4F5QA

Closed ternary complex of r283k dna polymerase beta
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
326
structure length
320
Chain Sequence
TLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMKAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of dNTP Intermediate States during DNA Polymerase Active Site Assembly.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase, lyase/dna
molecule keywords DNA polymerase beta
total genus 105
structure length 320
sequence length 326
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4f5qA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4f5qA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4f5qA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4f5qA03
1MQ3A 5HRBA 2H5XA 2XC9A 2XCAA 3H8WA 4PHAA 4DFJA 3TARA 3N4MB 3GIJA 1S77D 2W9CA 4YR0A 5KT2A 4WC1A 2HHUA 4GC6A 3JZ0A 1A76A 4RQ7A 1TK0A 1Z00B 4RPYA 4X4RA 2A1JA 2DVIA 2F1IA 5KG3A 4F50A 5BOMA 5D4BA 4ECXA 4GXIA 1L5UA 2AQ4A 5KFRA 1ZQYA 4RT3A 4B9SA 4IRCA 4EBJA 1R8AA 3RAXA 3ISCA 3C1YA 5KFBA 4QWAA 3V72A 1T8EA 5J2HA 2JZBA 2NRVA 2ZUBA 3H3AA 1ZQPA 5CWRA 1S97A 2PFOA 1XSPA 5J2CA 4Q43A 4RNNA 3MR6A 4ED7A 1NKBA 5J0QA 4O5CA 1CEZA 9ICEA 3PVXA 5KFFA 3LDAA 4DL3A 1WOTA 4NY8A 2ZTCA 1Z00A 4I2IA 2BPFA 1S0VA 3RRGA 5DB7A 5KFUA 4IRKA 1XC9A 2O1PA 4MFAA 2ZJ8A 2BQUA 3QE9Y 8ICVA 4KITB 3MDAA 3UQ0A 3PV8A 2HVHA 1A77A 2M9NA 3HWTA 2ALZA 1KDHA 2ZHAA 3AU2A 3V6HA 4YD1A 4RQ5A 4J9KA 3PO4A 3GIIA 1NK9A 4RU9A 3AQKA 7ICLA 3WFRE 1BPEA 1ZQUA 3C1ZA 4RUCA 1VFGA 4UB5A 2C2EA 5KFVA 1KFSA 2NRXA 4O5EA 5DBCA 1Q78A 5J0SA 3H40A 2AU0A 4F4KA 8ICMA 2VANA 9ICNA 4M2YA 3PNCA 2VA2A 3BDPA 4LZDA 2BKEA 3SI8A 3H8JA 4YQWA 2DRAA 2W9BA 5HNKA 4F8RA 1ZQXA 1XO1A 1XWLA 3RJEA 9ICGA 5DLFA 4AT7B 3V6JA 3RB0A 2PFNA 3TFSA 3PW5A 3WFOA 3MGIA 2BCVA 4PH5A 4QZ8A 2Y1IA 1NO5A 4YR3A 2XO7A 4MFFA 5HR9A 1NJZA 1OU5A 2V9WA 1TAUA 4C8NA 9ICUA 5KFIA 3NGDA 4DLGA 5KG0A 4I2AA 4XQ8A 2HHVA 4O3QA 3PMNA 2BQRA 4F3OA 4I2FA 4ECRA 2BCSA 4O5KA 5HMMA 5C5JA 4QZBA 1ZQJA 7ICHA 5DLGA 2DPJA 3H8SA 5BOLA 1C7YA 8ICFA 8ICXA 4RUAA 4RWPA 1R8BA 2BE3A 9ICWA 2ZH4A 3WFQE 2KFZA 4G3IA 4NLGA 3MBYA 3RJJA 4I27A 3KHRA 4K4GA 8ICHA 4ELUA 8ICNA 3TANA 3ZDBA 3OUYB 1X2IA 2KZ3A 4ED3A 2UVUA 7ICNA 2M2TA 3BJYA 3HIYA 4IQTA 4QZIA 2FMSA 1BGXT 3OGUA 2FPMA 3SV4A 1ZQLA 4FS2A 3GV5B 2BCUA 2P66A 3RB4A 3BQ2A 4I2GA 2MAXA 4F5PA 4F4XA 3IM1A 2RDJA 2BPGA 2ISOA 1PX5A 2Q66A 3PW0A 3OVBA 5CP2A 4J9OA 5DB8A 4UAZA 1SL2A 8ICJA 2ZH8A 4DFKA 1TFWA 3EZ5A 4KLEA 4FHVA 1K1QA 1U4BA 1MIWA 2A1JB 4O3PA 3PX4A 1JIHA 3RJIA 2R8KA 4R63A 8ICSA 4MEXA 2KP7A 3K75D 3GV8B 4YG2A 4PGYA 3RAQA 7ICGA 1D8LA 5DQHA 4RQ8A 3GDXA 1D9FA 1BNPA 4X4OA 3ORYA 2P6UA 3T5JA 2JEIA 5DDMA 3OHBA 2W8KA 4DEZA 1IXRA 4JV2A 5L1LA 4NKUA 3MABA 2IMWP 4HYKA 3H4BA 2C2DA 1HUOA 1T4GA 8ICYA 5KFKA 3MR3A 1ZQEA 1UETA 5EOZA 1ZJNA 1DOQA 4WC7A 4M47A 3PW4A 5HRHA 4AT9B 3V7JA 5HP4A 5J2KA 3LQCB 4KLDA 3LWMA 4RWNA 9ICRA 3ETLA 4EYIB 3GV7B 1JXEA 4EBCA 3BQ0A 1D8YA 2J6UA 4ELVA 3H7IA 4DQSA 4BWJA 1ZQWA 1U49A 5HRFA 2RFFA 1KLNA 5KG6A 4F93B 4UB2A 1NK7A 2HHSA 2C22A 2XY7A 4QZEA 9ICJA 4X4TA 1TFRA 2W9MA 4DOBA 4KLMA 1QSYA 4EBEA 3C2KA 1ZQMA 4K4HA 7ICJA 5DG9A 3AU6A 4IQVA 1SKRA 2GWSA 3T3FA 3Q8SB 1MIYA 5IIMA 2FMPA 3UQ2A 4QW9A 4QWBA 4QZHA 1U47A 3PR4A 5KFEA 2ASJA 3PMLA 3QZ7A 1TAQA 4TQSA 3AQMA 5D49A 9ICAA 5HRGA 5J0UA 3T5KA 3Q8KA 4KLOA 3H38A 4EYHB 3C66A 4M9JA 2OWOA 4RPZA 4YXJA 5DQGA 5EWGA 1ZQAA 3JPRA 8ICLA 1AROP 5HHHA 3SZ2A 1U45A 3OHAA 1TK8A 1VJ7A 1Y88A 5IIOA 4E80A 3JYYA 4NLKA 4KN4A 3Q8RB 2XCPA 2V4QA 8ICBA 4R66A 2MUTB 3JPSA 3AUOA 2XGPA 4DL4A 2IA6A 2ZUCA 2JZBB 4KLHA 2IBKA 4UAYA 2JEJA 4WC6A 3JPPA 2M2VA 2BPCA 1S76D 3KHGA 5HREA 2PI4A 4PHDA 3H4DA 4J9MA 3SYZA 1ZQRA 4PHEA 4YP3A 3N97B 3RB6A 4X4SA 7ICKA 2ZH7A 3ISDA 2PXIA 9ICSA 5DECA 1N56A 7ICFA 4RT2A 5HRDA 4KLUA 5DB6A 4RQ1A 1BPZA 3EPGA 3RH6A 2ZH2A 4RNMA 1JXLA 4DO9A 1X9MA 3L9DA 2R8IA 4RWOA 2BR0A 4F4ZA 4DLEA 2UVRA 3RR7A 1ZQHA 1SKWA 3UXNA 5KFMA 4B9LA 4UD5A 1BPYA 1BPXA 8ICEA 5CA7A 4I2BA 2ZH5A 2DRBA 8ICWA 3C18A 5IILA 4EBKA 3Q8QB 7ICTA 9ICTA 5KT6A 3RJFA 1XU4A 4XQ7A 2ZH1A 4X0BA 2DR7A 4YCXA 4XA5A 3IHQB 4PHPA 3Q8LA 4YVZA 3UXOA 4QZGA 5J0YA 4B9UA 1JAJA 5J2DA 3GILA 4X4NA 2KN7A 3HP6A 2IHMA 2ZH6A 2FPKA 5IINA 4Q45A 3QEBZ 3RJHA 4ATBA 4ED1A 1S9FA 1QSSA 2F1JA 2ZTDA 3ZD8A 4YFKA 3T5LA 1L3UA 3ZDCA 4NLZA 4X4UA 3PY8A 4I2JA 3OVAA 4QZ9A 3HX0A 3PW7A 3M8SA 2XY5A 2HW3A 4WC2A 4ECTA 4AT8B 4YD2A 2AJQA 5J0RA 7ICSA 4DFMA 8ICUA 4ECYA 4O3NA 4YN4A 4DL7A 4Z6FA 2HHXA 4AT8A 4KLJA 2ZJAA 2FLPA 4LZGA 1Z3EB 3RBEA 4IG8A 4PGQA 1KRPA 2HVIA 4JV1A 2HHQA 2FLLA 4Z6CA 4ED2A 2AGQA 1TKDA 4K4IA 1JQRA 4KLTA 5DBAA 1SL0A 1YLQA 1ZQKA 4IR1A 2Y1JA 4CCHA 4RQ4A 1NJWA 1RXWA 3GFKB 2JEFA 5J0OA 2LYHA 2W9BB 3UPQA 3V6KA 2ISPA 4FS1A 3MDCA 2R8HA 3RR8A 3G6YA 4DSJA 5J0WA 1NK5A 4IQUA 5KFQA 3FYHA 4E7XA 5F9NA 5KFHA 5KFDA 3KHHA 3T5HA 2DR9A 4P4MA 5EWFA 3M9NB 3M8RA 4KMUA 1X9WA 4FHPA 3B0XA 4RQ2A 4NM2A 4RNOA 4PGXA 4GLXA 3NYBA 3MFIA 1NJXA 4FHXA 1HJPA 3PO5A 4LT6A 1UEVA 2ASDA 5J2EA 3OVSA 7ICQA 1UT5A 2NRZA 3M9MB 5HMLA 4F4YA 2DFLA 3RH5A 1TV9A 2B21A 8ICPA 4ZH4A 1HUZA 5KG5A 4I29A 4MFCA 4DL6A 5L1IA 2XY6A 2ATLA 4C8LA 4C8KA 5KG1A 7ICMA 2M2WA 4EEYA 2DR5A 1TFYA 4JWMA 4B9NA 3ZDDA 1JN3A 4AT7A 5KFOA 3PX0A 3UXPA 2I9GA 5DKWA 4O3OA 2ASLA 9ICBA 4QZCA 3QEAZ 4B9MA 5DGBA 3WFPA 4F5NA 4WC5A 4R64A 4M9HA 4BWMA 5KFLA 2NRTA 3PR5B 4BDPA 7ICRA 5F2VO 4F5RA 4IR9A 4ELTA 4DF4A 4KLFA 4QWDA 1K1SA 2BGWA 4KLSA 5IIIA 5DB9A 2W8LA 4Z6DA 2C2RA 2BCQA 2FMQA 5KG7A 1ZQIA 3C23A 2BQ3A 4DQPA 2Q0ZX 2PBEA 1RPLA 9ICMA 1SZPA 3AQLA 5HRLA 3C2LA 1MQ2A 2FLNA 4GXKA 1L3SA 5KG2A 4UQGA 8ICOA 4TURA 5KT3A 1XS9D 1TVAA 4ECQA 4B9TA 2ZHBA 4J9PA 1S0OA 3HPOA 4ECWA 4QZFA 2V4RA 1IM4A 4BGDA 2W9AA 5J2IA 5KT5A 4DL5A 3LWLA 8ICKA 3OJUA 8ICTA 4RQ0A 4DOAA 8ICCA 2HHPA 2AGOA 3Q8PB 4JK1A 9ICLA 4FH3A 4F91B 3GIKA 1ZQZA 5KFAA 1NOMA 4DFPA 1NJYA 1MSWD 3AQNA 5DEDA 4DL2A 4QZAA 4QZDA 3HT3A 1D9DA 4Q8FA 4X0AA 4XUSA 4F2SA 4DWIA 3GIMA 4P4OA 7ICIA 1DK2A 8ICZA 4UBBA 1RYRA 5DDYA 5L1JA 4DOCA 1N48A 1X9SA 2J6SA 9ICVA 4J9QA 5KTQA 1XSNA 3ZD9A 3ZDAA 1WCNA 1T3NA 1ZQBA 4UB4A 4XRHA 3G6VA 4RZRA 4F5QA 2M2UA 7ICPA 5J2GA 5CB1A 4EZ6A 4I2DA 4O3RA 3SV3A 1UT8A 4LVSA 4RWQA 8ICAA 4C8OA 4PPXA 1DGSA 4FBUA 3C21A 4MF2A 4KLGA 3MGHA 1R8CA 5TZVA 2PFPA 3MR2A 3RRHA 5J2BA 1SKSA 2J6TA 1NK0A 1NKCA 5IIKA 3PX6A 4YMNA 2RDIA 4M04A 2VA3A 4J9LA 4GC7A 1QTMA 2O5AA 5CR0A 2MUTA 4F2RA 2NRWA 3HJ1A 2AQ0A 3RTVA 1CUKA 3TFRA 2PI5A 2NRKA 3V7KA 5J0PA 4F5OA 4YXMA 5KT4A 9ICXA 2KZMA 3RJKA 1S0NA 4R65A 3JPOA 4X4QA 3OSNA 4DS4A 3RBDA 4M0AA 3C5GA 4FH5A 1NK6A 1RYSA 4NKTA 5KFJA 1T7PA 1QLNA 1NK4A 4BXOB 3WFSC 5F9LA 5KG4A 2PFQA 2P6RA 9ICIA 9ICOA 4WBZA 4WC3A 1ZETA 5KFCA 1S10A 4B9VA 2HHTA 1Q79A 5DBBA 2C28A 4UD4A 4C8MA 1QSLA 4YR2A 5KFTA 1UEUA 4UBCA 3THVA 1KEJA 1JX4A 4DQQA 1ZQFA 5KT7A 5J2FA 3MR5A 5DQIA 4ECZA 4S3NA 4R8UA 4FHYA 1PZNA 1ZQVA 4NM1A 1ZQCA 5HRIA 4WC4A 3EW9A 4TQRA 4DQRA 3KTQA 1DK3A 5KFSA 4ED6A 4I2EA 4DS5A 4ED8A 4NLNA 3K4GA 3QZ8A 1WCLA 4J9RA 2BHNA 3B0YA 4Q44A 2ZTEA 4JUZA 1V9PA 3LK9A 4I28A 4X5VA 2BDPA 4M9GA 1B22A 5KFPA 1JMSA 4ATBB 5J0TA 1LV5A 4O3SA 5J29A 4AT9A 4JWNA 4TUSA 1LB2B 1F5AA 4IRDA 2DR8A 4KLQA 4EP7A 2VA8A 4FBTA 1NZPA 2I1QA 1ZQNA 4NXZA 3H37A 9ICHA 4E0DA 1ZQQA 4RPXA 1KSPA 3PW2A 4KLLA 5KFXA 2KFNA 4EZ9A 4YMMA 3ISBA 5D46A 5J2AA 3TAPA 4KLIA 2FPLA 1EXNA 4X4VA 5DGAA 4WC0A 4FHWA 4DSIA 4UB3A 3E2EA 1ZQOA 2JEGA 4KTQA 1ZQSA 4M9NA 4WBYA 4J9SA 1KTQA 3EYZA 4TUQA 1ZQGA 3GQCA 4RQ6A 4FO6A 4JV0A 5HHIA 3TI0A 4R8UB 2F1HA 1BVSA 5J2JA 3M9OB 3BQ1A 4DSFA 5CJ7A 4ED0A 3RH4A 8ICRA 1SL1A 7ICVA 4UAWA 9ICKA 1UA0A 3TQ1A 5L9XA 4KN7A 3C5FA 1XSLA 2ID1A 9ICQA 4QWCA 4E8FA 3EPIA 5KFZA 3G6XA 4ECUA 4MEYA 4J9NA 1MIVA 4I2CA 5CHGA 5IIJA 4Z6EA 3V7LA 2AGPA 4WCWA 9ICCA 3EWAA 1U9LA 4DSEA 1UA1A 1B43A 2ZJ5A 2R8JA 2KTQA 4QW8A 4F4WA 4I2HA 4O0IA 3HW8A 4M9LA 1RXVA 1BPBA 4MF8A 8ICGA 2ZUDA 3OUYA 3BQTA 1H38A 5HC9A 1L3TA 1R89A 2HHWA 4M6WA 1FA0A 4DSLA 1RZTA 1ZYQA 2UVWA 5KFNA 3OV7A 5DG7A 4F92B 2R8GA 5KFGA 4DSKA 4UB1A 4TUPA 4M5DA 9ICPA 5L1KA 2W9CB 3FDSA 3ZDEA 3RB3A 9ICFA 4RQ3A 4ECVA 3RJGA 4EBDA 1BPDA 5EWEA 3OSPA 1L3VA 2BCRA 4O9MA 5HRKA 2ZH9A 1TK5A 2WTFA 4IQWA 8ICQA 1BNOA 3JPTA 4QWEA 2UVVA 7ICEA 1KFDA 4M6WB 3NTUA 5DG8A 3C2MA 1U48A 4BXOA 3TAQA 7ICOA 4Q8EA 1MC8A 3JPQA 4P4PA 3MFHA 3H39A 2ZH3A 3OJSA 1KFTA 3HJ4A 4DQIA 1COOA 2IHNA 5J0XA 1S0MA 1KNYA 5KFWA 2XGQA 8ICIA 5BPCA 7ICUA 5KFYA 1V4AA 2KZZA 1ZQDA 3UPSA 4P2HA 4DF8A 4X4PA 3Q8MA 1ZQTA 4ECSA 2DPIA 4GXJA 1NKEA 3JPNA 3KHLA 4YMOA 5JUMA 1NK8A 1ZJMA
