4JWMA 4QZDA 4QZEA 4MFAA 1MIVA 4P2HA 1NO5A 7ICLA 1ZQYA 1KDHA 3UQ2A 9ICLA 5BOLA 4Z6FA 4XUSA 9ICOA 4TUSA 4FHYA 8ICHA 2Q66A 1XSNA 5DB7A 4NXXA 4OAHA 4XQ8A 5CB1A 1ZQFA 2BCRA 3RJKA 3PMLA 1VJ7A 7ICGA 5CWRA 4EP7A 5HHHA 4O69A 8ICGA 5HRIA 7ICSA 1ZQUA 2ZH7A 4R63A 4WC3A 4PHDA 2ZH6A 8ICVA 1ZQMA 2DRBA 4QZCA 8ICRA 4DOCA 4KLGA 4YMOA 2DR8A 5CR0A 5DDMA 1ZQOA 8ICMA 4M5DA 2W9MA 3OUYA 3C5FA 7ICEA 1WOTA 5J0QA 5J0PA 8ICPA 5J0SA 3C2LA 5D4BA 1ZQPA 4JLXA 3V7JA 4WC7A 4GXKA 8ICTA 4M0AA 4NKUA 3JPTA 1JQRA 1FA0A 1ZQXA 8ICAA 4E80A 3JZ0A 1XSPA 4DOBA 1UEUA 4QZFA 4KLSA 8ICNA 5J0OA 8ICEA 2PFNA 4K96A 4EBKA 5IIMA 4I2IA 4RPYA 3OVAA 5J0RA 4X5VA 1BPZA 9ICIA 4KLIA 4UBCA 5J2FA 4YCXA 2BE3A 4WC0A 4UB2A 1BPBA 4PHPA 3V72A 5DBBA 3OGUA 5HRGA 2DRAA 3TFSA 7ICKA 5J2KA 5DBAA 4KLDA 3PNCA 2M2UA 5D46A 5J2EA 1MQ2A 4R64A 4K9BA 4M9JA 3WFSC 7ICOA 5J2IA 1ZQHA 1ZQSA 8ICUA 2ZH8A 1Q79A 2ZH4A 4JLZA 5DKWA 4UB5A 4M9HA 1PX5A 5DB8A 4Z6CA 4K8VA 4NLKA 4ATBB 4AT7A 3HWTA 1MQ3A 4FHXA 3AQLA 1RZTA 4FO6A 4TURA 1BPXA 4PPXA 4K99A 5DEDA 4JWNA 5IIOA 4X0AA 4Z6EA 4OAFA 1BPEA 5CA7A 4RWPA 3OUYB 2ISPA 1ZQDA 3C66A 4I28A 4FHVA 3LK9A 5J2AA 4O5CA 4XQ7A 5J0TA 7ICUA 3JYYA 4UAWA 8ICLA 4IG8A 4M2YA 2BCSA 8ICIA 4IQVA 4X4OA 4X4QA 2ZH3A 1VFGA 5HRDA 5HHIA 4KLUA 5IINA 4LEYA 4F5QA 3WFQE 3HX0A 1YLQA 4I29A 1ZQBA 4I2DA 4UD5A 5F2VO 4PHEA 3V7LA 4XA5A 1JAJA 4O68A 4I27A 8ICQA 4NXUA 9ICNA 3UPSA 7ICTA 4PHAA 4X0BA 3WFRE 2DR7A 2FMSA 4NXTA 4F5PA 4R66A 1KEJA 4KLMA 4RWNA 1R8CA 4NXZA 3C18A 5J2DA 3NYBA 5J0WA 9ICEA 2GWSA 8ICBA 3L9DA 3RJGA 2HHPA 4RPZA 2FMPA 1ZQKA 4QZ9A 4YD2A 7ICVA 1MIWA 4F5OA 1ZQCA 4KM5A 5CHGA 7ICMA 4QZGA 4O5EA 3RJFA 3MGIA 1ZQWA 9ICWA 4NKTA 5J0YA 2ZH2A 5CJ7A 4KLLA 7ICHA 4O67A 3JPSA 4UBBA 4RQ7A 4KLJA 1UEVA 5IILA 2ID1A 4M04A 4AT9B 3H37A 1R8BA 4WC1A 4UB3A 3AU6A 8ICYA 4E8FA 2B4VA 4IQWA 3RJEA 4K4IA 1ZQJA 4AT9A 4EBJA 3TFRA 3JPQA 5TZVA 9ICSA 4LEWA 4X4RA 5IIIA 3UXNA 3UPQA 1ZQAA 4LZGA 4QZIA 3JPPA 4DO9A 1UETA 2I9GA 5HR9A 4KB6A 1ZQNA 4ATBA 4AT7B 3HJ1A 4MKPA 4I2EA 9ICJA 8ICXA 4I2GA 2NRKA 5BPCA 3UQ0A 5J0UA 4FHPA 2VANA 7ICRA 9ICXA 4M47A 4IQTA 1TFWA 5EOZA 2PFOA 5HRKA 4E7XA 1ZQVA 4K4GA 3HJ4A 5DDYA 3RJJA 4F5NA 7ICPA 4I2FA 1JN3A 1BPDA 4WC4A 4RT3A 3RH6A 4KLQA 3PMNA 1Q78A 5DB6A 4O5KA 1TFYA 4PGQA 3HW8A 3MDCA 4OAIZ 3JPNA 4UD4A 1ZQIA 2B56A 5D49A 1ZJNA 4UB4A 4P4OA 3ISDA 2IHMA 4X4SA 5HRBA 5J2JA 1XSLA 2RFFA 4UAYA 8ICSA 3B0YA 9ICBA 9ICUA 4PGYA 4KLOA 4LEZA 4M9NA 4WBZA 1HUOA 4DOAA 9ICRA 8ICFA 2B51A 2O1PA 3C2MA 3GDXA 1R89A 9ICGA 4X4VA 9ICPA 1ZQZA 5DBCA 3ISCA 4NXVA 7ICNA 4RQ5A 3ISBA 4P4MA 5J2CA 4LT6A 4GXJA 4QZHA 3OVSA 3LQCB 4X4TA 4QZ8A 