chains in the Genus database with same CATH superfamily
1MQ3A 4HAIA 5HRBA 2XC9A 4K98A 3GIJA 5EE3A 2KG5A 4RPYA 2YMPA 2DVIA 2F1IA 4F50A 4B9SA 1ZQYA 3FC4A 1T8EA 3H3AA 2JZBA 1QQ5A 3HKZF 2PFOA 1XSPA 5ALSA 9ICEA 3PVXA 3M7DA 4I2IA 5DB7A 2QB0A 3EUB2 4IRKA 2O1PA 4OAGA 5ALRA 1SGGA 2ZJ8A 3MDAA 3UQ0A 3PV8A 1A77A 5ALPA 3V6HA 4YD1A 2KK0A 5CFSA 4K97A 3WFRE 2KVSA 4RUCA 1VFGA 5F3XB 5KFVA 2C2EA 2NRXA 1KFSA 1Q78A 1ZD5A 3H40A 2JHDA 1J2NA 3GU3A 3PNCA 1X6IA 2H3IA 3ICXA 1XO1A 5ALNA 1V38A 4AT7B 3V6JA 3BQ7A 2ODGA 3WFOA 2DWQA 4Y2TA 3WK7A 2Y1IA 4YR3A 2G0AA 4MFFA 5HR9A 9ICUA 3PSTA 3NGDA 5KG0A 4I2AA 1JI7A 1ZQJA 3H0LB 2ZIUB 5BOLA 8ICXA 1C7YA 2WAQF 5AKYA 3OWGA 3WFQE 4NLGA 3RJJA 1PVRA 8ICNA 1ECWA 2YQEA 4ED3A 2M2TA 4IQTA 1BGXT 4XJEA 3I28A 2L5YA 3SAFA 4I2GA 5ALEA 5KNIA 3WKCA 3BQ2A 4F4XA 5CP2A 2ZH8A 2K8AA 1K1QA 1ZRMA 1U4BA 2A1JB 2LMRA 1JIHA 4R63A 2DBYA 5ALZA 2GH1A 2Z7JA 3F2CA 1D9FA 2P6UA 2JEIA 5DDMA 3OHBA 4NKUA 3WKBA 1PUZA 4HYKA 2C2DA 1T4GA 4CE6A 3MR3A 1ZJNA 4AT9B 5HP4A 5J2KA 4BUGA 3LWMA 4EYIB 1JXEA 1ZQWA 2RFFA 1NK7A 2HHSA 2C22A 2HOQA 9ICJA 4NXVA 2W9MA 4DOBA 4IS7A 2WF6A 4EBEA 2F2AB 4O68A 2W55A 3AU6A 1ZD3A 3Q8SB 5IIMA 4QW9A 2HDOA 3PR4A 4TQSA 5J0UA 4KLOA 3HILA 2HCFA 3AMZA 5EWGA 3QX7A 1AROP 1U45A 4Y2PA 1MA7A 2XCPA 8ICBA 2K89A 4MHVA 4R66A 2XGPA 2JEJA 3JPPA 2M2VA 2BPCA 3ERCC 4K99A 3H4DA 4J9MA 7ICKA 1WUDA 2PXIA 1N56A 3QUCA 1JXLA 1X9MA 2UVRA 5ALOA 1ZQHA 4I2BA 3DDHA 2EWRA 5IILA 1XU4A 2ZH1A 3SEIA 4X0BA 2KHVA 4YCXA 4QZGA 3NVYA 1VJ5A 1S9FA 4NL9A 1SWWA 4NLZA 4JMUA 4X4UA 4QZ9A 2DKZA 1K5OA 3M8SA 4AT8B 2ZIUA 2AJQA 7ICSA 4DFMA 4ECYA 4O3NA 3NRZA 4YN4A 3IDWA 4DL7A 3RBEA 3U26A 4PGQA 1KRPA 2YN4A 4JV1A 3ZI4A 4K4IA 5HR7A 4IR1A 4RQ4A 3UPQA 3G6YA 4NXTA 2QLTA 2MU2A 1NK5A 4FFDA 5F9NA 5KFHA 3T5HA 3M8RA 1QCKA 3B0XA 5EE0A 4GLXA 3NYBA 4LT6A 3PO5A 2NRZA 2AHOB 5HMLA 2CRXA 3RH5A 2B21A 4ZH4A 1HUZA 1IG6A 4I29A 4C8LA 5TISU 5L1IA 2ATLA 7ICMA 2M2WA 2A1AA 3N28A 4EEYA 3WK9A 2K8CB 4EEKA 4AT7A 2ASLA 3QEAZ 1DGJA 4R64A 5KFLA 3PR5B 4F5RA 2E8OA 4DF4A 2EZXA 4Z6DA 2BCQA 1PVQA 5KG7A 2Q0ZX 1PK1A 5HRLA 3BS5A 5AKGA 4TURA 2DKXA 4LEVA 3F2BA 5JU5A 2HMXA 4DL5A 4NLCA 8ICKA 4JLZA 2JXJA 8ICTA 4K96A 1S5LU 8ICCA 2G5IB 3Q8PB 2LHTA 4Y2XA 1F0MA 2K4EA 1ZQZA 5KFAA 5DEDA 4X0AA 5CFTA 4DWIA 7ICIA 4C4SA 8ICZA 3MCRA 1N48A 1X9SA 4QIWC 4J9QA 1XSNA 3ZD9A 1T3NA 3TACB 4F5QA 3CNHA 4CF4A 4LVSA 4C8OA 1R8CA 2LM4A 2J6TA 1NK0A 4YMNA 2VA3A 2O5AA 4O6AA 1RYUA 2MUTA 3NS1A 4F2RA 3HJ1A 2NV3A 4HX0A 3TFRA 3V7KA 2XI9A 4LEZA 2KZMA 3RBDA 3C5GA 1NK6A 1LVHA 1T7PA 4KMOB 1NK4A 5F9LA 9ICIA 9ICOA 4WBZA 4WC3A 1ZETA 2HBLA 1S10A 5ALLA 5AHXA 5AI5A 4YR2A 4UBCA 2HOFA 1ZQFA 3LVWA 5DQIA 5JTIA 1PZNA 1FEZA 4TQRA 3K4GA 3QZ8A 1WCLA 4Q44A 2KJ9A 1V9PA 4AYBF 4LJXA 2BDPA 1JALA 3R9KA 5J29A 1L8LA 1LB2B 2VA8A 4FBTA 4NXZA 9ICHA 4I0UA 4OJ6A 1M6YA 5KFXA 2KFNA 4KLIA 4X4VA 4WC0A 2NYVA 2P35A 4FHWA 3E2EA 4KTQA 1X66A 4WBYA 1ZQSA 3D6JA 1KTQA 4RQ6A 2WF5A 4JV0A 4R8UB 1BVSA 4UASA 3M9OB 4DSFA 4ED0A 3RH4A 8ICRA 9ICKA 5L9XA 4E8FA 3EPIA 1IV8A 4I2CA 4WCWA 5IIJA 3V7LA 2AGPA 3NWIA 9ICCA 1U9LA 4PJ0U 1B43A 2ZJ5A 2R8JA 4I2HA 4O0IA 4MF8A 3OUYA 1YZ6A 3IN5A 4M6WA 1FA0A 4DSLA 4IL6U 2ZIVA 2FI1A 4F92B 5KFGA 4NJ8A 3HRDD 3FDSA 3ZDEA 4WJ3B 1C20A 4EBDA 5ALFA 1F5SA 1TK5A 2VJ4A 2WTFA 1A6SA 2ZIVB 2MSNA 4M6WB 3NTUA 4EENA 5DG8A 3JPQA 4G9BA 1S8OA 3IG8A 4DQIA 1S0MA 1T3QA 3UPSA 5BPCA 1L8OA 2JRZA 2YMQA 5KFYA 1ZQDA 3KZXA 4P2HA 4X4PA 4GXJA 1TE2A 5ALUA 5KL8B 4EX6A 3TARA 4PHAA 1S77D 3N4MB 2KKVA 4WC1A 4US9A 2IHOA 2FE9A 4GC6A 2NO4A 1Z00B 4UB8U 5KG3A 1L5UA 3ISCA 3C1YA 4QWAA 5J2HA 2ZUBA 1ZQPA 5CWRA 1KL9A 4LEWA 5J2CA 4ED7A 5EE9A 5J0QA 1CEZA 5KFFA 3LDAA 4DL3A 1WOTA 2BPFA 3NVZA 1V97A 4KX3A 1XC9A 1QH9A 2BQUA 4P0QA 4RQNA 8ICVA 1SV0C 3WK6A 2ALZA 3L4PA 3AU2A 3PO4A 1BPEA 3C1ZA 3WKDA 5J0SA 2KICA 8ICMA 9ICNA 4M2YA 2VA2A 2FJ6A 3WK8A 4LZDA 3BDPA 4C4RA 2OYYA 1XWLA 2IOHA 3RB0A 1GO3F 3TFSA 1SXEA 3QUBA 3MGIA 2BCVA 4PH5A 2G5HB 4QZ8A 1OU5A 2V9WA 2JR5A 1ZOLA 3KBBA 5HR6A 3PZPA 4F3OA 4QZBA 3H8SA 8ICFA 4RWPA 9ICWA 4OCZA 4G3IA 3MBYA 2YTUA 2RRDA 3ZDBA 2KZ3A 4EEBA 3BJYA 2DL0A 4QZIA 5AK6A 1ZQLA 1X6JA 3QUQA 2Q66A 5CFUA 1KKXA 3DEEA 3NKUA 1TFWA 3EZ5A 2HBJA 1RQNA 2R8KA 1HEKA 8ICSA 2G09A 3K75D 3BS5B 4YG2A 3AQFA 3TADC 1BNPA 3ORYA 1WG8A 1IXRA 5L1LA 2WAQC 5J8YA 2W54A 1UETA 5EOZA 3PW4A 2YMMA 4F71A 3LQCB 1VLBA 2J6UA 4EBCA 4O3MA 3BQ0A 2ZIXA 3H7IA 4DQSA 1KLNA 4F93B 4UB2A 3F5AA 4QZEA 4X4TA 2E5SA 1ZQMA 4K4HA 7ICJA 2VJ5A 2GWSA 3T3FA 3DV9A 4EEDA 3UQ2A 3L3FX 5ALHA 5AK5A 3PMLA 3T5KA 3H38A 2W04A 4RPZA 4YXJA 1ZQAA 3KFUF 4OJ5A 3SZ2A 3OHAA 5IIOA 4NLKA 5CEHA 3AUOA 4WC6A 5HREA 3SYZA 3J81j 1ZQRA 4PHEA 4YP3A 3N97B 4X4SA 2ZH7A 5E79U 2ES6A 4KLUA 5DB6A 5HRDA 4GFJA 4RNMA 2FDRA 2R8IA 2BR0A 3RR7A 2RQ5A 4UD5A 2VIXA 2ZH5A 8ICWA 3C18A 4EBKA 7ICTA 3ETRA 4XQ7A 2DR7A 3IHQB 4PHPA 3Q8LA 4YVZA 4B9UA 2IHMA 1CRXA 3KKAC 3QEBZ 4ED1A 2F1JA 2IOFK 2EQYA 2D3DA 5A0LA 3PW7A 4WC2A 2LM1A 3HJEA 8ICUA 4AT8A 2HHXA 2DUYA 4LZGA 5D62A 5ALTA 1V85A 2LI6A 5DBAA 1YLQA 1FFVA 2Y1JA 1NJWA 5J0OA 2W9BB 2W7PA 4DSJA 4NXUA 2OM6A 5KFDA 4B6JA 2DR9A 5EWFA 2R18A 2OH2A 4FHPA 1HJPA 3OVSA 2W11A 5J2EA 7ICQA 3M9MB 4ICAA 4FZLA 5KG5A 2XY6A 1PK3A 4C8KA 2A3VA 3WKEA 4O69A 2GO7A 3PX0A 2I9GA 2Y9TA 9ICBA 4QZCA 4B9MA 5B66U 2GA9D 4M9HA 4BWMA 5AICA 2NRTA 7ICRA 2LBOA 4IR9A 3OTQA 4KLFA 2BGWA 1P7DA 5DB9A 2FMQA 4DFDA 2BQ3A 2PBEA 1SZPA 3AQLA 1MQ2A 2FLNA 4GXKA 5KG2A 5B5EU 5KT3A 1XS9D 1TVAA 2ZHBA 1S0OA 1JROA 2IUBA 4ECWA 3KD3A 4BGDA 5KT5A 3OJUA 2KE7A 4K8VA 2AGOA 4JK1A 4FH3A 2H3ZA 1NJYA 1ED1A 4QZAA 3HT3A 1D9DA 3AQEA 2CN1A 2Q4TA 4UBBA 4Y2UA 5L1JA 2J6SA 1ZD2P 5KTQA 2KSOB 4UB4A 4XRHA 3G6VA 1N5XA 5CB1A 4I2DA 4PPXA 2MRLA 3KKAA 5J2BA 3AN1A 3OPXA 4KM5A 2HBMA 4GC7A 1QTMA 5CR0A 2NRWA 2AQ0A 4QIWF 1CUKA 1HIWA 2PI5A 5KT4A 3QU5A 4R65A 3JPOA 2HBKA 2WF8A 1QLNA 4BXOB 5KG4A 2PFQA 5D61A 3E0FA 1QSLA 5AKLA 5KT7A 3MR5A 3SQIA 4S3NA 2YX8A 2A19A 4ED6A 2KJ5A 2EZYA 2ZTEA 1B22A 2B56A 2ZIXB 5KFPA 3BZKA 1LV5A 4PL1A 4JWNA 1F5AA 1SWVA 1ZQNA 4FO1A 1KSPA 3TAPA 1EXNA 5AKJA 5DGAA 5JTGA 2KV2A 4J9SA 3EYZA 1ZQGA 3GQCA 4FO6A 2F1HA 2ZHAA 7ICVA 3ALRA 3TQ1A 2ZG6A 2ID1A 5KFZA 5CHGA 4Z6EA 3QUTA 3EWAA 4DSEA 1UA1A 2KJ8A 3S6JA 4QW8A 4F4WA 1DXSA 1RXVA 2F3NA 8ICGA 3BQTA 2WB1C 3SAHA 2HHWA 1ZYQA 2E1EA 5KFNA 4CGZA 1Q8KA 3WK4A 4O67A 2CPRA 9ICFA 1OXJA 3IP4B 3RJGA 4O9MA 4QWEA 2UVVA 3KZIU 7ICEA 3C2MA 7ICOA 2E8PA 4P4PA 3H39A 3D2QA 2IHNA 1XO0A 4C7YA 5KFWA 5AIBA 4DF8A 3Q8MA 1B0XA 2DPIA 3JCFA 3BZCA 5G5HA 2KIVA 4YMOA 2JGAA 5K4LA 1MN8A 1ZJMA 2H5XA 2H3VA 2WB1F 2AXTU 3BS7A 4EX7A 5KT2A 2HHUA 1J2MA 1O08A 1A76A 4RQ7A 2A1JA 2CXYA 5D4BA 1YZ7A 4RT3A 1KQQA 3V72A 2NRVA 1WWUA 2F8KA 4RNNA 4MKPA 1NKBA 5AKXA 3QU7A 1Z00A 1S0VA 5AI4A 3F53A 4MFAA 3QE9Y 4KITB 2M9NA 3HWTA 1OW5A 4U7CA 2LKYA 3GIIA 4RU9A 1ZQUA 4O5EA 3UMGA 3SENA 5DBCA 4F4KA 2VANA 4RQMA 1UHUA 5AK4A 3I76A 2DRAA 4F8RA 2B51A 1ZQXA 2RLTA 1Z19A 3PW5A 2EAPA 3AEVA 1L6NA 1FO4A 1NO5A 2XO7A 1NJZA 3M6ZA 4Y2VA 1TAUA 4C8NA 2HHVA 3VC8A 4XQ8A 4NWIA 3AM9A 3CP8A 2BQRA 1CI4A 2BCSA 2O6KA 5HMMA 5C5JA 4P0PB 7ICHA 2DPJA 4FE3A 2BE3A 2W3SA 2KFZA 8ICHA 4I27A 4K4GA 2LPEA 2QB0B 4ELUA 3TANA 1L7NA 3OUYB 1X2IA 7ICNA 1IIPA 3HIYA 3SV4A 2FPMA 1NNLA 3RFAA 2BCUA 2MAXA 2ISOA 1PX5A 2RDJA 1RQLA 5DB8A 3GZFA 1MIWA 4O3PA 3PX4A 3RJIA 2KP7A 5AM2A 4MEXA 1D8LA 5DQHA 1J97A 2W8KA 4DEZA 3MABA 3H4BA 5KAFU 1NZBA 3C28A 5KFKA 1ZQEA 2EAOA 4WC7A 4M47A 2KMDA 9ICRA 3H0MB 1D8YA 5HRFA 5JRTA 5KG6A 2LYBA 3C2KA 5DG9A 4Y2QA 1LKYB 2MA1A 4IQVA 1MIYA 2E8MA 2FMPA 4OO1J 1U47A 5KFEA 3QZ7A 5T14A 5HRGA 3Q8KA 4EYHB 2M0NA 4M9JA 2OWOA 5DQGA 5C0YA 2HSZA 3QNMA 4E80A 3JYYA 3Q8RB 2V4QA 2IA6A 2MUTB 3QXGA 3JPSA 4DL4A 4K9BA 4KLHA 4LEYA 2HI0A 4UAUA 3KHGA 3HKZC 3FAHA 2Y0SF 4WQKA 3ISDA 4RT2A 1BPZA 4GIBA 4DO9A 3L9DA 4RWOA 4F4ZA 5ALQA 1SKWA 5KFMA 4ACOA 1BPYA 5CA7A 3Q8QB 9ICTA 2EANA 1JAJA 3UXOA 4X4NA 2FPKA 4Q45A 1N2XA 4ATBA 1ZQ1C 3ZD8A 1FFUA 4YFKA 1QSSA 2YY6A 4OAIZ 3N7SC 4I2JA 2DF4B 3H0RB 4ECTA 2G08A 4NXXA 3CYMA 2OXOA 4NXWA 4EV6A 4Z6FA 2ZJAA 2FLPA 1DRGA 3MGVA 5AKIA 3WK5A 2Y0SC 1Z3EB 5ALVA 1SB3C 3SD7A 2FCLA 2KD1A 2HVIA 4Z6CA 4ED2A 1TKDA 1JQRA 4KLTA 4CCHA 3F2DA 1RXWA 2LYHA 3MDCA 3RR8A 5CRXA 5J0WA 3LYSA 4E7XA 1N61A 2K4HA 2KIWA 3H8MA 4NV0A 3M9NB 4KMUA 1X9WA 1NJXA 4FHXA 2B0CA 3CW2C 1UT5A 3PSFA 4F4YA 2DFLA 1TV9A 8ICPA 4MFCA 5KG1A 3QYPA 2DR5A 2YMLA 1TFYA 4OAHA 5AI9A 4B9NA 2DQNB 3ZDDA 5KFOA 1JUDA 3UXPA 1KBUA 5DKWA 2OCEA 3WFPA 4F5NA 4WC5A 4BDPA 5F2VO 5ALXA 5AI8A 5IIIA 2W8LA 2C2RA 1UCVA 4DQPA 3C2LA 1L3SA 8ICOA 4B9TA 4ECQA 4UB6U 3QU9A 4J9PA 3IV6A 1D8BA 4QZFA 2V4RA 1N60A 5J2IA 2HHPA 4RQ0A 4DOAA 2D8CA 4EELA 9ICLA 4F91B 3PSPA 4Q8FA 4XUSA 3GIMA 4P4OA 1DK2A 4UW9A 1ZQBA 1WYGA 1KW4A 5J2GA 4O3RA 3SV3A 1UT8A 3WKAA 8ICAA 1DGSA 4FBUA 3C21A 5TZVA 2PFPA 3MR2A 3RRHA 1SKSA 1NKCA 2KNJA 2RDIA 4J9LA 3B9JA 4OD0A 5ALGA 2WHEA 2VKQA 3RTVA 4Y2YA 5J0PA 4F5OA 4YXMA 1L7OA 3A0HU 4DS4A 4M0AA 4NKTA 2P6RA 1JRPA 5AKZA 3K1RB 5KFCA 4B9VA 2HHTA 4C8MA 1UEUA 3THVA 1KEJA 4DQQA 5J2FA 4J03A 4FHYA 2E3TA 1ZQCA 5HRIA 1PK1B 1SZHA 3KTQA 4I2EA 4DS5A 4ED8A 4NLNA 4J9RA 2ZIWB 2BHNA 1N5WA 3B0YA 3RF9A 4I28A 4X5VA 1JMSA 2YB1A 4AT9A 2DR8A 4KLQA 4EP7A 1NZPA 2DGZA 1QQ6A 3H37A 4Y2JA 2F77X 4KLLA 3PW2A 4EZ9A 5J2AA 2FPLA 2D6FC 4DSIA 4UB3A 4M9NA 1SIJA 1TAMA 2XVTA 1ZQOA 4ELTA 8ICJA 4U6PA 1UA0A 1Z1BA 1XSLA 9ICQA 3G6XA 1AQ6A 4KB6A 2RHFA 3LVVA 1RG6A 1T94A 2HN1A 1ZRNA 1BPBA 3KOOA 1L3TA 5ALKA 1R89A 1O03A 1RZTA 2R8GA 4DSKA 4UB1A 4TUPA 5L1KA 2W9CB 2AH5A 4UATA 4ECVA 5EWEA 1F44A 2BCRA 5B3QA 1KFDA 1U48A 4BXOA 4Q8EA 1MC8A 1L7MA 3MFHA 3OJSA 1KFTA 3HJ4A 1KNYA 2XGQA 7ICUA 2KZZA 4ECSA 3I1YA 1NKEA 1X9XA 5JUMA 1NK8A 4C7ZA 2XCAA 3H8WA 4DFJA 5H2FU 2W9CA 2H3QA 4YR0A 3JZ0A 1TK0A 2KSOA 4X4RA 1N63A 5KL1B 2F44A 5BOMA 4ECXA 5AI0A 4GXIA 2AQ4A 5KFRA 4IRCA 4EBJA 3AL0B 1R8AA 3RAXA 5KFBA 3CK6A 1GPJA 1S97A 3SMVA 4Q43A 3MR6A 4O5CA 2E8NA 2WF9A 2ZTCA 4NY8A 3RRGA 4A8EA 3EF2A 5KFUA 4ZOHC 3ER8C 2JH1A 4CRXA 2HVHA 1KDHA 4RQ5A 4J9KA 1NK9A 5AM0A 3AQKA 7ICLA 4UB5A 3NVVA 3ED5A 2AU0A 3CRXA 2XIDA 2BBHA 2IOFA 3WU2U 4C4TA 4CDGA 3SI8A 2BKEA 4QNLA 3H8JA 4YQWA 3UMBA 2W9BA 2KVCA 5HNKA 3RJEA 4OJOA 5DLFA 9ICGA 5KAIU 2PFNA 2ZIWA 2WF7A 5B3PA 5ALIA 1Q3UA 5FP0A 5KFIA 4DLGA 4O3QA 3PMNA 4I2FA 4O5KA 4ECRA 2F8LA 5DLGA 3K7DA 4RUAA 2KOBA 1R8BA 2ZH4A 3KHRA 2JH7A 3QU2A 2W3RA 2UVUA 1A0PA 2H3FA 2FMSA 3L5KA 3OGUA 1URJA 3K1ZA 4FS2A 3GV5B 2P66A 3NUQA 3RB4A 4F5PA 2BPGA 3IM1A 1XNSA 3PW0A 3OVBA 4J9OA 4UAZA 1SL2A 4DFKA 4DCCA 1Z4OA 4KLEA 4FHVA 3D2SA 2W43A 3GV8B 3RAQA 4PGYA 7ICGA 4RQ8A 3GDXA 4X4OA 3T5JA 4JV2A 4CNQA 1X42A 4BX9C 2IMWP 1HUOA 1Q3VA 1RM6C 8ICYA 2NO5A 3O0FA 4US8A 1DOQA 5HRHA 3V7JA 5J8YC 5ALMA 4KLDA 2KHQA 3ETLA 5GTIU 3GV7B 2ESEA 4ELVA 4BWJA 1U49A 2B6GA 4FZNA 2XY7A 1TFRA 4KLMA 1QSYA 2ZXIA 4PL2A 4PZOA 3N7PD 1SKRA 4FZMA 1RDFA 2OEHA 4QWBA 4QZHA 5AM5A 2ASJA 2EH9A 1TAQA 2YB4A 3AQMA 5D49A 3E58A 2BZFA 4NL9C 9ICAA 3C66A 4WH5A 4EGWA 2EAMA 2GAFD 3JPRA 8ICLA 1Z1VA 5HHHA 1TK8A 1VJ7A 1Y88A 4UARA 4KN4A 2ZUCA 2JZBB 2IBKA 4UAYA 1S76D 2N1RA 2PI4A 4PHDA 5AM3A 3RB6A 9ICSA 3M6KA 2QB1A 7ICFA 5DECA 2RP5A 4RQ1A 3EPGA 3RH6A 2ZH2A 4QJFB 4B9LA 4DLEA 3UXNA 8ICEA 1BPXA 2DRBA 1N62A 3NVWA 5KT6A 3RJFA 2HOIA 4XA5A 5J0YA 5J2DA 1B4FA 3GILA 1COKA 2KN7A 3HP6A 2ZH6A 5IINA 3RJHA 5D63A 3T5LA 2ZTDA 1L3UA 2K4IA 3ZDCA 3PY8A 5ALYA 3OVAA 3HX0A 2XY5A 2HW3A 4YD2A 2ZXHA 5J0RA 2K4PA 1YT3A 4KLJA 1Z4NA 4IG8A 5L1MA 5ALDA 2HHQA 2FLLA 2E1FA 2AGQA 1SL0A 1ZQKA 2QARB 3GFKB 2JEFA 2PMZC 3V6KA 4OAFA 2ISPA 4FS1A 2R8HA 3A0BU 4IQUA 5KFQA 3FYHA 2EZZA 3KHHA 4F72A 2I6XA 4P4MA 2F76X 4RQ2A 4NM2A 4RNOA 4PGXA 3MFIA 4C0ZA 2ASDA 1UEVA 2KEYA 1LKYA 4C80A 4DL6A 2QKQA 5AKHA 4JWMA 5AKKA 1JN3A 4NLBA 4O3OA 3T79A 2JV3A 5DGBA 3UM9A 4OJLA 4QWDA 1K1SA 4KLSA 2PKEA 4WOYA 1ZQIA 3C23A 4K9AA 4USAA 1RPLA 9ICMA 2KKPA 3NVOA 4UQGA 3IG5A 4P0QB 5AKEA 3MC1A 3HPOA 2W9AA 1IM4A 3ONNA 3LWLA 1UQVA 1NI3A 3GIKA 2BDUA 3AQNA 1NOMA 4DFPA 1MSWD 4DL2A 4QZDA 4F2SA 2I5HA 1RYRA 2G07A 4JLXA 5DDYA 4OJPA 4DOCA 5AM4A 9ICVA 3N7RC 3ZDAA 1WCNA 2LYAA 1SXDA 3M1YA 2M2UA 4RZRA 2B4VA 7ICPA 1SV4A 4EZ6A 4UAVA 5ALWA 4RWQA 4MF2A 4KLGA 3MGHA 2OHFA 4AP9A 1SV0A 5IIKA 3PX6A 4M04A 2G06A 3FM9A 3PSIA 2NRKA 1OUQA 9ICXA 3RJKA 1S0NA 4X4QA 3OSNA 2W7OA 4FH5A 1RYSA 3WFSC 5KFJA 2WFAA 3D2NA 5G5GA 4JB3A 1Q79A 5DBBA 5KFTA 4P0PA 4BJQA 1JX4A 4Y2RA 4ECZA 1ZXIA 1FIQA 4R8UA 1ZQVA 4NM1A 4WC4A 1DK3A 3EW9A 4DQRA 5KFSA 4IC9A 4PZNA 4CF3A 1UPHA 2BBJA 4JUZA 2GLEA 3LK9A 4M9GA 3QU4A 4ATBB 5J0TA 4O3SA 5AIAA 3TKAA 4TUSA 4IRDA 1QQ7A 3VCBA 2Y9UA 2I1QA 4E0DA 1ZQQA 4RPXA 4YMMA 5GTHU 5D46A 3ISBA 1PVPA 2PMZF 2XICA 3ER9B 2JEGA 4TUQA 2HN2A 5HHIA 3TI0A 2C28A 4UD4A 5J2JA 3BQ1A 4RWNA 2K60A 5CJ7A 1SL1A 3IRUA 4UAWA 4KN7A 5ALJA 3C5FA 2K8BB 1KN5A 1L7PA 4QWCA 4ECUA 4MEYA 3TADA 4J9NA 1MIVA 2KTQA 3HW8A 4M9LA 3SAGA 2ZUDA 1H38A 5HC9A 2QARA 1WWVA 5CHEA 4AYBC 2UVWA 2JMGA 3UMCA 5DG7A 4N7RA 3OV7A 4M5DA 9ICPA 1VDVA 3NRWA 3NASA 3RB3A 4RQ3A 4WQLA 1BPDA 1L3VA 5EE1A 3OSPA 2EDUA 5HRKA 2ZH9A 4Y2SA 4IQWA 8ICQA 1BNOA 3JPTA 4KX5A 3F5EA 3TAQA 3PHZA 1X40A 2ZH3A 5AI6A 1COOA 2GOLA 5J0XA 5AM1A 1V4AA 8ICIA 3C29A 1Q46A 4CF5A 2W03A 5AK3A 3SR6A 1ZQTA 1ZD4A 3JPNA 3KHLA
chains in the Genus database with same CATH topology
1MQ3A 5HRBA 2H5XA 2XC9A 2XCAA 3H8WA 4PHAA 4DFJA 3TARA 3N4MB 3GIJA 1S77D 2W9CA 4YR0A 5KT2A 4WC1A 2HHUA 4GC6A 3JZ0A 1A76A 4RQ7A 1TK0A 1Z00B 4RPYA 4X4RA 2A1JA 2DVIA 2F1IA 5KG3A 4F50A 5BOMA 5D4BA 4ECXA 4GXIA 1L5UA 2AQ4A 5KFRA 1ZQYA 4RT3A 4B9SA 4IRCA 4EBJA 1R8AA 3RAXA 3ISCA 3C1YA 5KFBA 4QWAA 3V72A 1T8EA 5J2HA 2JZBA 2NRVA 2ZUBA 3H3AA 1ZQPA 5CWRA 1S97A 2PFOA 1XSPA 5J2CA 4Q43A 4RNNA 3MR6A 4ED7A 1NKBA 5J0QA 4O5CA 1CEZA 9ICEA 3PVXA 5KFFA 3LDAA 4DL3A 1WOTA 4NY8A 2ZTCA 1Z00A 4I2IA 2BPFA 1S0VA 3RRGA 5DB7A 5KFUA 4IRKA 1XC9A 2O1PA 4MFAA 2ZJ8A 2BQUA 3QE9Y 8ICVA 4KITB 3MDAA 3UQ0A 3PV8A 2HVHA 1A77A 2M9NA 3HWTA 2ALZA 1KDHA 2ZHAA 3AU2A 3V6HA 4YD1A 4RQ5A 4J9KA 3PO4A 3GIIA 1NK9A 4RU9A 3AQKA 7ICLA 3WFRE 1BPEA 1ZQUA 3C1ZA 4RUCA 1VFGA 4UB5A 2C2EA 5KFVA 1KFSA 2NRXA 4O5EA 5DBCA 1Q78A 5J0SA 3H40A 2AU0A 4F4KA 8ICMA 2VANA 9ICNA 4M2YA 3PNCA 2VA2A 3BDPA 4LZDA 2BKEA 3SI8A 3H8JA 4YQWA 2DRAA 2W9BA 5HNKA 4F8RA 1ZQXA 1XO1A 1XWLA 3RJEA 9ICGA 5DLFA 4AT7B 3V6JA 3RB0A 2PFNA 3TFSA 3PW5A 3WFOA 3MGIA 2BCVA 4PH5A 4QZ8A 2Y1IA 1NO5A 4YR3A 2XO7A 4MFFA 5HR9A 1NJZA 1OU5A 2V9WA 1TAUA 4C8NA 9ICUA 5KFIA 3NGDA 4DLGA 5KG0A 4I2AA 4XQ8A 2HHVA 4O3QA 3PMNA 2BQRA 4F3OA 4I2FA 4ECRA 2BCSA 4O5KA 5HMMA 5C5JA 4QZBA 1ZQJA 7ICHA 5DLGA 2DPJA 3H8SA 5BOLA 1C7YA 8ICFA 8ICXA 4RUAA 4RWPA 1R8BA 2BE3A 9ICWA 2ZH4A 3WFQE 2KFZA 4G3IA 4NLGA 3MBYA 3RJJA 4I27A 3KHRA 4K4GA 8ICHA 4ELUA 8ICNA 3TANA 3ZDBA 3OUYB 1X2IA 2KZ3A 4ED3A 2UVUA 7ICNA 2M2TA 3BJYA 3HIYA 4IQTA 4QZIA 2FMSA 1BGXT 3OGUA 2FPMA 3SV4A 1ZQLA 4FS2A 3GV5B 2BCUA 2P66A 3RB4A 3BQ2A 4I2GA 2MAXA 4F5PA 4F4XA 3IM1A 2RDJA 2BPGA 2ISOA 1PX5A 2Q66A 3PW0A 3OVBA 5CP2A 4J9OA 5DB8A 4UAZA 1SL2A 8ICJA 2ZH8A 4DFKA 1TFWA 3EZ5A 4KLEA 4FHVA 1K1QA 1U4BA 1MIWA 2A1JB 4O3PA 3PX4A 1JIHA 3RJIA 2R8KA 4R63A 8ICSA 4MEXA 2KP7A 3K75D 3GV8B 4YG2A 4PGYA 3RAQA 7ICGA 1D8LA 5DQHA 4RQ8A 3GDXA 1D9FA 1BNPA 4X4OA 3ORYA 2P6UA 3T5JA 2JEIA 5DDMA 3OHBA 2W8KA 4DEZA 1IXRA 4JV2A 5L1LA 4NKUA 3MABA 2IMWP 4HYKA 3H4BA 2C2DA 1HUOA 1T4GA 8ICYA 5KFKA 3MR3A 1ZQEA 1UETA 5EOZA 1ZJNA 1DOQA 4WC7A 4M47A 3PW4A 5HRHA 4AT9B 3V7JA 5HP4A 5J2KA 3LQCB 4KLDA 3LWMA 4RWNA 9ICRA 3ETLA 4EYIB 3GV7B 1JXEA 4EBCA 3BQ0A 1D8YA 2J6UA 4ELVA 3H7IA 4DQSA 4BWJA 1ZQWA 1U49A 5HRFA 2RFFA 1KLNA 5KG6A 4F93B 4UB2A 1NK7A 2HHSA 2C22A 2XY7A 4QZEA 9ICJA 4X4TA 1TFRA 2W9MA 4DOBA 4KLMA 1QSYA 4EBEA 3C2KA 1ZQMA 4K4HA 7ICJA 5DG9A 3AU6A 4IQVA 1SKRA 2GWSA 3T3FA 3Q8SB 1MIYA 5IIMA 2FMPA 3UQ2A 4QW9A 4QWBA 4QZHA 1U47A 3PR4A 5KFEA 2ASJA 3PMLA 3QZ7A 1TAQA 4TQSA 3AQMA 5D49A 9ICAA 5HRGA 5J0UA 3T5KA 3Q8KA 4KLOA 3H38A 4EYHB 3C66A 4M9JA 2OWOA 4RPZA 4YXJA 5DQGA 5EWGA 1ZQAA 3JPRA 8ICLA 1AROP 5HHHA 3SZ2A 1U45A 3OHAA 1TK8A 1VJ7A 1Y88A 5IIOA 4E80A 3JYYA 4NLKA 4KN4A 3Q8RB 2XCPA 2V4QA 8ICBA 4R66A 2MUTB 3JPSA 3AUOA 2XGPA 4DL4A 2IA6A 2ZUCA 2JZBB 4KLHA 2IBKA 4UAYA 2JEJA 4WC6A 3JPPA 2M2VA 2BPCA 1S76D 3KHGA 5HREA 2PI4A 4PHDA 3H4DA 4J9MA 3SYZA 1ZQRA 4PHEA 4YP3A 3N97B 3RB6A 4X4SA 