4RQ1A 4UAZA 5BOMA 4RPXA 4QZAA 3JPRA 3OV7A 4I2HA 4TUQA 4WC6A 4GXIA 4RWOA 9ICHA 4RQ6A 2ZHBA 4K98A 1V4AA 3RH4A 1NOMA 2PFPA 9ICTA 1ZJMA 4FH3A 1F5AA 1R8AA 2ZHAA 4YMNA 4RQ8A 4YN4A 2BCUA 3WFPA 9ICCA 1OU5A 4FH5A 3RH5A 4LZDA 3B0XA 3UXPA 4Z6DA 3V7KA 4RQ4A 3HIYA 4S3NA 4WC5A 3AU2A 9ICAA 4MF8A 5IIJA 4KLHA 1ZQQA 4I2JA 4M9GA 4O9MA 5HRFA 2BPGA 4MFCA 4NXWA 4WCWA 8ICCA 5HRHA 2PBEA 4M9LA 2DR9A 4QZBA 2BPCA 3WFOA 4RQ0A 5CP2A 4MF2A 3AQKA 3C2KA 4RWQA 7ICIA 4IQUA 4LVSA 2P66A 2O5AA 5IIKA 3OVBA 4WC2A 4NY8A 3C5GA 3RJIA 4AT8B 4PGXA 4NM2A 3AQNA 9ICVA 5HC9A 9ICMA 3MDAA 3AQMA 2ZH5A 4LEVA 4FHWA 4MFFA 5HRLA 4WOYA 8ICJA 1BPYA 8ICWA 4KLTA 7ICJA 8ICKA 4YD1A 4P4PA 2FMQA 2PXIA 1JMSA 4TUPA 4F5RA 5J2HA 4KLFA 7ICQA 4RQ2A 1ZQGA 2BCQA 4I2AA 1ZQRA 3H3AA 3JPOA 9ICKA 2DVIA 4WBYA 4XRHA 9ICQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M2V A;  2PFQ A;  3RJH A;  2M2T A;  9ICF A;  4YMM A;  3MGH A;  1ZQL A;  2BCV A;  4NLN A;  4X4N A;  4K4H A;  3H38 A;  4R65 A;  8ICZ A;  1ZQE A;  4RT2 A;  1TV9 A;  8ICO A;  5J29 A;  5DB9 A;  4KLE A;  3K75 D;  4NLZ A;  5J2G A;  2BPF A;  1ZQT A;  5J0X A;  4I2C A;  1RPL A;  5DEC A;  4PH5 A;  4I2B A;  3H39 A;  2ZH1 A;  5HRE A;  3AUO A;  4X4U A;  4AT8 A;  3UXO A;  5J2B A;  2M2W A;  4X4P A;  1MIY A;  2DR5 A;  1KNY A;  4RQ3 A;  3MBY A;  1TVA A;  4UB1 A;  2ISO A;  2ZH9 A;  4NM1 A;  7ICF A;  1HUZ A;  4JWM A;  4QZD A;  4QZE A;  4MFA A;  1MIV A;  4P2H A;  1NO5 A;  7ICL A;  1ZQY A;  1KDH A;  3UQ2 A;  9ICL A;  5BOL A;  4Z6F A;  4XUS A;  9ICO A;  4TUS A;  4FHY A;  8ICH A;  2Q66 A;  1XSN A;  5DB7 A;  4XQ8 A;  5CB1 A;  1ZQF A;  3RJK A;  2BCR A;  3PML A;  1VJ7 A;  7ICG A;  5CWR A;  4EP7 A;  5HHH A;  8ICG A;  5HRI A;  7ICS A;  1ZQU A;  2ZH7 A;  4R63 A;  4WC3 A;  4PHD A;  2ZH6 A;  8ICV A;  1ZQM A;  2DRB A;  4QZC A;  8ICR A;  4DOC A;  4KLG A;  4YMO A;  2DR8 A;  5CR0 A;  5DDM A;  1ZQO A;  8ICM A;  3C5F A;  4M5D A;  2W9M A;  3OUY A;  7ICE A;  1WOT A;  5J0Q A;  5J0P A;  8ICP A;  5J0S A;  3C2L A;  5D4B A;  1ZQP A;  3V7J A;  4WC7 A;  4GXK A;  8ICT A;  4M0A A;  4NKU A;  3JPT A;  1JQR A;  1FA0 A;  1ZQX A;  8ICA A;  4E80 A;  3JZ0 A;  1XSP A;  4DOB A;  1UEU A;  4QZF A;  4KLS A;  8ICN A;  5J0O A;  8ICE A;  2PFN A;  4EBK A;  5IIM A;  4I2I A;  4RPY A;  3OVA A;  5J0R A;  4X5V A;  1BPZ A;  9ICI A;  4KLI A;  4UBC A;  5J2F A;  4YCX A;  2BE3 A;  4WC0 A;  4UB2 A;  1BPB A;  4PHP A;  3V72 A;  5DBB A;  3OGU A;  5HRG A;  3TFS A;  2DRA A;  7ICK A;  5J2K A;  5DBA A;  4KLD A;  3PNC A;  2M2U A;  5D46 A;  5J2E A;  1MQ2 A;  4R64 A;  4M9J A;  3WFS C;  7ICO A;  