7ICKA 2ZH7A 3ISDA 2PXIA 9ICSA 5DECA 1N56A 7ICFA 4RT2A 5HRDA 4KLUA 5DB6A 4RQ1A 1BPZA 3EPGA 3RH6A 2ZH2A 4RNMA 1JXLA 4DO9A 1X9MA 3L9DA 2R8IA 4RWOA 2BR0A 4F4ZA 4DLEA 2UVRA 3RR7A 1ZQHA 1SKWA 3UXNA 5KFMA 4B9LA 4UD5A 1BPYA 1BPXA 8ICEA 5CA7A 4I2BA 2ZH5A 2DRBA 8ICWA 3C18A 5IILA 4EBKA 3Q8QB 7ICTA 9ICTA 5KT6A 3RJFA 1XU4A 4XQ7A 2ZH1A 4X0BA 2DR7A 4YCXA 4XA5A 3IHQB 4PHPA 3Q8LA 4YVZA 3UXOA 4QZGA 5J0YA 4B9UA 1JAJA 5J2DA 3GILA 4X4NA 2KN7A 3HP6A 2IHMA 2ZH6A 2FPKA 5IINA 4Q45A 3QEBZ 3RJHA 4ATBA 4ED1A 1S9FA 1QSSA 2F1JA 2ZTDA 3ZD8A 4YFKA 3T5LA 1L3UA 3ZDCA 4NLZA 4X4UA 3PY8A 4I2JA 3OVAA 4QZ9A 3HX0A 3PW7A 3M8SA 2XY5A 2HW3A 4WC2A 4ECTA 4AT8B 4YD2A 2AJQA 5J0RA 7ICSA 4DFMA 8ICUA 4ECYA 4O3NA 4YN4A 4DL7A 4Z6FA 2HHXA 4AT8A 4KLJA 2ZJAA 2FLPA 4LZGA 1Z3EB 3RBEA 4IG8A 4PGQA 1KRPA 2HVIA 4JV1A 2HHQA 2FLLA 4Z6CA 4ED2A 2AGQA 1TKDA 4K4IA 1JQRA 4KLTA 5DBAA 1SL0A 1YLQA 1ZQKA 4IR1A 2Y1JA 4CCHA 4RQ4A 1NJWA 1RXWA 3GFKB 2JEFA 5J0OA 2LYHA 2W9BB 3UPQA 3V6KA 2ISPA 4FS1A 3MDCA 2R8HA 3RR8A 3G6YA 4DSJA 5J0WA 1NK5A 4IQUA 5KFQA 3FYHA 4E7XA 5F9NA 5KFHA 5KFDA 3KHHA 3T5HA 2DR9A 4P4MA 5EWFA 3M9NB 3M8RA 4KMUA 1X9WA 4FHPA 3B0XA 4RQ2A 4NM2A 4RNOA 4PGXA 4GLXA 3NYBA 3MFIA 1NJXA 4FHXA 1HJPA 3PO5A 4LT6A 1UEVA 2ASDA 5J2EA 3OVSA 7ICQA 1UT5A 2NRZA 3M9MB 5HMLA 4F4YA 2DFLA 3RH5A 1TV9A 2B21A 8ICPA 4ZH4A 1HUZA 5KG5A 4I29A 4MFCA 4DL6A 5L1IA 2XY6A 2ATLA 4C8LA 4C8KA 5KG1A 7ICMA 2M2WA 4EEYA 2DR5A 1TFYA 4JWMA 4B9NA 3ZDDA 1JN3A 4AT7A 5KFOA 3PX0A 3UXPA 2I9GA 5DKWA 4O3OA 2ASLA 9ICBA 4QZCA 3QEAZ 4B9MA 5DGBA 3WFPA 4F5NA 4WC5A 4R64A 4M9HA 4BWMA 5KFLA 2NRTA 3PR5B 4BDPA 7ICRA 5F2VO 4F5RA 4IR9A 4ELTA 4DF4A 4KLFA 4QWDA 1K1SA 2BGWA 4KLSA 5IIIA 5DB9A 2W8LA 4Z6DA 2C2RA 2BCQA 2FMQA 5KG7A 1ZQIA 3C23A 2BQ3A 4DQPA 2Q0ZX 2PBEA 1RPLA 9ICMA 1SZPA 3AQLA 5HRLA 3C2LA 1MQ2A 2FLNA 4GXKA 1L3SA 5KG2A 4UQGA 8ICOA 4TURA 5KT3A 1XS9D 1TVAA 4ECQA 4B9TA 2ZHBA 4J9PA 1S0OA 3HPOA 4ECWA 4QZFA 2V4RA 1IM4A 4BGDA 2W9AA 5J2IA 5KT5A 4DL5A 3LWLA 8ICKA 3OJUA 8ICTA 4RQ0A 4DOAA 8ICCA 2HHPA 2AGOA 3Q8PB 4JK1A 9ICLA 4FH3A 4F91B 3GIKA 1ZQZA 5KFAA 1NOMA 4DFPA 1NJYA 1MSWD 3AQNA 5DEDA 4DL2A 4QZAA 4QZDA 3HT3A 1D9DA 4Q8FA 4X0AA 4XUSA 4F2SA 4DWIA 3GIMA 4P4OA 7ICIA 1DK2A 8ICZA 4UBBA 1RYRA 5DDYA 5L1JA 4DOCA 1N48A 1X9SA 2J6SA 9ICVA 4J9QA 5KTQA 1XSNA 3ZD9A 3ZDAA 1WCNA 1T3NA 1ZQBA 4UB4A 4XRHA 3G6VA 4RZRA 4F5QA 2M2UA 7ICPA 5J2GA 5CB1A 4EZ6A 4I2DA 4O3RA 3SV3A 1UT8A 4LVSA 4RWQA 8ICAA 4C8OA 4PPXA 1DGSA 4FBUA 3C21A 4MF2A 4KLGA 3MGHA 1R8CA 5TZVA 2PFPA 3MR2A 3RRHA 5J2BA 1SKSA 2J6TA 1NK0A 1NKCA 5IIKA 3PX6A 4YMNA 2RDIA 4M04A 2VA3A 4J9LA 4GC7A 1QTMA 2O5AA 5CR0A 2MUTA 4F2RA 2NRWA 3HJ1A 2AQ0A 3RTVA 1CUKA 3TFRA 2PI5A 2NRKA 3V7KA 5J0PA 4F5OA 4YXMA 5KT4A 9ICXA 2KZMA 3RJKA 1S0NA 4R65A 3JPOA 4X4QA 3OSNA 4DS4A 3RBDA 4M0AA 3C5GA 4FH5A 1NK6A 1RYSA 4NKTA 5KFJA 1T7PA 1QLNA 1NK4A 4BXOB 3WFSC 5F9LA 5KG4A 2PFQA 2P6RA 9ICIA 9ICOA 4WBZA 4WC3A 1ZETA 5KFCA 1S10A 4B9VA 2HHTA 1Q79A 5DBBA 2C28A 4UD4A 4C8MA 1QSLA 4YR2A 5KFTA 1UEUA 4UBCA 3THVA 1KEJA 1JX4A 4DQQA 1ZQFA 5KT7A 5J2FA 3MR5A 5DQIA 4ECZA 4S3NA 4R8UA 4FHYA 1PZNA 1ZQVA 4NM1A 1ZQCA 5HRIA 4WC4A 3EW9A 4TQRA 4DQRA 3KTQA 1DK3A 5KFSA 4ED6A 4I2EA 4DS5A 4ED8A 4NLNA 3K4GA 3QZ8A 1WCLA 4J9RA 2BHNA 3B0YA 4Q44A 2ZTEA 4JUZA 1V9PA 3LK9A 4I28A 4X5VA 2BDPA 4M9GA 1B22A 5KFPA 1JMSA 4ATBB 5J0TA 1LV5A 4O3SA 5J29A 4AT9A 4JWNA 4TUSA 1LB2B 1F5AA 4IRDA 2DR8A 4KLQA 4EP7A 2VA8A 4FBTA 1NZPA 2I1QA 1ZQNA 4NXZA 3H37A 9ICHA 4E0DA 1ZQQA 4RPXA 1KSPA 3PW2A 4KLLA 5KFXA 2KFNA 4EZ9A 4YMMA 3ISBA 5D46A 5J2AA 3TAPA 4KLIA 2FPLA 1EXNA 4X4VA 5DGAA 4WC0A 4FHWA 4DSIA 4UB3A 3E2EA 1ZQOA 2JEGA 4KTQA 1ZQSA 4M9NA 4WBYA 4J9SA 1KTQA 3EYZA 4TUQA 1ZQGA 3GQCA 4RQ6A 4FO6A 4JV0A 5HHIA 3TI0A 4R8UB 2F1HA 1BVSA 5J2JA 3M9OB 3BQ1A 4DSFA 5CJ7A 4ED0A 3RH4A 8ICRA 1SL1A 7ICVA 4UAWA 9ICKA 1UA0A 3TQ1A 5L9XA 4KN7A 3C5FA 1XSLA 2ID1A 9ICQA 4QWCA 4E8FA 3EPIA 5KFZA 3G6XA 4ECUA 4MEYA 4J9NA 1MIVA 4I2CA 5CHGA 5IIJA 4Z6EA 3V7LA 2AGPA 4WCWA 9ICCA 3EWAA 1U9LA 4DSEA 1UA1A 1B43A 2ZJ5A 2R8JA 2KTQA 4QW8A 4F4WA 4I2HA 4O0IA 3HW8A 4M9LA 1RXVA 1BPBA 4MF8A 8ICGA 2ZUDA 3OUYA 3BQTA 1H38A 5HC9A 1L3TA 1R89A 2HHWA 4M6WA 1FA0A 4DSLA 1RZTA 1ZYQA 2UVWA 5KFNA 3OV7A 5DG7A 4F92B 2R8GA 5KFGA 4DSKA 4UB1A 4TUPA 4M5DA 9ICPA 5L1KA 2W9CB 3FDSA 3ZDEA 3RB3A 9ICFA 4RQ3A 4ECVA 3RJGA 4EBDA 1BPDA 5EWEA 3OSPA 1L3VA 2BCRA 4O9MA 5HRKA 2ZH9A 1TK5A 2WTFA 4IQWA 8ICQA 1BNOA 3JPTA 4QWEA 2UVVA 7ICEA 1KFDA 4M6WB 3NTUA 5DG8A 3C2MA 1U48A 4BXOA 3TAQA 7ICOA 4Q8EA 1MC8A 3JPQA 4P4PA 3MFHA 3H39A 2ZH3A 3OJSA 1KFTA 3HJ4A 4DQIA 1COOA 2IHNA 5J0XA 1S0MA 1KNYA 5KFWA 2XGQA 8ICIA 5BPCA 7ICUA 5KFYA 1V4AA 2KZZA 1ZQDA 3UPSA 4P2HA 4DF8A 4X4PA 3Q8MA 1ZQTA 4ECSA 2DPIA 4GXJA 1NKEA 3JPNA 3KHLA 4YMOA 5JUMA 1NK8A 1ZJMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MQ3 A;  5HRB A;  2H5X A;  2XC9 A;  2XCA A;  3H8W A;  4PHA A;  4DFJ A;  3TAR A;  3N4M B;  3GIJ A;  1S77 D;  2W9C A;  4YR0 A;  5KT2 A;  4WC1 A;  2HHU A;  4GC6 A;  3JZ0 A;  1A76 A;  4RQ7 A;  1TK0 A;  1Z00 B;  4RPY A;  4X4R A;  2A1J A;  2DVI A;  2F1I A;  5KG3 A;  4F50 A;  5BOM A;  5D4B A;  4ECX A;  4GXI A;  1L5U A;  2AQ4 A;  5KFR A;  1ZQY A;  4RT3 A;  4B9S A;  4IRC A;  4EBJ A;  1R8A A;  3RAX A;  3ISC A;  3C1Y A;  5KFB A;  4QWA A;  3V72 A;  1T8E A;  5J2H A;  2JZB A;  2NRV A;  2ZUB A;  3H3A A;  1ZQP A;  5CWR A;  1S97 A;  2PFO A;  1XSP A;  5J2C A;  4Q43 A;  4RNN A;  3MR6 A;  4ED7 A;  1NKB A;  5J0Q A;  4O5C A;  1CEZ A;  9ICE A;  3PVX A;  5KFF A;  3LDA A;  4DL3 A;  1WOT A;  4NY8 A;  2ZTC A;  1Z00 A;  4I2I A;  2BPF A;  1S0V A;  3RRG A;  5DB7 A;  5KFU A;  4IRK A;  1XC9 A;  2O1P A;  4MFA A;  2ZJ8 A;  2BQU A;  3QE9 Y;  8ICV A;  4KIT B;  3MDA A;  3UQ0 A;  3PV8 A;  2HVH A;  1A77 A;  2M9N A;  3HWT A;  2ALZ A;  1KDH A;  2ZHA A;  3AU2 A;  3V6H A;  4YD1 A;  4RQ5 A;  4J9K A;  3PO4 A;  3GII A;  1NK9 A;  4RU9 A;  3AQK A;  7ICL A;  3WFR E;  1BPE A;  1ZQU A;  3C1Z A;  4RUC A;  1VFG A;  4UB5 A;  2C2E A;  5KFV A;  1KFS A;  2NRX A;  4O5E A;  5DBC A;  1Q78 A;  5J0S A;  3H40 A;  2AU0 A;  4F4K A;  8ICM A;  2VAN A;  9ICN A;  4M2Y A;  3PNC A;  2VA2 A;  3BDP A;  4LZD A;  2BKE A;  3SI8 A;  3H8J A;  4YQW A;  2DRA A;  2W9B A;  5HNK A;  4F8R A;  1ZQX A;  1XO1 A;  1XWL A;  3RJE A;  9ICG A;  5DLF A;  4AT7 B;  3V6J A;  3RB0 A;  2PFN A;  3TFS A;  3PW5 A;  3WFO A;  3MGI A;  2BCV A;  4PH5 A;  4QZ8 A;  2Y1I A;  1NO5 A;  4YR3 A;  2XO7 A;  4MFF A;  5HR9 A;  1NJZ A;  1OU5 A;  2V9W A;  1TAU A;  4C8N A;  9ICU A;  5KFI A;  3NGD A;  4DLG A;  5KG0 A;  4I2A A;  4XQ8 A;  2HHV A;  4O3Q A;  3PMN A;  2BQR A;  4F3O A;  4I2F A;  4ECR A;  2BCS A;  4O5K A;  5HMM A;  5C5J A;  4QZB A;  1ZQJ A;  7ICH A;  5DLG A;  2DPJ A;  3H8S A;  5BOL A;  1C7Y A;  8ICF A;  8ICX A;  4RUA A;  4RWP A;  1R8B A;  2BE3 A;  9ICW A;  2ZH4 A;  3WFQ E;  2KFZ A;  4G3I A;  4NLG A;  3MBY A;  3RJJ A;  4I27 A;  3KHR A;  4K4G A;  8ICH A;  4ELU A;  8ICN A;  3TAN A;  3ZDB A;  3OUY B;  1X2I A;  2KZ3 A;  4ED3 A;  2UVU A;  7ICN A;  2M2T A;  3BJY A;  3HIY A;  4IQT A;  4QZI A;  2FMS A;  1BGX T;  3OGU A;  2FPM A;  3SV4 A;  1ZQL A;  4FS2 A;  3GV5 B;  2BCU A;  2P66 A;  3RB4 A;  3BQ2 A;  4I2G A;  2MAX A;  4F5P A;  4F4X A;  3IM1 A;  2RDJ A;  2BPG A;  2ISO A;  1PX5 A;  2Q66 A;  3PW0 A;  3OVB A;  5CP2 A;  4J9O A;  5DB8 A;  4UAZ A;  1SL2 A;  8ICJ A;  2ZH8 A;  4DFK A;  1TFW A;  3EZ5 A;  4KLE A;  4FHV A;  1K1Q A;  1U4B A;  1MIW A;  2A1J B;  4O3P A;  3PX4 A;  1JIH A;  3RJI A;  2R8K A;  4R63 A;  8ICS A;  4MEX A;  2KP7 A;  3K75 D;  3GV8 B;  4YG2 A;  4PGY A;  3RAQ A;  7ICG A;  1D8L A;  5DQH A;  4RQ8 A;  3GDX A;  1D9F A;  1BNP A;  4X4O A;  3ORY A;  2P6U A;  3T5J A;  2JEI A;  5DDM A;  3OHB A;  2W8K A;  4DEZ A;  1IXR A;  4JV2 A;  5L1L A;  4NKU A;  3MAB A;  2IMW P;  4HYK A;  3H4B A;  2C2D A;  1HUO A;  1T4G A;  8ICY A;  5KFK A;  3MR3 A;  1ZQE A;  1UET A;  5EOZ A;  1ZJN A;  1DOQ A;  4WC7 A;  4M47 A;  3PW4 A;  5HRH A;  4AT9 B;  3V7J A;  5HP4 A;  5J2K A;  3LQC B;  4KLD A;  3LWM A;  4RWN A;  9ICR A;  3ETL A;  4EYI B;  3GV7 B;  1JXE A;  4EBC A;  3BQ0 A;  1D8Y A;  2J6U A;  4ELV A;  3H7I A;  4DQS A;  4BWJ A;  1ZQW A;  1U49 A;  5HRF A;  2RFF A;  1KLN A;  