5J2I A;  1ZQH A;  1ZQS A;  8ICU A;  2ZH8 A;  1Q79 A;  2ZH4 A;  5DKW A;  4UB5 A;  4M9H A;  1PX5 A;  5DB8 A;  4Z6C A;  4NLK A;  4ATB B;  4AT7 A;  3HWT A;  1MQ3 A;  4FHX A;  3AQL A;  1RZT A;  4FO6 A;  4TUR A;  1BPX A;  4PPX A;  5DED A;  4JWN A;  5IIO A;  4X0A A;  4Z6E A;  1BPE A;  5CA7 A;  4RWP A;  3OUY B;  2ISP A;  1ZQD A;  3C66 A;  4I28 A;  4FHV A;  3LK9 A;  5J2A A;  4O5C A;  4XQ7 A;  5J0T A;  7ICU A;  3JYY A;  4UAW A;  8ICL A;  4IG8 A;  4M2Y A;  2BCS A;  8ICI A;  4IQV A;  4X4O A;  4X4Q A;  2ZH3 A;  1VFG A;  5HRD A;  5HHI A;  4KLU A;  5IIN A;  4F5Q A;  3WFQ E;  3HX0 A;  1YLQ A;  4I29 A;  1ZQB A;  4I2D A;  4UD5 A;  5F2V O;  4PHE A;  3V7L A;  4XA5 A;  1JAJ A;  4I27 A;  8ICQ A;  9ICN A;  3UPS A;  7ICT A;  4PHA A;  4X0B A;  3WFR E;  2DR7 A;  2FMS A;  4F5P A;  4R66 A;  1KEJ A;  4KLM A;  4RWN A;  1R8C A;  4NXZ A;  3C18 A;  5J2D A;  3NYB A;  5J0W A;  9ICE A;  2GWS A;  8ICB A;  3L9D A;  3RJG A;  2HHP A;  4RPZ A;  2FMP A;  1ZQK A;  4QZ9 A;  4YD2 A;  7ICV A;  1MIW A;  4F5O A;  1ZQC A;  5CHG A;  7ICM A;  4QZG A;  4O5E A;  3RJF A;  3MGI A;  1ZQW A;  9ICW A;  4NKT A;  5J0Y A;  2ZH2 A;  5CJ7 A;  4KLL A;  7ICH A;  3JPS A;  4UBB A;  4RQ7 A;  4KLJ A;  1UEV A;  5IIL A;  2ID1 A;  4M04 A;  4AT9 B;  3H37 A;  1R8B A;  4WC1 A;  4UB3 A;  3AU6 A;  8ICY A;  4E8F A;  2B4V A;  4IQW A;  3RJE A;  4K4I A;  1ZQJ A;  4AT9 A;  4EBJ A;  3TFR A;  3JPQ A;  5TZV A;  9ICS A;  4X4R A;  5III A;  3UXN A;  3UPQ A;  1ZQA A;  4LZG A;  4QZI A;  3JPP A;  4DO9 A;  1UET A;  2I9G A;  5HR9 A;  1ZQN A;  4ATB A;  4AT7 B;  3HJ1 A;  4I2E A;  9ICJ A;  8ICX A;  4I2G A;  2NRK A;  5BPC A;  3UQ0 A;  5J0U A;  4FHP A;  2VAN A;  7ICR A;  9ICX A;  4M47 A;  4IQT A;  1TFW A;  5EOZ A;  2PFO A;  5HRK A;  4E7X A;  1ZQV A;  4K4G A;  3HJ4 A;  5DDY A;  3RJJ A;  4F5N A;  7ICP A;  4I2F A;  1JN3 A;  1BPD A;  4WC4 A;  4RT3 A;  3RH6 A;  4KLQ A;  3PMN A;  1Q78 A;  5DB6 A;  4O5K A;  1TFY A;  4PGQ A;  3HW8 A;  3MDC A;  1ZQI A;  3JPN A;  4UD4 A;  2B56 A;  5D49 A;  1ZJN A;  4UB4 A;  4P4O A;  3ISD A;  2IHM A;  5HRB A;  4X4S A;  5J2J A;  1XSL A;  2RFF A;  4UAY A;  8ICS A;  3B0Y A;  9ICB A;  9ICU A;  4PGY A;  4KLO A;  4M9N A;  4WBZ A;  1HUO A;  4DOA A;  9ICR A;  8ICF A;  2B51 A;  2O1P A;  3C2M A;  3GDX A;  1R89 A;  9ICG A;  4X4V A;  9ICP A;  1ZQZ A;  5DBC A;  3ISC A;  7ICN A;  4RQ5 A;  3ISB A;  4P4M A;  5J2C A;  4LT6 A;  4GXJ A;  4QZH A;  3OVS A;  3LQC B;  4QZ8 A;  4X4T A;  4RQ1 A;  4UAZ A;  5BOM A;  4RPX A;  4QZA A;  3JPR A;  3OV7 A;  4I2H A;  4TUQ A;  4WC6 A;  4GXI A;  4RWO A;  9ICH A;  4RQ6 A;  2ZHB A;  3RH4 A;  1V4A A;  1NOM A;  2PFP A;  9ICT A;  1ZJM A;  4FH3 A;  1F5A A;  1R8A A;  4YMN A;  2ZHA A;  4RQ8 A;  4YN4 A;  2BCU A;  3WFP A;  9ICC A;  1OU5 A;  4FH5 A;  3RH5 A;  4LZD A;  3B0X A;  3UXP A;  4Z6D A;  3V7K A;  4RQ4 A;  3HIY A;  4S3N A;  4WC5 A;  3AU2 A;  9ICA A;  4MF8 A;  5IIJ A;  4KLH A;  1ZQQ A;  4I2J A;  4M9G A;  4O9M A;  5HRF A;  2BPG A;  4MFC A;  4WCW A;  8ICC A;  5HRH A;  2PBE A;  4M9L A;  2DR9 A;  4QZB A;  2BPC A;  3WFO A;  4RQ0 A;  5CP2 A;  4MF2 A;  3AQK A;  3C2K A;  4RWQ A;  7ICI A;  4IQU A;  4LVS A;  2P66 A;  2O5A A;  5IIK A;  3OVB A;  4WC2 A;  4NY8 A;  3C5G A;  3RJI A;  4AT8 B;  4PGX A;  4NM2 A;  3AQN A;  9ICV A;  5HC9 A;  9ICM A;  3MDA A;  3AQM A;  2ZH5 A;  4FHW A;  4MFF A;  5HRL A;  8ICJ A;  1BPY A;  8ICW A;  4KLT A;  7ICJ A;  8ICK A;  4YD1 A;  4P4P A;  2FMQ A;  2PXI A;  1JMS A;  4TUP A;  4F5R A;  5J2H A;  4KLF A;  7ICQ A;  4RQ2 A;  1ZQG A;  2BCQ A;  4I2A A;  1ZQR A;  3H3A A;  3JPO A;  9ICK A;  4XRH A;  4WBY A;  2DVI A;  9ICQ A; 
#chains in the Genus database with same CATH topology
 2M2V A;  4OAG A;  4HX0 A;  2PFQ A;  3RJH A;  2M2T A;  9ICF A;  4YMM A;  3MGH A;  1ZQL A;  4K9A A;  2BCV A;  4NLN A;  4X4N A;  4K97 A;  4K4H A;  3H38 A;  4R65 A;  8ICZ A;  1ZQE A;  4RT2 A;  1TV9 A;  8ICO A;  5J29 A;  5DB9 A;  4KLE A;  3K75 D;  5JTG A;  4NLZ A;  5J2G A;  2BPF A;  1ZQT A;  5J0X A;  4I2C A;  4N7R A;  1RPL A;  5DEC A;  4PH5 A;  4I2B A;  2ZH1 A;  3H39 A;  5HRE A;  4X4U A;  5CFU A;  4AT8 A;  3AUO A;  3UXO A;  5J2B A;  2M2W A;  4X4P A;  1MIY A;  2DR5 A;  3PHZ A;  4O6A A;  1KNY A;  4RQ3 A;  3MBY A;  5B3P A;  1TVA A;  4UB1 A;  2ISO A;  2ZH9 A;  4NM1 A;  7ICF A;  1HUZ A;  4JWM A;  4QZD A;  4QZE A;  4MFA A;  1MIV A;  4P2H A;  1NO5 A;  7ICL A;  1ZQY A;  1KDH A;  3UQ2 A;  9ICL A;  5BOL A;  4Z6F A;  4XUS A;  5B3Q A;  9ICO A;  4TUS A;  4FHY A;  8ICH A;  2Q66 A;  1XSN A;  5DB7 A;  4NXX A;  4OAH A;  4XQ8 A;  5CB1 A;  1ZQF A;  2BCR A;  3RJK A;  5D62 A;  3PML A;  1VJ7 A;  7ICG A;  5CWR A;  4EP7 A;  5HHH A;  1GPJ A;  4O69 A;  8ICG A;  5HRI A;  7ICS A;  1ZQU A;  2ZH7 A;  4R63 A;  4WC3 A;  4PHD A;  2ZH6 A;  8ICV A;  1ZQM A;  2DRB A;  4QZC A;  8ICR A;  4DOC A;  4KLG A;  4YMO A;  2DR8 A;  5CR0 A;  5DDM A;  1ZQO A;  8ICM A;  4M5D A;  2W9M A;  3OUY A;  3C5F A;  7ICE A;  1WOT A;  5J0Q A;  5J0P A;  8ICP A;  5J0S A;  3C2L A;  5D4B A;  2GAF D;  1ZQP A;  4JLX A;  3V7J A;  4WC7 A;  2EWR A;  4EV6 A;  4GXK A;  8ICT A;  4M0A A;  4NKU A;  3JPT A;  1JQR A;  1FA0 A;  1ZQX A;  8ICA A;  4E80 A;  3JZ0 A;  1XSP