5KG6 A;  4F93 B;  4UB2 A;  1NK7 A;  2HHS A;  2C22 A;  2XY7 A;  4QZE A;  9ICJ A;  4X4T A;  1TFR A;  2W9M A;  4DOB A;  4KLM A;  1QSY A;  4EBE A;  3C2K A;  1ZQM A;  4K4H A;  7ICJ A;  5DG9 A;  3AU6 A;  4IQV A;  1SKR A;  2GWS A;  3T3F A;  3Q8S B;  1MIY A;  5IIM A;  2FMP A;  3UQ2 A;  4QW9 A;  4QWB A;  4QZH A;  1U47 A;  3PR4 A;  5KFE A;  2ASJ A;  3PML A;  3QZ7 A;  1TAQ A;  4TQS A;  3AQM A;  5D49 A;  9ICA A;  5HRG A;  5J0U A;  3T5K A;  3Q8K A;  4KLO A;  3H38 A;  4EYH B;  3C66 A;  4M9J A;  2OWO A;  4RPZ A;  4YXJ A;  5DQG A;  5EWG A;  1ZQA A;  3JPR A;  8ICL A;  1ARO P;  5HHH A;  3SZ2 A;  1U45 A;  3OHA A;  1TK8 A;  1VJ7 A;  1Y88 A;  5IIO A;  4E80 A;  3JYY A;  4NLK A;  4KN4 A;  3Q8R B;  2XCP A;  2V4Q A;  8ICB A;  4R66 A;  2MUT B;  3JPS A;  3AUO A;  2XGP A;  4DL4 A;  2IA6 A;  2ZUC A;  2JZB B;  4KLH A;  2IBK A;  4UAY A;  2JEJ A;  4WC6 A;  3JPP A;  2M2V A;  2BPC A;  1S76 D;  3KHG A;  5HRE A;  2PI4 A;  4PHD A;  3H4D A;  4J9M A;  3SYZ A;  1ZQR A;  4PHE A;  4YP3 A;  3N97 B;  3RB6 A;  4X4S A;  7ICK A;  2ZH7 A;  3ISD A;  2PXI A;  9ICS A;  5DEC A;  1N56 A;  7ICF A;  4RT2 A;  5HRD A;  4KLU A;  5DB6 A;  4RQ1 A;  1BPZ A;  3EPG A;  3RH6 A;  2ZH2 A;  4RNM A;  1JXL A;  4DO9 A;  1X9M A;  3L9D A;  2R8I A;  4RWO A;  2BR0 A;  4F4Z A;  4DLE A;  2UVR A;  3RR7 A;  1ZQH A;  1SKW A;  3UXN A;  5KFM A;  4B9L A;  4UD5 A;  1BPY A;  1BPX A;  8ICE A;  5CA7 A;  4I2B A;  2ZH5 A;  2DRB A;  8ICW A;  3C18 A;  5IIL A;  4EBK A;  3Q8Q B;  7ICT A;  9ICT A;  5KT6 A;  3RJF A;  1XU4 A;  4XQ7 A;  2ZH1 A;  4X0B A;  2DR7 A;  4YCX A;  4XA5 A;  3IHQ B;  4PHP A;  3Q8L A;  4YVZ A;  3UXO A;  4QZG A;  5J0Y A;  4B9U A;  1JAJ A;  5J2D A;  3GIL A;  4X4N A;  2KN7 A;  3HP6 A;  2IHM A;  2ZH6 A;  2FPK A;  5IIN A;  4Q45 A;  3QEB Z;  3RJH A;  4ATB A;  4ED1 A;  1S9F A;  1QSS A;  2F1J A;  2ZTD A;  3ZD8 A;  4YFK A;  3T5L A;  1L3U A;  3ZDC A;  4NLZ A;  4X4U A;  3PY8 A;  4I2J A;  3OVA A;  4QZ9 A;  3HX0 A;  3PW7 A;  3M8S A;  2XY5 A;  2HW3 A;  4WC2 A;  4ECT A;  4AT8 B;  4YD2 A;  2AJQ A;  5J0R A;  7ICS A;  4DFM A;  8ICU A;  4ECY A;  4O3N A;  4YN4 A;  4DL7 A;  4Z6F A;  2HHX A;  4AT8 A;  4KLJ A;  2ZJA A;  2FLP A;  4LZG A;  1Z3E B;  3RBE A;  4IG8 A;  4PGQ A;  1KRP A;  2HVI A;  4JV1 A;  2HHQ A;  2FLL A;  4Z6C A;  4ED2 A;  2AGQ A;  1TKD A;  4K4I A;  1JQR A;  4KLT A;  5DBA A;  1SL0 A;  1YLQ A;  1ZQK A;  4IR1 A;  2Y1J A;  4CCH A;  4RQ4 A;  1NJW A;  1RXW A;  3GFK B;  2JEF A;  5J0O A;  2LYH A;  2W9B B;  3UPQ A;  3V6K A;  2ISP A;  4FS1 A;  3MDC A;  2R8H A;  3RR8 A;  3G6Y A;  4DSJ A;  5J0W A;  1NK5 A;  4IQU A;  5KFQ A;  3FYH A;  4E7X A;  5F9N A;  5KFH A;  5KFD A;  3KHH A;  3T5H A;  2DR9 A;  4P4M A;  5EWF A;  3M9N B;  3M8R A;  4KMU A;  1X9W A;  4FHP A;  3B0X A;  4RQ2 A;  4NM2 A;  4RNO A;  4PGX A;  4GLX A;  3NYB A;  3MFI A;  1NJX A;  4FHX A;  1HJP A;  3PO5 A;  4LT6 A;  1UEV A;  2ASD A;  5J2E A;  3OVS A;  7ICQ A;  1UT5 A;  2NRZ A;  3M9M B;  5HML A;  4F4Y A;  2DFL A;  3RH5 A;  1TV9 A;  2B21 A;  8ICP A;  4ZH4 A;  1HUZ A;  5KG5 A;  4I29 A;  4MFC A;  4DL6 A;  5L1I A;  2XY6 A;  2ATL A;  4C8L A;  4C8K A;  5KG1 A;  7ICM A;  2M2W A;  4EEY A;  2DR5 A;  1TFY A;  4JWM A;  4B9N A;  3ZDD A;  1JN3 A;  4AT7 A;  5KFO A;  3PX0 A;  3UXP A;  2I9G A;  5DKW A;  4O3O A;  2ASL A;  9ICB A;  4QZC A;  3QEA Z;  4B9M A;  5DGB A;  3WFP A;  4F5N A;  4WC5 A;  4R64 A;  4M9H A;  4BWM A;  5KFL A;  2NRT A;  3PR5 B;  4BDP A;  7ICR A;  5F2V O;  4F5R A;  4IR9 A;  4ELT A;  4DF4 A;  4KLF A;  4QWD A;  1K1S A;  2BGW A;  4KLS A;  5III A;  5DB9 A;  2W8L A;  4Z6D A;  2C2R A;  2BCQ A;  2FMQ A;  5KG7 A;  1ZQI A;  3C23 A;  2BQ3 A;  4DQP A;  2Q0Z X;  2PBE A;  1RPL A;  9ICM A;  1SZP A;  3AQL A;  5HRL A;  3C2L A;  1MQ2 A;  2FLN A;  4GXK A;  1L3S A;  5KG2 A;  4UQG A;  8ICO A;  4TUR A;  5KT3 A;  1XS9 D;  1TVA A;  4ECQ A;  4B9T A;  2ZHB A;  4J9P A;  1S0O A;  3HPO A;  4ECW A;  4QZF A;  2V4R A;  1IM4 A;  4BGD A;  2W9A A;  5J2I A;  5KT5 A;  4DL5 A;  3LWL A;  8ICK A;  3OJU A;  8ICT A;  4RQ0 A;  4DOA A;  8ICC A;  2HHP A;  2AGO A;  3Q8P B;  4JK1 A;  9ICL A;  4FH3 A;  4F91 B;  3GIK A;  1ZQZ A;  5KFA A;  1NOM A;  4DFP A;  1NJY A;  1MSW D;  3AQN A;  5DED A;  4DL2 A;  4QZA A;  4QZD A;  3HT3 A;  1D9D A;  4Q8F A;  4X0A A;  4XUS A;  4F2S A;  4DWI A;  3GIM A;  4P4O A;  7ICI A;  1DK2 A;  8ICZ A;  4UBB A;  1RYR A;  5DDY A;  5L1J A;  4DOC A;  1N48 A;  1X9S A;  2J6S A;  9ICV A;  4J9Q A;  5KTQ A;  1XSN A;  3ZD9 A;  3ZDA A;  1WCN A;  1T3N A;  1ZQB A;  4UB4 A;  4XRH A;  3G6V A;  4RZR A;  4F5Q A;  2M2U A;  7ICP A;  5J2G A;  5CB1 A;  4EZ6 A;  4I2D A;  4O3R A;  3SV3 A;  1UT8 A;  4LVS A;  4RWQ A;  8ICA A;  4C8O A;  4PPX A;  1DGS A;  4FBU A;  3C21 A;  4MF2 A;  4KLG A;  3MGH A;  1R8C A;  5TZV A;  2PFP A;  3MR2 A;  3RRH A;  5J2B A;  1SKS A;  2J6T A;  1NK0 A;  1NKC A;  5IIK A;  3PX6 A;  4YMN A;  2RDI A;  4M04 A;  2VA3 A;  4J9L A;  4GC7 A;  1QTM A;  2O5A A;  5CR0 A;  2MUT A;  4F2R A;  2NRW A;  3HJ1 A;  2AQ0 A;  3RTV A;  1CUK A;  3TFR A;  2PI5 A;  2NRK A;  3V7K A;  5J0P A;  4F5O A;  4YXM A;  5KT4 A;  9ICX A;  2KZM A;  3RJK A;  1S0N A;  4R65 A;  3JPO A;  4X4Q A;  3OSN A;  4DS4 A;  3RBD A;  4M0A A;  3C5G A;  4FH5 A;  1NK6 A;  1RYS A;  4NKT A;  5KFJ A;  1T7P A;  1QLN A;  1NK4 A;  4BXO B;  3WFS C;  5F9L A;  5KG4 A;  2PFQ A;  2P6R A;  9ICI A;  9ICO A;  4WBZ A;  4WC3 A;  1ZET A;  5KFC A;  1S10 A;  4B9V A;  2HHT A;  1Q79 A;  5DBB A;  2C28 A;  4UD4 A;  4C8M A;  1QSL A;  4YR2 A;  5KFT A;  1UEU A;  4UBC A;  3THV A;  1KEJ A;  1JX4 A;  4DQQ A;  1ZQF A;  5KT7 A;  5J2F A;  3MR5 A;  5DQI A;  4ECZ A;  4S3N A;  4R8U A;  4FHY A;  1PZN A;  1ZQV A;  4NM1 A;  1ZQC A;  5HRI A;  4WC4 A;  3EW9 A;  4TQR A;  4DQR A;  3KTQ A;  1DK3 A;  5KFS A;  4ED6 A;  4I2E A;  4DS5 A;  4ED8 A;  4NLN A;  3K4G A;  3QZ8 A;  1WCL A;  4J9R A;  2BHN A;  3B0Y A;  4Q44 A;  2ZTE A;  4JUZ A;  1V9P A;  3LK9 A;  4I28 A;  4X5V A;  2BDP A;  4M9G A;  1B22 A;  5KFP A;  1JMS A;  4ATB B;  5J0T A;  1LV5 A;  4O3S A;  5J29 A;  4AT9 A;  4JWN A;  4TUS A;  1LB2 B;  1F5A A;  4IRD A;  2DR8 A;  4KLQ A;  4EP7 A;  2VA8 A;  4FBT A;  1NZP A;  2I1Q A;  1ZQN A;  4NXZ A;  3H37 A;  9ICH A;  4E0D A;  1ZQQ A;  4RPX A;  1KSP A;  3PW2 A;  4KLL A;  5KFX A;  2KFN A;  4EZ9 A;  4YMM A;  3ISB A;  5D46 A;  5J2A A;  3TAP A;  4KLI A;  2FPL A;  1EXN A;  4X4V A;  5DGA A;  4WC0 A;  4FHW A;  4DSI A;  4UB3 A;  3E2E A;  1ZQO A;  2JEG A;  4KTQ A;  1ZQS A;  4M9N A;  4WBY A;  4J9S A;  1KTQ A;  3EYZ A;  4TUQ A;  1ZQG A;  3GQC A;  4RQ6 A;  4FO6 A;  4JV0 A;  5HHI A;  3TI0 A;  4R8U B;  2F1H A;  1BVS A;  5J2J A;  3M9O B;  3BQ1 A;  4DSF A;  5CJ7 A;  4ED0 A;  3RH4 A;  8ICR A;  1SL1 A;  7ICV A;  4UAW A;  9ICK A;  1UA0 A;  3TQ1 A;  5L9X A;  4KN7 A;  3C5F A;  1XSL A;  2ID1 A;  9ICQ A;  4QWC A;  4E8F A;  3EPI A;  5KFZ A;  3G6X A;  4ECU A;  4MEY A;  4J9N A;  1MIV A;  4I2C A;  5CHG A;  5IIJ A;  4Z6E A;  3V7L A;  2AGP A;  4WCW A;  9ICC A;  3EWA A;  1U9L A;  4DSE A;  1UA1 A;  1B43 A;  2ZJ5 A;  2R8J A;  2KTQ A;  4QW8 A;  4F4W A;  4I2H A;  4O0I A;  3HW8 A;  4M9L A;  1RXV A;  1BPB A;  4MF8 A;  8ICG A;  2ZUD A;  3OUY A;  3BQT A;  1H38 A;  5HC9 A;  1L3T A;  1R89 A;  2HHW A;  4M6W A;  1FA0 A;  4DSL A;  1RZT A;  1ZYQ A;  2UVW A;  5KFN A;  3OV7 A;  5DG7 A;  4F92 B;  2R8G A;  5KFG A;  4DSK A;  4UB1 A;  4TUP A;  4M5D A;  9ICP A;  5L1K A;  2W9C B;  3FDS A;  3ZDE A;  3RB3 A;  9ICF A;  4RQ3 A;  4ECV A;  3RJG A;  4EBD A;  1BPD A;  5EWE A;  3OSP A;  1L3V A;  2BCR A;  4O9M A;  5HRK A;  2ZH9 A;  1TK5 A;  2WTF A;  4IQW A;  8ICQ A;  1BNO A;  3JPT A;  4QWE A;  2UVV A;  7ICE A;  1KFD A;  4M6W B;  3NTU A;  5DG8 A;  3C2M A;  1U48 A;  4BXO A;  3TAQ A;  7ICO A;  4Q8E A;  1MC8 A;  3JPQ A;  4P4P A;  3MFH A;  3H39 A;  2ZH3 A;  3OJS A;  1KFT A;  3HJ4 A;  4DQI A;  1COO A;  2IHN A;  5J0X A;  1S0M A;  1KNY A;  5KFW A;  2XGQ A;  8ICI A;  5BPC A;  7ICU A;  5KFY A;  1V4A A;  2KZZ A;  1ZQD A;  3UPS A;  4P2H A;  4DF8 A;  4X4P A;  3Q8M A;  1ZQT A;  4ECS A;  2DPI A;  4GXJ A;  1NKE A;  3JPN A;  3KHL A;  4YMO A;  5JUM A;  1NK8 A;  1ZJM A; 