A;  4DOB A;  1UEU A;  4QZF A;  4KLS A;  8ICN A;  5J0O A;  8ICE A;  2PFN A;  4K96 A;  4EBK A;  5IIM A;  4I2I A;  4RPY A;  3OVA A;  5J0R A;  4X5V A;  1BPZ A;  9ICI A;  4KLI A;  4UBC A;  4WQL A;  5J2F A;  4YCX A;  2BE3 A;  4WC0 A;  4UB2 A;  4EEB A;  1BPB A;  4PHP A;  3V72 A;  5DBB A;  3OGU A;  5HRG A;  2DRA A;  3TFS A;  7ICK A;  5J2K A;  2GA9 D;  5DBA A;  4KLD A;  3PNC A;  2M2U A;  5D46 A;  5J2E A;  1MQ2 A;  4R64 A;  4K9B A;  4M9J A;  3WFS C;  7ICO A;  5J2I A;  5CFS A;  1ZQS A;  1ZQH A;  8ICU A;  2ZH8 A;  1Q79 A;  2ZH4 A;  4JLZ A;  5DKW A;  4UB5 A;  4M9H A;  1PX5 A;  5DB8 A;  4Z6C A;  4K8V A;  4NLK A;  4ATB B;  4AT7 A;  3HWT A;  1MQ3 A;  4FHX A;  5D61 A;  3AQL A;  1RZT A;  4FO6 A;  4TUR A;  1BPX A;  4PPX A;  4K99 A;  5DED A;  4JWN A;  5IIO A;  4X0A A;  4Z6E A;  4OAF A;  1BPE A;  5CA7 A;  4RWP A;  3OUY B;  2ISP A;  1ZQD A;  3C66 A;  4I28 A;  4FHV A;  3LK9 A;  5J2A A;  4O5C A;  4XQ7 A;  5J0T A;  7ICU A;  3JYY A;  4UAW A;  3JCF A;  8ICL A;  4IG8 A;  3ER9 B;  4M2Y A;  2BCS A;  8ICI A;  4IQV A;  4X4O A;  4X4Q A;  2ZH3 A;  1VFG A;  5HRD A;  3NKU A;  5HHI A;  4KLU A;  2BBJ A;  5IIN A;  4LEY A;  4F5Q A;  3WFQ E;  3HX0 A;  2IHO A;  2HN1 A;  4EGW A;  1YLQ A;  4EED A;  4I29 A;  1ZQB A;  4I2D A;  4UD5 A;  5F2V O;  4PHE A;  3V7L A;  4XA5 A;  1JAJ A;  4O68 A;  4I27 A;  8ICQ A;  4NXU A;  9ICN A;  3UPS A;  3EF2 A;  7ICT A;  4PHA A;  4X0B A;  3WFR E;  2DR7 A;  2FMS A;  4NXT A;  4F5P A;  4R66 A;  4RWN A;  1KEJ A;  4KLM A;  1R8C A;  4NXZ A;  3C18 A;  5J2D A;  3NYB A;  3MCR A;  5J0W A;  9ICE A;  2GWS A;  8ICB A;  3L9D A;  3RJG A;  2HHP A;  4RPZ A;  2FMP A;  1ZQK A;  4QZ9 A;  4YD2 A;  7ICV A;  1MIW A;  4F5O A;  1ZQC A;  4KM5 A;  5CHG A;  7ICM A;  4QZG A;  4O5E A;  3RJF A;  3MGI A;  1ZQW A;  9ICW A;  4NKT A;  5J0Y A;  2ZH2 A;  5CJ7 A;  4KLL A;  7ICH A;  4O67 A;  3JPS A;  4UBB A;  4WQK A;  4WH5 A;  4RQ7 A;  2HN2 A;  4KLJ A;  1UEV A;  3K7D A;  2ID1 A;  5IIL A;  4M04 A;  4AT9 B;  3H37 A;  1R8B A;  4WC1 A;  4UB3 A;  3AU6 A;  3ER8 C;  8ICY A;  4E8F A;  2B4V A;  4IQW A;  3RJE A;  4K4I A;  1ZQJ A;  4AT9 A;  4EBJ A;  3TFR A;  3JPQ A;  5TZV A;  9ICS A;  4LEW A;  4X4R A;  5III A;  3UXN A;  5CFT A;  3UPQ A;  1ZQA A;  4LZG A;  4QZI A;  3JPP A;  4DO9 A;  1UET A;  3NWI A;  5D63 A;  2I9G A;  5HR9 A;  4KB6 A;  1ZQN A;  4ATB A;  4AT7 B;  3HJ1 A;  4MKP A;  4I2E A;  9ICJ A;  8ICX A;  4I2G A;  2BBH A;  2NRK A;  5BPC A;  3UQ0 A;  5J0U A;  4FHP A;  2VAN A;  7ICR A;  9ICX A;  4M47 A;  4IQT A;  3NVO A;  1TFW A;  5EOZ A;  2PFO A;  5HRK A;  4E7X A;  1ZQV A;  4K4G A;  3HJ4 A;  5DDY A;  3RJJ A;  4F5N A;  7ICP A;  4I2F A;  1JN3 A;  1BPD A;  4WC4 A;  4RT3 A;  3RH6 A;  4KLQ A;  3PMN A;  1Q78 A;  5DB6 A;  4O5K A;  1TFY A;  4PGQ A;  3HW8 A;  3MDC A;  4OAI Z;  3JPN A;  4UD4 A;  1ZQI A;  2B56 A;  5D49 A;  1ZJN A;  4UB4 A;  4P4O A;  2IUB A;  3ISD A;  3OWG A;  2IHM A;  4XJE A;  4X4S A;  5HRB A;  5J2J A;  1XSL A;  2RFF A;  4UAY A;  8ICS A;  3B0Y A;  9ICB A;  9ICU A;  4PGY A;  4KLO A;  4LEZ A;  4M9N A;  4WBZ A;  1HUO A;  4DOA A;  9ICR A;  8ICF A;  2B51 A;  2O1P A;  3C2M A;  3GDX A;  1R89 A;  9ICG A;  4X4V A;  9ICP A;  1ZQZ A;  5DBC A;  3ISC A;  4NXV A;  7ICN A;  4RQ5 A;  3ISB A;  4P4M A;  5J2C A;  4LT6 A;  4GXJ A;  4QZH A;  3OVS A;  3LQC B;  4X4T A;  4QZ8 A;  4RQ1 A;  4UAZ A;  5BOM A;  4RPX A;  4QZA A;  3JPR A;  3OV7 A;  5CHE A;  4TUQ A;  4WC6 A;  4I2H A;  4GXI A;  4RWO A;  9ICH A;  4RQ6 A;  2ZHB A;  4K98 A;  1V4A A;  3RH4 A;  1NOM A;  4FO1 A;  2PFP A;  9ICT A;  1ZJM A;  4I0U A;  4FH3 A;  1F5A A;  1R8A A;  2ZHA A;  4YMN A;  4RQ8 A;  4YN4 A;  2BCU A;  3WFP A;  9ICC A;  3CK6 A;  1OU5 A;  4FH5 A;  3RH5 A;  4LZD A;  3B0X A;  3UXP A;  4Z6D A;  3V7K A;  4RQ4 A;  3HIY A;  4S3N A;  4WC5 A;  3AU2 A;  9ICA A;  4MF8 A;  5IIJ A;  4KLH A;  1ZQQ A;  4I2J A;  4M9G A;  4O9M A;  5HRF A;  2BPG A;  4MFC A;  4NXW A;  4WCW A;  8ICC A;  5HRH A;  2PBE A;  4M9L A;  2DR9 A;  4QZB A;  2BPC A;  3WFO A;  4RQ0 A;  5CP2 A;  4MF2 A;  3AQK A;  3C2K A;  4RWQ A;  7ICI A;  4IQU A;  3ERC C;  4LVS A;  2P66 A;  2O5A A;  5IIK A;  3OVB A;  4WC2 A;  4NY8 A;  3C5G A;  3RJI A;  4AT8 B;  4PGX A;  4NM2 A;  3AQN A;  9ICV A;  5HC9 A;  9ICM A;  3MDA A;  3AQM A;  2ZH5 A;  4LEV A;  4FHW A;  2FCL A;  4MFF A;  5HRL A;  4WOY A;  8ICJ A;  1BPY A;  8ICW A;  4KLT A;  7ICJ A;  8ICK A;  4YD1 A;  4P4P A;  2FMQ A;  2PXI A;  1JMS A;  4TUP A;  4F5R A;  5J2H A;  4KLF A;  7ICQ A;  4RQ2 A;  1ZQG A;  2BCQ A;  4I2A A;  1ZQR A;  3H3A A;  3JPO A;  9ICK A;  2DVI A;  4WBY A;  4XRH A;  9ICQ A; 
#chains in the Genus database with same CATH homology
 2M2V A;  4OAG A;  2PFQ A;  3RJH A;  2M2T A;  9ICF A;  4YMM A;  3MGH A;  1ZQL A;  4K9A A;  2BCV A;  4NLN A;  4X4N A;  4K97 A;  4K4H A;  3H38 A;  4R65 A;  8ICZ A;  1ZQE A;  4RT2 A;  1TV9 A;  8ICO A;  5J29 A;  5DB9 A;  4KLE A;  3K75 D;  4NLZ A;  5J2G A;  2BPF A;  1ZQT A;  5J0X A;  4I2C A;  1RPL A;  5DEC A;  4PH5 A;  4I2B A;  2ZH1 A;  3H39 A;  4X4U A;  5HRE A;  3AUO A;  4AT8 A;  3UXO A;  5J2B A;  2M2W A;  4X4P A;  1MIY A;  2DR5 A;  4O6A A;  1KNY A;  4RQ3 A;  3MBY A;  1TVA A;  4UB1 A;  2ISO A;  