#chains in the Genus database with same CATH topology
 1MQ3 A;  4HAI A;  5HRB A;  2XC9 A;  4K98 A;  3GIJ A;  5EE3 A;  2KG5 A;  4RPY A;  2YMP A;  2DVI A;  2F1I A;  4F50 A;  4B9S A;  1ZQY A;  3FC4 A;  1T8E A;  3H3A A;  2JZB A;  1QQ5 A;  3HKZ F;  2PFO A;  1XSP A;  5ALS A;  9ICE A;  3PVX A;  3M7D A;  4I2I A;  5DB7 A;  2QB0 A;  3EUB 2;  4IRK A;  2O1P A;  4OAG A;  5ALR A;  1SGG A;  2ZJ8 A;  3MDA A;  3UQ0 A;  3PV8 A;  1A77 A;  5ALP A;  3V6H A;  4YD1 A;  2KK0 A;  5CFS A;  4K97 A;  3WFR E;  2KVS A;  4RUC A;  1VFG A;  5F3X B;  5KFV A;  2C2E A;  2NRX A;  1KFS A;  1Q78 A;  1ZD5 A;  3H40 A;  2JHD A;  1J2N A;  3GU3 A;  3PNC A;  1X6I A;  2H3I A;  3ICX A;  1XO1 A;  5ALN A;  1V38 A;  4AT7 B;  3V6J A;  3BQ7 A;  2ODG A;  3WFO A;  2DWQ A;  4Y2T A;  3WK7 A;  2Y1I A;  4YR3 A;  2G0A A;  4MFF A;  5HR9 A;  9ICU A;  3PST A;  3NGD A;  5KG0 A;  4I2A A;  1JI7 A;  1ZQJ A;  3H0L B;  2ZIU B;  5BOL A;  8ICX A;  1C7Y A;  2WAQ F;  5AKY A;  3OWG A;  3WFQ E;  4NLG A;  3RJJ A;  1PVR A;  8ICN A;  1ECW A;  2YQE A;  4ED3 A;  2M2T A;  4IQT A;  1BGX T;  4XJE A;  3I28 A;  2L5Y A;  3SAF A;  4I2G A;  5ALE A;  5KNI A;  3WKC A;  3BQ2 A;  4F4X A;  5CP2 A;  2ZH8 A;  2K8A A;  1K1Q A;  1ZRM A;  1U4B A;  2A1J B;  2LMR A;  1JIH A;  4R63 A;  2DBY A;  5ALZ A;  2GH1 A;  2Z7J A;  3F2C A;  1D9F A;  2P6U A;  2JEI A;  5DDM A;  3OHB A;  4NKU A;  3WKB A;  1PUZ A;  4HYK A;  2C2D A;  1T4G A;  4CE6 A;  3MR3 A;  1ZJN A;  4AT9 B;  5HP4 A;  5J2K A;  4BUG A;  3LWM A;  4EYI B;  1JXE A;  1ZQW A;  2RFF A;  1NK7 A;  2HHS A;  2C22 A;  2HOQ A;  9ICJ A;  4NXV A;  2W9M A;  4DOB A;  4IS7 A;  2WF6 A;  4EBE A;  2F2A B;  4O68 A;  2W55 A;  3AU6 A;  1ZD3 A;  3Q8S B;  5IIM A;  4QW9 A;  2HDO A;  3PR4 A;  4TQS A;  5J0U A;  4KLO A;  3HIL A;  2HCF A;  3AMZ A;  5EWG A;  3QX7 A;  1ARO P;  1U45 A;  4Y2P A;  1MA7 A;  2XCP A;  8ICB A;  2K89 A;  4MHV A;  4R66 A;  2XGP A;  2JEJ A;  3JPP A;  2M2V A;  2BPC A;  3ERC C;  4K99 A;  3H4D A;  4J9M A;  7ICK A;  1WUD A;  2PXI A;  1N56 A;  3QUC A;  1JXL A;  1X9M A;  2UVR A;  5ALO A;  1ZQH A;  4I2B A;  3DDH A;  2EWR A;  5IIL A;  1XU4 A;  2ZH1 A;  3SEI A;  4X0B A;  2KHV A;  4YCX A;  4QZG A;  3NVY A;  1VJ5 A;  1S9F A;  4NL9 A;  1SWW A;  4NLZ A;  4JMU A;  4X4U A;  4QZ9 A;  2DKZ A;  1K5O A;  3M8S A;  4AT8 B;  2ZIU A;  2AJQ A;  7ICS A;  4DFM A;  4ECY A;  4O3N A;  3NRZ A;  4YN4 A;  3IDW A;  4DL7 A;  3RBE A;  3U26 A;  4PGQ A;  1KRP A;  2YN4 A;  4JV1 A;  3ZI4 A;  4K4I A;  5HR7 A;  4IR1 A;  4RQ4 A;  3UPQ A;  3G6Y A;  4NXT A;  2QLT A;  2MU2 A;  1NK5 A;  4FFD A;  5F9N A;  5KFH A;  3T5H A;  3M8R A;  1QCK A;  3B0X A;  5EE0 A;  4GLX A;  3NYB A;  4LT6 A;  3PO5 A;  2NRZ A;  2AHO B;  5HML A;  2CRX A;  3RH5 A;  2B21 A;  4ZH4 A;  1HUZ A;  1IG6 A;  4I29 A;  4C8L A;  5TIS U;  5L1I A;  2ATL A;  7ICM A;  2M2W A;  2A1A A;  3N28 A;  4EEY A;  3WK9 A;  2K8C B;  4EEK A;  4AT7 A;  2ASL A;  3QEA Z;  1DGJ A;  4R64 A;  5KFL A;  3PR5 B;  4F5R A;  2E8O A;  4DF4 A;  2EZX A;  4Z6D A;  2BCQ A;  1PVQ A;  5KG7 A;  2Q0Z X;  1PK1 A;  5HRL A;  3BS5 A;  5AKG A;  4TUR A;  2DKX A;  4LEV A;  3F2B A;  5JU5 A;  2HMX A;  4DL5 A;  4NLC A;  8ICK A;  4JLZ A;  2JXJ A;  8ICT A;  4K96 A;  1S5L U;  8ICC A;  2G5I B;  3Q8P B;  2LHT A;  4Y2X A;  1F0M A;  2K4E A;  1ZQZ A;  5KFA A;  5DED A;  4X0A A;  5CFT A;  4DWI A;  7ICI A;  4C4S A;  8ICZ A;  3MCR A;  1N48 A;  1X9S A;  4QIW C;  4J9Q A;  1XSN A;  3ZD9 A;  1T3N A;  3TAC B;  4F5Q A;  3CNH A;  4CF4 A;  4LVS A;  4C8O A;  1R8C A;  2LM4 A;  2J6T A;  1NK0 A;  4YMN A;  2VA3 A;  2O5A A;  4O6A A;  1RYU A;  2MUT A;  3NS1 A;  4F2R A;  3HJ1 A;  2NV3 A;  4HX0 A;  3TFR A;  3V7K A;  2XI9 A;  4LEZ A;  2KZM A;  3RBD A;  3C5G A;  1NK6 A;  1LVH A;  1T7P A;  4KMO B;  1NK4 A;  5F9L A;  9ICI A;  9ICO A;  4WBZ A;  4WC3 A;  1ZET A;  2HBL A;  1S10 A;  5ALL A;  5AHX A;  5AI5 A;  4YR2 A;  4UBC A;  2HOF A;  1ZQF A;  3LVW A;  5DQI A;  5JTI A;  1PZN A;  1FEZ A;  4TQR A;  3K4G A;  3QZ8 A;  1WCL A;  4Q44 A;  2KJ9 A;  1V9P A;  4AYB F;  4LJX A;  2BDP A;  1JAL A;  3R9K A;  5J29 A;  1L8L A;  1LB2 B;  2VA8 A;  4FBT A;  4NXZ A;  9ICH A;  4I0U A;  4OJ6 A;  1M6Y A;  5KFX A;  2KFN A;  4KLI A;  4X4V A;  4WC0 A;  2NYV A;  2P35 A;  4FHW A;  3E2E A;  4KTQ A;  1X66 A;  4WBY A;  1ZQS A;  3D6J A;  1KTQ A;  4RQ6 A;  2WF5 A;  4JV0 A;  4R8U B;  1BVS A;  4UAS A;  3M9O B;  4DSF A;  4ED0 A;  3RH4 A;  8ICR A;  9ICK A;  5L9X A;  4E8F A;  3EPI A;  1IV8 A;  4I2C A;  4WCW A;  5IIJ A;  3V7L A;  2AGP A;  3NWI A;  9ICC A;  1U9L A;  4PJ0 U;  1B43 A;  2ZJ5 A;  2R8J A;  4I2H A;  4O0I A;  4MF8 A;  3OUY A;  1YZ6 A;  3IN5 A;  4M6W A;  1FA0 A;  4DSL A;  4IL6 U;  2ZIV A;  2FI1 A;  4F92 B;  5KFG A;  4NJ8 A;  3HRD D;  3FDS A;  3ZDE A;  4WJ3 B;  1C20 A;  4EBD A;  5ALF A;  1F5S A;  1TK5 A;  2VJ4 A;  2WTF A;  1A6S A;  2ZIV B;  2MSN A;  4M6W B;  3NTU A;  4EEN A;  5DG8 A;  3JPQ A;  4G9B A;  1S8O A;  3IG8 A;  4DQI A;  1S0M A;  1T3Q A;  3UPS A;  5BPC A;  1L8O A;  2JRZ A;  2YMQ A;  5KFY A;  1ZQD A;  3KZX A;  4P2H A;  4X4P A;  4GXJ A;  1TE2 A;  5ALU A;  5KL8 B;  4EX6 A;  3TAR A;  4PHA A;  1S77 D;  3N4M B;  2KKV A;  4WC1 A;  4US9 A;  2IHO A;  2FE9 A;  4GC6 A;  2NO4 A;  1Z00 B;  4UB8 U;  5KG3 A;  1L5U A;  3ISC A;  3C1Y A;  4QWA A;  5J2H A;  2ZUB A;  1ZQP A;  5CWR A;  1KL9 A;  4LEW A;  5J2C A;  4ED7 A;  5EE9 A;  5J0Q A;  1CEZ A;  5KFF A;  3LDA A;  4DL3 A;  1WOT A;  2BPF A;  3NVZ A;  1V97 A;  4KX3 A;  1XC9 A;  1QH9 A;  2BQU A;  4P0Q A;  4RQN A;  8ICV A;  1SV0 C;  3WK6 A;  2ALZ A;  3L4P A;  3AU2 A;  3PO4 A;  1BPE A;  3C1Z A;  3WKD A;  5J0S A;  2KIC A;  8ICM A;  9ICN A;  4M2Y A;  2VA2 A;  2FJ6 A;  3WK8 A;  4LZD A;  3BDP A;  4C4R A;  2OYY A;  1XWL A;  2IOH A;  3RB0 A;  1GO3 F;  3TFS A;  1SXE A;  3QUB A;  3MGI A;  2BCV A;  4PH5 A;  2G5H B;  4QZ8 A;  1OU5 A;  2V9W A;  2JR5 A;  1ZOL A;  3KBB A;  5HR6 A;  3PZP A;  4F3O A;  4QZB A;  3H8S A;  8ICF A;  4RWP A;  9ICW A;  4OCZ A;  4G3I A;  3MBY A;  2YTU A;  2RRD A;  3ZDB A;  2KZ3 A;  4EEB A;  3BJY A;  2DL0 A;  4QZI A;  5AK6 A;  1ZQL A;  1X6J A;  3QUQ A;  2Q66 A;  5CFU A;  1KKX A;  3DEE A;  3NKU A;  1TFW A;  3EZ5 A;  2HBJ A;  1RQN A;  2R8K A;  1HEK A;  8ICS A;  2G09 A;  3K75 D;  3BS5 B;  4YG2 A;  3AQF A;  3TAD C;  1BNP A;  3ORY A;  1WG8 A;  1IXR A;  5L1L A;  2WAQ C;  5J8Y A;  2W54 A;  1UET A;  5EOZ A;  3PW4 A;  2YMM A;  4F71 A;  3LQC B;  1VLB A;  2J6U A;  4EBC A;  4O3M A;  3BQ0 A;  2ZIX A;  3H7I A;  4DQS A;  1KLN A;  4F93 B;  4UB2 A;  3F5A A;  4QZE A;  4X4T A;  2E5S A;  1ZQM A;  4K4H A;  7ICJ A;  2VJ5 A;  2GWS A;  3T3F A;  3DV9 A;  4EED A;  3UQ2 A;  3L3F X;  5ALH A;  5AK5 A;  3PML A;  3T5K A;  3H38 A;  2W04 A;  4RPZ A;  4YXJ A;  1ZQA A;  3KFU F;  4OJ5 A;  3SZ2 A;  3OHA A;  5IIO A;  4NLK A;  5CEH A;  3AUO A;  4WC6 A;  5HRE A;  3SYZ A;  3J81 j;  1ZQR A;  4PHE A;  4YP3 A;  3N97 B;  4X4S A;  2ZH7 A;  5E79 U;  2ES6 A;  4KLU A;  5DB6 A;  5HRD A;  4GFJ A;  4RNM A;  2FDR A;  2R8I A;  2BR0 A;  3RR7 A;  2RQ5 A;  4UD5 A;  2VIX A;  2ZH5 A;  8ICW A;  3C18 A;  4EBK A;  7ICT A;  3ETR A;  4XQ7 A;  2DR7 A;  3IHQ B;  4PHP A;  3Q8L A;  4YVZ A;  4B9U A;  2IHM A;  1CRX A;  3KKA C;  3QEB Z;  4ED1 A;  2F1J A;  2IOF K;  2EQY A;  2D3D A;  5A0L A;  3PW7 A;  4WC2 A;  2LM1 A;  3HJE A;  8ICU A;  4AT8 A;  2HHX A;  2DUY A;  4LZG A;  5D62 A;  5ALT A;  1V85 A;  2LI6 A;  5DBA A;  1YLQ A;  1FFV A;  2Y1J A;  1NJW A;  5J0O A;  2W9B B;  2W7P A;  4DSJ A;  4NXU A;  2OM6 A;  5KFD A;  4B6J A;  2DR9 A;  5EWF A;  2R18 A;  2OH2 A;  4FHP A;  1HJP A;  3OVS A;  2W11 A;  5J2E A;  7ICQ A;  3M9M B;  4ICA A;  4FZL A;  5KG5 A;  2XY6 A;  1PK3 A;  4C8K A;  2A3V A;  3WKE A;  4O69 A;  2GO7 A;  3PX0 A;  2I9G A;  2Y9T A;  9ICB A;  4QZC A;  4B9M A;  5B66 U;  2GA9 D;  4M9H A;  4BWM A;  5AIC A;  2NRT A;  7ICR A;  2LBO A;  4IR9 A;  3OTQ A;  4KLF A;  2BGW A;  1P7D A;  5DB9 A;  2FMQ A;  4DFD A;  2BQ3 A;  2PBE A;  1SZP A;  3AQL A;  1MQ2 A;  2FLN A;  4GXK A;  5KG2 A;  5B5E U;  5KT3 A;  1XS9 D;  1TVA A;  2ZHB A;  1S0O A;  1JRO A;  2IUB A;  4ECW A;  3KD3 A;  4BGD A;  5KT5 A;  3OJU A;  2KE7 A;  4K8V A;  2AGO A;  4JK1 A;  4FH3 A;  2H3Z A;  1NJY A;  1ED1 A;  4QZA A;  3HT3 A;  1D9D A;  3AQE A;  2CN1 A;  2Q4T A;  4UBB A;  4Y2U A;  5L1J A;  2J6S A;  1ZD2 P;  5KTQ A;  2KSO B;  4UB4 A;  4XRH A;  3G6V A;  1N5X A;  5CB1 A;  4I2D A;  4PPX A;  2MRL A;  3KKA A;  5J2B A;  3AN1 A;  3OPX A;  4KM5 A;  2HBM A;  4GC7 A;  1QTM A;  5CR0 A;  2NRW A;  2AQ0 A;  4QIW F;  1CUK A;  1HIW A;  2PI5 A;  5KT4 A;  3QU5 A;  4R65 A;  3JPO A;  2HBK A;  2WF8 A;  1QLN A;  4BXO B;  5KG4 A;  2PFQ A;  5D61 A;  3E0F A;  1QSL A;  5AKL A;  5KT7 A;  3MR5 A;  3SQI A;  4S3N A;  2YX8 A;  2A19 A;  4ED6 A;  2KJ5 A;  2EZY A;  2ZTE A;  1B22 A;  2B56 A;  2ZIX B;  5KFP A;  3BZK A;  1LV5 A;  4PL1 A;  4JWN A;  1F5A A;  1SWV A;  1ZQN A;  4FO1 A;  1KSP A;  3TAP A;  1EXN A;  5AKJ A;  5DGA A;  5JTG A;  2KV2 A;  4J9S A;  3EYZ A;  1ZQG A;  3GQC A;  4FO6 A;  2F1H A;  2ZHA A;  7ICV A;  3ALR A;  3TQ1 A;  2ZG6 A;  2ID1 A;  5KFZ A;  5CHG A;  4Z6E A;  3QUT A;  3EWA A;  4DSE A;  1UA1 A;  2KJ8 A;  3S6J A;  4QW8 A;  4F4W A;  1DXS A;  1RXV A;  2F3N A;  8ICG A;  3BQT A;  2WB1 C;  3SAH A;  2HHW A;  1ZYQ A;  2E1E A;  5KFN A;  4CGZ A;  1Q8K A;  3WK4 A;  4O67 A;  2CPR A;  9ICF A;  1OXJ A;  3IP4 B;  3RJG A;  4O9M A;  4QWE A;  2UVV A;  3KZI U;  7ICE A;  3C2M A;  7ICO A;  2E8P A;  4P4P A;  3H39 A;  3D2Q A;  2IHN A;  1XO0 A;  4C7Y A;  5KFW A;  5AIB A;  4DF8 A;  3Q8M A;  1B0X A;  2DPI A;  3JCF A;  3BZC A;  5G5H A;  2KIV A;  4YMO A;  2JGA A;  5K4L A;  1MN8 A;  1ZJM A;  2H5X A;  2H3V A;  2WB1 F;  2AXT U;  3BS7 A;  4EX7 A;  5KT2 A;  2HHU A;  1J2M A;  1O08 A;  1A76 A;  4RQ7 A;  2A1J A;  2CXY A;  5D4B A;  1YZ7 A;  4RT3 A;  1KQQ A;  3V72 A;  2NRV A;  1WWU A;  2F8K A;  4RNN A;  4MKP A;  1NKB A;  5AKX A;  3QU7 A;  1Z00 A;  1S0V A;  5AI4 A;  3F53 A;  4MFA A;  3QE9 Y;  4KIT B;  2M9N A;  3HWT A;  1OW5 A;  4U7C A;  2LKY A;  3GII A;  4RU9 A;  1ZQU A;  4O5E A;  3UMG A;  3SEN A;  5DBC A;  4F4K A;  2VAN A;  4RQM A;  1UHU A;  5AK4 A;  3I76 A;  2DRA A;  4F8R A;  2B51 A;  1ZQX A;  2RLT A;  1Z19 A;  3PW5 A;  2EAP A;  3AEV A;  1L6N A;  1FO4 A;  1NO5 A;  2XO7 A;  1NJZ A;  3M6Z A;  4Y2V A;  1TAU A;  4C8N A;  2HHV A;  3VC8 A;  4XQ8 A;  4NWI A;  3AM9 A;  3CP8 A;  2BQR A;  1CI4 A;  2BCS A;  2O6K A;  5HMM A;  5C5J A;  4P0P B;  7ICH A;  2DPJ A;  4FE3 A;  2BE3 A;  2W3S A;  2KFZ A;  8ICH A;  4I27 A;  4K4G A;  2LPE A;  2QB0 B;  4ELU A;  3TAN A;  1L7N A;  3OUY B;  1X2I A;  7ICN A;  1IIP A;  3HIY A;  3SV4 A;  2FPM A;  1NNL A;  3RFA A;  2BCU A;  2MAX A;  2ISO A;  1PX5 A;  2RDJ A;  1RQL A;  5DB8 A;  3GZF A;  1MIW A;  4O3P A;  3PX4 A;  3RJI A;  2KP7 A;  5AM2 A;  4MEX A;  1D8L A;  5DQH A;  1J97 A;  2W8K A;  4DEZ A;  3MAB A;  3H4B A;  5KAF U;  1NZB A;  3C28 A;  5KFK A;  1ZQE A;  2EAO A;  4WC7 A;  4M47 A;  2KMD A;  9ICR A;  3H0M B;  1D8Y A;  5HRF A;  5JRT A;  5KG6 A;  2LYB A;  3C2K A;  5DG9 A;  4Y2Q A;  1LKY B;  2MA1 A;  4IQV A;  1MIY A;  2E8M A;  2FMP A;  4OO1 J;  1U47 A;  5KFE A;  3QZ7 A;  5T14 A;  5HRG A;  3Q8K A;  4EYH B;  2M0N A;  4M9J A;  2OWO A;  5DQG A;  5C0Y A;  2HSZ A;  3QNM A;  4E80 A;  3JYY A;  3Q8R B;  2V4Q A;  2IA6 A;  2MUT B;  3QXG A;  3JPS A;  4DL4 A;  4K9B A;  4KLH A;  4LEY A;  2HI0 A;  4UAU A;  3KHG A;  3HKZ C;  3FAH A;  2Y0S F;  4WQK A;  3ISD A;  4RT2 A;  1BPZ A;  4GIB A;  4DO9 A;  3L9D A;  4RWO A;  4F4Z A;  5ALQ A;  1SKW A;  5KFM A;  4ACO A;  1BPY A;  5CA7 A;  3Q8Q B;  9ICT A;  2EAN A;  1JAJ A;  3UXO A;  4X4N A;  2FPK A;  4Q45 A;  1N2X A;  4ATB A;  1ZQ1 C;  3ZD8 A;  1FFU A;  4YFK A;  1QSS A;  2YY6 A;  4OAI Z;  3N7S C;  4I2J A;  2DF4 B;  3H0R B;  4ECT A;  2G08 A;  4NXX A;  3CYM A;  2OXO A;  4NXW A;  4EV6 A;  4Z6F A;  2ZJA A;  2FLP A;  1DRG A;  3MGV A;  5AKI A;  3WK5 A;  2Y0S C;  1Z3E B;  5ALV A;  1SB3 C;  3SD7 A;  2FCL A;  2KD1 A;  2HVI A;  4Z6C A;  4ED2 A;  1TKD A;  1JQR A;  4KLT A;  4CCH A;  3F2D A;  1RXW A;  2LYH A;  3MDC A;  3RR8 A;  5CRX A;  5J0W A;  3LYS A;  4E7X A;  1N61 A;  2K4H A;  2KIW A;  3H8M A;  4NV0 A;  3M9N B;  4KMU A;  1X9W A;  1NJX A;  4FHX A;  2B0C A;  3CW2 C;  1UT5 A;  3PSF A;  4F4Y A;  2DFL A;  1TV9 A;  8ICP A;  4MFC A;  5KG1 A;  3QYP A;  2DR5 A;  2YML A;  1TFY A;  4OAH A;  5AI9 A;  4B9N A;  2DQN B;  3ZDD A;  5KFO A;  1JUD A;  3UXP A;  1KBU A;  5DKW A;  2OCE A;  3WFP A;  4F5N A;  4WC5 A;  4BDP A;  5F2V O;  5ALX A;  5AI8 A;  5III A;  2W8L A;  2C2R A;  1UCV A;  4DQP A;  3C2L A;  1L3S A;  8ICO A;  4B9T A;  4ECQ A;  4UB6 U;  3QU9 A;  4J9P A;  3IV6 A;  1D8B A;  4QZF A;  2V4R A;  1N60 A;  5J2I A;  2HHP A;  4RQ0 A;  4DOA A;  2D8C A;  4EEL A;  9ICL A;  4F91 B;  3PSP A;  4Q8F A;  4XUS A;  3GIM A;  4P4O A;  1DK2 A;  4UW9 A;  1ZQB A;  1WYG A;  1KW4 A;  5J2G A;  4O3R A;  3SV3 A;  1UT8 A;  3WKA A;  8ICA A;  1DGS A;  4FBU A;  3C21 A;  5TZV A;  2PFP A;  3MR2 A;  3RRH A;  1SKS A;  1NKC A;  2KNJ A;  2RDI A;  4J9L A;  3B9J A;  4OD0 A;  5ALG A;  2WHE A;  2VKQ A;  3RTV A;  4Y2Y A;  5J0P A;  4F5O A;  4YXM A;  1L7O A;  3A0H U;  4DS4 A;  4M0A A;  4NKT A;  2P6R A;  1JRP A;  5AKZ A;  3K1R B;  5KFC A;  4B9V A;  2HHT A;  4C8M A;  1UEU A;  3THV A;  1KEJ A;  4DQQ A;  5J2F A;  4J03 A;  4FHY A;  2E3T A;  1ZQC A;  5HRI A;  1PK1 B;  1SZH A;  3KTQ A;  4I2E A;  4DS5 A;  4ED8 A;  4NLN A;  4J9R A;  2ZIW B;  2BHN A;  1N5W A;  3B0Y A;  3RF9 A;  4I28 A;  4X5V A;  1JMS A;  2YB1 A;  4AT9 A;  2DR8 A;  4KLQ A;  4EP7 A;  1NZP A;  2DGZ A;  1QQ6 A;  3H37 A;  4Y2J A;  2F77 X;  4KLL A;  3PW2 A;  4EZ9 A;  5J2A A;  2FPL A;  2D6F C;  4DSI A;  4UB3 A;  4M9N A;  1SIJ A;  1TAM A;  2XVT A;  1ZQO A;  4ELT A;  8ICJ A;  4U6P A;  1UA0 A;  1Z1B A;  1XSL A;  9ICQ A;  3G6X A;  1AQ6 A;  4KB6 A;  2RHF A;  3LVV A;  1RG6 A;  1T94 A;  2HN1 A;  1ZRN A;  1BPB A;  3KOO A;  1L3T A;  5ALK A;  1R89 A;  1O03 A;  1RZT A;  2R8G A;  4DSK A;  4UB1 A;  4TUP A;  5L1K A;  2W9C B;  2AH5 A;  4UAT A;  4ECV A;  5EWE A;  1F44 A;  2BCR A;  5B3Q A;  1KFD A;  1U48 A;  4BXO A;  4Q8E A;  1MC8 A;  1L7M A;  3MFH A;  3OJS A;  1KFT A;  3HJ4 A;  1KNY A;  2XGQ A;  7ICU A;  2KZZ A;  4ECS A;  3I1Y A;  1NKE A;  1X9X A;  5JUM A;  1NK8 A;  4C7Z A;  2XCA A;  3H8W A;  4DFJ A;  5H2F U;  2W9C A;  2H3Q A;  4YR0 A;  3JZ0 A;  1TK0 A;  2KSO A;  4X4R A;  1N63 A;  5KL1 B;  2F44 A;  5BOM A;  4ECX A;  5AI0 A;  4GXI A;  2AQ4 A;  5KFR A;  4IRC A;  4EBJ A;  3AL0 B;  1R8A A;  3RAX A;  5KFB A;  3CK6 A;  1GPJ A;  1S97 A;  3SMV A;  4Q43 A;  3MR6 A;  4O5C A;  2E8N A;  2WF9 A;  2ZTC A;  4NY8 A;  3RRG A;  4A8E A;  3EF2 A;  5KFU A;  4ZOH C;  3ER8 C;  2JH1 A;  4CRX A;  2HVH A;  1KDH A;  4RQ5 A;  4J9K A;  1NK9 A;  5AM0 A;  3AQK A;  7ICL A;  4UB5 A;  3NVV A;  3ED5 A;  2AU0 A;  3CRX A;  2XID A;  2BBH A;  2IOF A;  3WU2 U;  4C4T A;  4CDG A;  3SI8 A;  2BKE A;  4QNL A;  3H8J A;  4YQW A;  3UMB A;  2W9B A;  2KVC A;  5HNK A;  3RJE A;  4OJO A;  5DLF A;  9ICG A;  5KAI U;  2PFN A;  2ZIW A;  2WF7 A;  5B3P A;  5ALI A;  1Q3U A;  5FP0 A;  5KFI A;  4DLG A;  4O3Q A;  3PMN A;  4I2F A;  4O5K A;  4ECR A;  2F8L A;  5DLG A;  3K7D A;  4RUA A;  2KOB A;  1R8B A;  2ZH4 A;  3KHR A;  2JH7 A;  3QU2 A;  2W3R A;  2UVU A;  1A0P A;  2H3F A;  2FMS A;  3L5K A;  3OGU A;  1URJ A;  3K1Z A;  4FS2 A;  3GV5 B;  2P66 A;  3NUQ A;  3RB4 A;  4F5P A;  2BPG A;  3IM1 A;  1XNS A;  3PW0 A;  3OVB A;  4J9O A;  4UAZ A;  1SL2 A;  4DFK A;  4DCC A;  1Z4O A;  4KLE A;  4FHV A;  3D2S A;  2W43 A;  3GV8 B;  3RAQ A;  4PGY A;  7ICG A;  4RQ8 A;  3GDX A;  4X4O A;  3T5J A;  4JV2 A;  4CNQ A;  1X42 A;  4BX9 C;  2IMW P;  1HUO A;  1Q3V A;  1RM6 C;  8ICY A;  2NO5 A;  3O0F A;  4US8 A;  1DOQ A;  5HRH A;  3V7J A;  5J8Y C;  5ALM A;  4KLD A;  2KHQ A;  3ETL A;  5GTI U;  3GV7 B;  2ESE A;  4ELV A;  4BWJ A;  1U49 A;  2B6G A;  4FZN A;  2XY7 A;  1TFR A;  4KLM A;  1QSY A;  2ZXI A;  4PL2 A;  4PZO A;  3N7P D;  1SKR A;  4FZM A;  1RDF A;  2OEH A;  4QWB A;  4QZH A;  5AM5 A;  2ASJ A;  2EH9 A;  1TAQ A;  2YB4 A;  3AQM A;  5D49 A;  3E58 A;  2BZF A;  4NL9 C;  9ICA A;  3C66 A;  4WH5 A;  4EGW A;  2EAM A;  2GAF D;  3JPR A;  8ICL A;  1Z1V A;  5HHH A;  1TK8 A;  1VJ7 A;  1Y88 A;  4UAR A;  4KN4 A;  2ZUC A;  2JZB B;  2IBK A;  4UAY A;  1S76 D;  2N1R A;  2PI4 A;  4PHD A;  5AM3 