2ZH9 A;  4NM1 A;  7ICF A;  1HUZ A;  4JWM A;  4QZD A;  4QZE A;  4MFA A;  1MIV A;  4P2H A;  1NO5 A;  7ICL A;  1ZQY A;  1KDH A;  3UQ2 A;  9ICL A;  5BOL A;  4Z6F A;  4XUS A;  9ICO A;  4TUS A;  4FHY A;  8ICH A;  2Q66 A;  1XSN A;  5DB7 A;  4NXX A;  4OAH A;  4XQ8 A;  5CB1 A;  1ZQF A;  2BCR A;  3RJK A;  3PML A;  1VJ7 A;  7ICG A;  5CWR A;  4EP7 A;  5HHH A;  4O69 A;  8ICG A;  5HRI A;  7ICS A;  1ZQU A;  2ZH7 A;  4R63 A;  4WC3 A;  4PHD A;  2ZH6 A;  8ICV A;  1ZQM A;  2DRB A;  4QZC A;  8ICR A;  4DOC A;  4KLG A;  4YMO A;  2DR8 A;  5CR0 A;  5DDM A;  1ZQO A;  8ICM A;  4M5D A;  2W9M A;  3OUY A;  3C5F A;  7ICE A;  1WOT A;  5J0Q A;  5J0P A;  8ICP A;  5J0S A;  3C2L A;  5D4B A;  1ZQP A;  4JLX A;  3V7J A;  4WC7 A;  4GXK A;  8ICT A;  4M0A A;  4NKU A;  3JPT A;  1JQR A;  1FA0 A;  1ZQX A;  8ICA A;  4E80 A;  3JZ0 A;  1XSP A;  4DOB A;  1UEU A;  4QZF A;  4KLS A;  8ICN A;  5J0O A;  8ICE A;  2PFN A;  4K96 A;  4EBK A;  5IIM A;  4I2I A;  4RPY A;  3OVA A;  5J0R A;  4X5V A;  1BPZ A;  9ICI A;  4KLI A;  4UBC A;  5J2F A;  4YCX A;  2BE3 A;  4WC0 A;  4UB2 A;  1BPB A;  4PHP A;  3V72 A;  5DBB A;  3OGU A;  5HRG A;  2DRA A;  3TFS A;  7ICK A;  5J2K A;  5DBA A;  4KLD A;  3PNC A;  2M2U A;  5D46 A;  5J2E A;  1MQ2 A;  4R64 A;  4K9B A;  4M9J A;  3WFS C;  7ICO A;  5J2I A;  1ZQH A;  1ZQS A;  8ICU A;  2ZH8 A;  1Q79 A;  2ZH4 A;  4JLZ A;  5DKW A;  4UB5 A;  4M9H A;  1PX5 A;  5DB8 A;  4Z6C A;  4K8V A;  4NLK A;  4ATB B;  4AT7 A;  3HWT A;  1MQ3 A;  4FHX A;  3AQL A;  1RZT A;  4FO6 A;  4TUR A;  1BPX A;  4PPX A;  4K99 A;  5DED A;  4JWN A;  5IIO A;  4X0A A;  4Z6E A;  4OAF A;  1BPE A;  5CA7 A;  4RWP A;  3OUY B;  2ISP A;  1ZQD A;  3C66 A;  4I28 A;  4FHV A;  3LK9 A;  5J2A A;  4O5C A;  4XQ7 A;  5J0T A;  7ICU A;  3JYY A;  4UAW A;  8ICL A;  4IG8 A;  4M2Y A;  2BCS A;  8ICI A;  4IQV A;  4X4O A;  4X4Q A;  2ZH3 A;  1VFG A;  5HRD A;  5HHI A;  4KLU A;  5IIN A;  4LEY A;  4F5Q A;  3WFQ E;  3HX0 A;  1YLQ A;  4I29 A;  1ZQB A;  4I2D A;  4UD5 A;  5F2V O;  4PHE A;  3V7L A;  4XA5 A;  1JAJ A;  4O68 A;  4I27 A;  8ICQ A;  4NXU A;  9ICN A;  3UPS A;  7ICT A;  4PHA A;  4X0B A;  3WFR E;  2DR7 A;  2FMS A;  4NXT A;  4F5P A;  4R66 A;  1KEJ A;  4KLM A;  4RWN A;  1R8C A;  4NXZ A;  3C18 A;  5J2D A;  3NYB A;  5J0W A;  9ICE A;  2GWS A;  8ICB A;  3L9D A;  3RJG A;  2HHP A;  4RPZ A;  2FMP A;  1ZQK A;  4QZ9 A;  4YD2 A;  7ICV A;  1MIW A;  4F5O A;  1ZQC A;  4KM5 A;  5CHG A;  7ICM A;  4QZG A;  4O5E A;  3RJF A;  3MGI A;  1ZQW A;  9ICW A;  4NKT A;  5J0Y A;  2ZH2 A;  5CJ7 A;  4KLL A;  7ICH A;  4O67 A;  3JPS A;  4UBB A;  4RQ7 A;  4KLJ A;  1UEV A;  5IIL A;  2ID1 A;  4M04 A;  4AT9 B;  3H37 A;  1R8B A;  4WC1 A;  4UB3 A;  3AU6 A;  8ICY A;  4E8F A;  2B4V A;  4IQW A;  3RJE A;  4K4I A;  1ZQJ A;  4AT9 A;  4EBJ A;  3TFR A;  3JPQ A;  5TZV A;  9ICS A;  4LEW A;  4X4R A;  5III A;  3UXN A;  3UPQ A;  1ZQA A;  4LZG A;  4QZI A;  3JPP A;  4DO9 A;  1UET A;  2I9G A;  5HR9 A;  4KB6 A;  1ZQN A;  4ATB A;  4AT7 B;  3HJ1 A;  4MKP A;  4I2E A;  9ICJ A;  8ICX A;  4I2G A;  2NRK A;  5BPC A;  3UQ0 A;  5J0U A;  4FHP A;  2VAN A;  7ICR A;  9ICX A;  4M47 A;  4IQT A;  1TFW A;  5EOZ A;  2PFO A;  5HRK A;  4E7X A;  1ZQV A;  4K4G A;  3HJ4 A;  5DDY A;  3RJJ A;  4F5N A;  7ICP A;  4I2F A;  1JN3 A;  1BPD A;  4WC4 A;  4RT3 A;  3RH6 A;  4KLQ A;  3PMN A;  1Q78 A;  5DB6 A;  4O5K A;  1TFY A;  4PGQ A;  3HW8 A;  3MDC A;  4OAI Z;  3JPN A;  4UD4 A;  1ZQI A;  2B56 A;  5D49 A;  1ZJN A;  4UB4 A;  4P4O A;  3ISD A;  2IHM A;  4X4S A;  5HRB A;  5J2J A;  1XSL A;  2RFF A;  4UAY A;  8ICS A;  3B0Y A;  9ICB A;  9ICU A;  4PGY A;  4KLO A;  4LEZ A;  4M9N A;  4WBZ A;  1HUO A;  4DOA A;  9ICR A;  8ICF A;  2B51 A;  2O1P A;  3C2M A;  3GDX A;  1R89 A;  9ICG A;  4X4V A;  9ICP A;  1ZQZ A;  5DBC A;  3ISC A;  4NXV A;  7ICN A;  4RQ5 A;  3ISB A;  4P4M A;  5J2C A;  4LT6 A;  4GXJ A;  4QZH A;  3OVS A;  3LQC B;  4X4T A;  4QZ8 A;  4RQ1 A;  4UAZ A;  5BOM A;  4RPX A;  4QZA A;  3JPR A;  3OV7 A;  4I2H A;  4TUQ A;  4WC6 A;  4GXI A;  4RWO A;  9ICH A;  4RQ6 A;  2ZHB A;  4K98 A;  1V4A A;  3RH4 A;  1NOM A;  2PFP A;  9ICT A;  1ZJM A;  4FH3 A;  1F5A A;  1R8A A;  2ZHA A;  4YMN A;  4RQ8 A;  4YN4 A;  2BCU A;  3WFP A;  9ICC A;  1OU5 A;  4FH5 A;  3RH5 A;  4LZD A;  3B0X A;  3UXP A;  4Z6D A;  3V7K A;  4RQ4 A;  3HIY A;  4S3N A;  4WC5 A;  3AU2 A;  9ICA A;  4MF8 A;  5IIJ A;  4KLH A;  1ZQQ A;  4I2J A;  4M9G A;  4O9M A;  5HRF A;  2BPG A;  4MFC A;  4NXW A;  4WCW A;  8ICC A;  5HRH A;  2PBE A;  4M9L A;  2DR9 A;  4QZB A;  2BPC A;  3WFO A;  4RQ0 A;  5CP2 A;  4MF2 A;  3AQK A;  3C2K A;  4RWQ A;  7ICI A;  4IQU A;  4LVS A;  2P66 A;  2O5A A;  5IIK A;  3OVB A;  4WC2 A;  4NY8 A;  3C5G A;  3RJI A;  4AT8 B;  4PGX A;  4NM2 A;  3AQN A;  9ICV A;  5HC9 A;  9ICM A;  3MDA A;  3AQM A;  2ZH5 A;  4LEV A;  4FHW A;  4MFF A;  5HRL A;  4WOY A;  8ICJ A;  1BPY A;  8ICW A;  4KLT A;  7ICJ A;  8ICK A;  4YD1 A;  4P4P A;  2FMQ A;  2PXI A;  1JMS A;  4TUP A;  4F5R A;  5J2H A;  4KLF A;  7ICQ A;  4RQ2 A;  1ZQG A;  2BCQ A;  4I2A A;  1ZQR A;  3H3A A;  3JPO A;  9ICK A;  2DVI A;  4WBY A;  4XRH A;  9ICQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...