A;  3RB6 A;  9ICS A;  3M6K A;  2QB1 A;  7ICF A;  5DEC A;  2RP5 A;  4RQ1 A;  3EPG A;  3RH6 A;  2ZH2 A;  4QJF B;  4B9L A;  4DLE A;  3UXN A;  8ICE A;  1BPX A;  2DRB A;  1N62 A;  3NVW A;  5KT6 A;  3RJF A;  2HOI A;  4XA5 A;  5J0Y A;  5J2D A;  1B4F A;  3GIL A;  1COK A;  2KN7 A;  3HP6 A;  2ZH6 A;  5IIN A;  3RJH A;  5D63 A;  3T5L A;  2ZTD A;  1L3U A;  2K4I A;  3ZDC A;  3PY8 A;  5ALY A;  3OVA A;  3HX0 A;  2XY5 A;  2HW3 A;  4YD2 A;  2ZXH A;  5J0R A;  2K4P A;  1YT3 A;  4KLJ A;  1Z4N A;  4IG8 A;  5L1M A;  5ALD A;  2HHQ A;  2FLL A;  2E1F A;  2AGQ A;  1SL0 A;  1ZQK A;  2QAR B;  3GFK B;  2JEF A;  2PMZ C;  3V6K A;  4OAF A;  2ISP A;  4FS1 A;  2R8H A;  3A0B U;  4IQU A;  5KFQ A;  3FYH A;  2EZZ A;  3KHH A;  4F72 A;  2I6X A;  4P4M A;  2F76 X;  4RQ2 A;  4NM2 A;  4RNO A;  4PGX A;  3MFI A;  4C0Z A;  2ASD A;  1UEV A;  2KEY A;  1LKY A;  4C80 A;  4DL6 A;  2QKQ A;  5AKH A;  4JWM A;  5AKK A;  1JN3 A;  4NLB A;  4O3O A;  3T79 A;  2JV3 A;  5DGB A;  3UM9 A;  4OJL A;  4QWD A;  1K1S A;  4KLS A;  2PKE A;  4WOY A;  1ZQI A;  3C23 A;  4K9A A;  4USA A;  1RPL A;  9ICM A;  2KKP A;  3NVO A;  4UQG A;  3IG5 A;  4P0Q B;  5AKE A;  3MC1 A;  3HPO A;  2W9A A;  1IM4 A;  3ONN A;  3LWL A;  1UQV A;  1NI3 A;  3GIK A;  2BDU A;  3AQN A;  1NOM A;  4DFP A;  1MSW D;  4DL2 A;  4QZD A;  4F2S A;  2I5H A;  1RYR A;  2G07 A;  4JLX A;  5DDY A;  4OJP A;  4DOC A;  5AM4 A;  9ICV A;  3N7R C;  3ZDA A;  1WCN A;  2LYA A;  1SXD A;  3M1Y A;  2M2U A;  4RZR A;  2B4V A;  7ICP A;  1SV4 A;  4EZ6 A;  4UAV A;  5ALW A;  4RWQ A;  4MF2 A;  4KLG A;  3MGH A;  2OHF A;  4AP9 A;  1SV0 A;  5IIK A;  3PX6 A;  4M04 A;  2G06 A;  3FM9 A;  3PSI A;  2NRK A;  1OUQ A;  9ICX A;  3RJK A;  1S0N A;  4X4Q A;  3OSN A;  2W7O A;  4FH5 A;  1RYS A;  3WFS C;  5KFJ A;  2WFA A;  3D2N A;  5G5G A;  4JB3 A;  1Q79 A;  5DBB A;  5KFT A;  4P0P A;  4BJQ A;  1JX4 A;  4Y2R A;  4ECZ A;  1ZXI A;  1FIQ A;  4R8U A;  1ZQV A;  4NM1 A;  4WC4 A;  1DK3 A;  3EW9 A;  4DQR A;  5KFS A;  4IC9 A;  4PZN A;  4CF3 A;  1UPH A;  2BBJ A;  4JUZ A;  2GLE A;  3LK9 A;  4M9G A;  3QU4 A;  4ATB B;  5J0T A;  4O3S A;  5AIA A;  3TKA A;  4TUS A;  4IRD A;  1QQ7 A;  3VCB A;  2Y9U A;  2I1Q A;  4E0D A;  1ZQQ A;  4RPX A;  4YMM A;  5GTH U;  5D46 A;  3ISB A;  1PVP A;  2PMZ F;  2XIC A;  3ER9 B;  2JEG A;  4TUQ A;  2HN2 A;  5HHI A;  3TI0 A;  2C28 A;  4UD4 A;  5J2J A;  3BQ1 A;  4RWN A;  2K60 A;  5CJ7 A;  1SL1 A;  3IRU A;  4UAW A;  4KN7 A;  5ALJ A;  3C5F A;  2K8B B;  1KN5 A;  1L7P A;  4QWC A;  4ECU A;  4MEY A;  3TAD A;  4J9N A;  1MIV A;  2KTQ A;  3HW8 A;  4M9L A;  3SAG A;  2ZUD A;  1H38 A;  5HC9 A;  2QAR A;  1WWV A;  5CHE A;  4AYB C;  2UVW A;  2JMG A;  3UMC A;  5DG7 A;  4N7R A;  3OV7 A;  4M5D A;  9ICP A;  1VDV A;  3NRW A;  3NAS A;  3RB3 A;  4RQ3 A;  4WQL A;  1BPD A;  1L3V A;  5EE1 A;  3OSP A;  2EDU A;  5HRK A;  2ZH9 A;  4Y2S A;  4IQW A;  8ICQ A;  1BNO A;  3JPT A;  4KX5 A;  3F5E A;  3TAQ A;  3PHZ A;  1X40 A;  2ZH3 A;  5AI6 A;  1COO A;  2GOL A;  5J0X A;  5AM1 A;  1V4A A;  8ICI A;  3C29 A;  1Q46 A;  4CF5 A;  2W03 A;  5AK3 A;  3SR6 A;  1ZQT A;  1ZD4 A;  3JPN A;  3KHL A; 
#chains in the Genus database with same CATH homology
 1MQ3 A;  5HRB A;  2H5X A;  2XC9 A;  2XCA A;  3H8W A;  4PHA A;  4DFJ A;  3TAR A;  3N4M B;  3GIJ A;  1S77 D;  2W9C A;  4YR0 A;  5KT2 A;  4WC1 A;  2HHU A;  4GC6 A;  3JZ0 A;  1A76 A;  4RQ7 A;  1TK0 A;  1Z00 B;  4RPY A;  4X4R A;  2A1J A;  2DVI A;  2F1I A;  5KG3 A;  4F50 A;  5BOM A;  5D4B A;  4ECX A;  4GXI A;  1L5U A;  2AQ4 A;  5KFR A;  1ZQY A;  4RT3 A;  4B9S A;  4IRC A;  4EBJ A;  1R8A A;  3RAX A;  3ISC A;  3C1Y A;  5KFB A;  4QWA A;  3V72 A;  1T8E A;  5J2H A;  2JZB A;  2NRV A;  2ZUB A;  3H3A A;  1ZQP A;  5CWR A;  1S97 A;  2PFO A;  1XSP A;  5J2C A;  4Q43 A;  4RNN A;  3MR6 A;  4ED7 A;  1NKB A;  5J0Q A;  4O5C A;  1CEZ A;  9ICE A;  3PVX A;  5KFF A;  3LDA A;  4DL3 A;  1WOT A;  4NY8 A;  2ZTC A;  1Z00 A;  4I2I A;  2BPF A;  1S0V A;  3RRG A;  5DB7 A;  5KFU A;  4IRK A;  1XC9 A;  2O1P A;  4MFA A;  2ZJ8 A;  2BQU A;  3QE9 Y;  8ICV A;  4KIT B;  3MDA A;  3UQ0 A;  3PV8 A;  2HVH A;  1A77 A;  2M9N A;  3HWT A;  2ALZ A;  1KDH A;  2ZHA A;  3AU2 A;  3V6H A;  4YD1 A;  4RQ5 A;  4J9K A;  3PO4 A;  3GII A;  1NK9 A;  4RU9 A;  3AQK A;  7ICL A;  3WFR E;  1BPE A;  1ZQU A;  3C1Z A;  4RUC A;  1VFG A;  4UB5 A;  2C2E A;  5KFV A;  1KFS A;  2NRX A;  4O5E A;  5DBC A;  1Q78 A;  5J0S A;  3H40 A;  2AU0 A;  4F4K A;  8ICM A;  2VAN A;  9ICN A;  4M2Y A;  3PNC A;  2VA2 A;  3BDP A;  4LZD A;  2BKE A;  3SI8 A;  3H8J A;  4YQW A;  2DRA A;  2W9B A;  5HNK A;  4F8R A;  1ZQX A;  1XO1 A;  1XWL A;  3RJE A;  9ICG A;  5DLF A;  4AT7 B;  3V6J A;  3RB0 A;  2PFN A;  3TFS A;  3PW5 A;  3WFO A;  3MGI A;  2BCV A;  4PH5 A;  4QZ8 A;  2Y1I A;  1NO5 A;  4YR3 A;  2XO7 A;  4MFF A;  5HR9 A;  1NJZ A;  1OU5 A;  2V9W A;  1TAU A;  4C8N A;  9ICU A;  5KFI A;  3NGD A;  4DLG A;  5KG0 A;  4I2A A;  4XQ8 A;  2HHV A;  4O3Q A;  3PMN A;  2BQR A;  4F3O A;  4I2F A;  4ECR A;  2BCS A;  4O5K A;  5HMM A;  5C5J A;  4QZB A;  1ZQJ A;  7ICH A;  5DLG A;  2DPJ A;  3H8S A;  5BOL A;  1C7Y A;  8ICF A;  8ICX A;  4RUA A;  4RWP A;  1R8B A;  2BE3 A;  9ICW A;  2ZH4 A;  3WFQ E;  2KFZ A;  4G3I A;  4NLG A;  3MBY A;  3RJJ A;  4I27 A;  3KHR A;  4K4G A;  8ICH A;  4ELU A;  8ICN A;  3TAN A;  3ZDB A;  3OUY B;  1X2I A;  2KZ3 A;  4ED3 A;  2UVU A;  7ICN A;  2M2T A;  3BJY A;  3HIY A;  4IQT A;  4QZI A;  2FMS A;  1BGX T;  3OGU A;  2FPM A;  3SV4 A;  1ZQL A;  4FS2 A;  3GV5 B;  2BCU A;  2P66 A;  3RB4 A;  3BQ2 A;  4I2G A;  2MAX A;  4F5P A;  4F4X A;  3IM1 A;  2RDJ A;  2BPG A;  2ISO A;  1PX5 A;  2Q66 A;  3PW0 A;  3OVB A;  5CP2 A;  4J9O A;  5DB8 A;  4UAZ A;  1SL2 A;  8ICJ A;  2ZH8 A;  4DFK A;  1TFW A;  3EZ5 A;  4KLE A;  4FHV A;  1K1Q A;  1U4B A;  1MIW A;  2A1J B;  4O3P A;  3PX4 A;  1JIH A;  3RJI A;  2R8K A;  4R63 A;  8ICS A;  4MEX A;  2KP7 A;  3K75 D;  3GV8 B;  4YG2 A;  4PGY A;  3RAQ A;  7ICG A;  1D8L A;  5DQH A;  4RQ8 A;  3GDX A;  1D9F A;  1BNP A;  4X4O A;  3ORY A;  2P6U A;  3T5J A;  2JEI A;  5DDM A;  3OHB A;  2W8K A;  4DEZ A;  1IXR A;  4JV2 A;  5L1L A;  4NKU A;  3MAB A;  2IMW P;  4HYK A;  3H4B A;  2C2D A;  1HUO A;  1T4G A;  8ICY A;  5KFK A;  3MR3 A;  1ZQE A;  1UET A;  5EOZ A;  1ZJN A;  1DOQ A;  4WC7 A;  4M47 A;  3PW4 A;  5HRH A;  4AT9 B;  3V7J A;  5HP4 A;  5J2K A;  3LQC B;  4KLD A;  3LWM A;  4RWN A;  9ICR A;  3ETL A;  4EYI B;  3GV7 B;  1JXE A;  4EBC A;  3BQ0 A;  1D8Y A;  2J6U A;  4ELV A;  3H7I A;  4DQS A;  4BWJ A;  1ZQW A;  1U49 A;  5HRF A;  2RFF A;  1KLN A;  5KG6 A;  4F93 B;  4UB2 A;  1NK7 A;  2HHS A;  2C22 A;  2XY7 A;  4QZE A;  9ICJ A;  4X4T A;  1TFR A;  2W9M A;  4DOB A;  4KLM A;  1QSY A;  4EBE A;  3C2K A;  1ZQM A;  4K4H A;  7ICJ A;  5DG9 A;  3AU6 A;  4IQV A;  1SKR A;  2GWS A;  3T3F A;  3Q8S B;  1MIY A;  5IIM A;  2FMP A;  3UQ2 A;  4QW9 A;  4QWB A;  4QZH A;  1U47 A;  3PR4 A;  5KFE A;  2ASJ A;  3PML A;  3QZ7 A;  1TAQ A;  4TQS A;  3AQM A;  5D49 A;  9ICA A;  5HRG A;  5J0U A;  3T5K A;  3Q8K A;  4KLO A;  3H38 A;  4EYH B;  3C66 A;  4M9J A;  2OWO A;  4RPZ A;  4YXJ A;  5DQG A;  5EWG A;  1ZQA A;  3JPR A;  8ICL A;  1ARO P;  5HHH A;  3SZ2 A;  1U45 A;  3OHA A;  1TK8 A;  1VJ7 A;  1Y88 A;  5IIO A;  4E80 A;  3JYY A;  4NLK A;  4KN4 A;  3Q8R B;  2XCP A;  2V4Q A;  8ICB A;  4R66 A;  2MUT B;  3JPS A;  3AUO A;  2XGP A;  4DL4 A;  2IA6 A;  2ZUC A;  2JZB B;  4KLH A;  2IBK A;  4UAY A;  2JEJ A;  4WC6 A;  3JPP A;  2M2V A;  2BPC A;  1S76 D;  3KHG A;  5HRE A;  2PI4 A;  4PHD A;  3H4D A;  4J9M A;  3SYZ A;  1ZQR A;  4PHE A;  4YP3 A;  3N97 B;  3RB6 A;  4X4S A;  7ICK A;  2ZH7 A;  3ISD A;  2PXI A;  9ICS A;  5DEC A;  1N56 A;  7ICF A;  4RT2 A;  5HRD A;  4KLU A;  5DB6 A;  4RQ1 A;  1BPZ A;  3EPG A;  3RH6 A;  2ZH2 A;  4RNM A;  1JXL A;  4DO9 A;  1X9M A;  3L9D A;  2R8I A;  4RWO A;  2BR0 A;  4F4Z A;  4DLE A;  2UVR A;  3RR7 A;  1ZQH A;  1SKW A;  3UXN A;  5KFM A;  4B9L A;  4UD5 A;  1BPY A;  1BPX A;  8ICE A;  5CA7 A;  4I2B A;  2ZH5 A;  2DRB A;  8ICW A;  3C18 A;  5IIL A;  4EBK A;  3Q8Q B;  7ICT A;  9ICT A;  5KT6 A;  3RJF A;  1XU4 A;  4XQ7 A;  2ZH1 A;  4X0B A;  2DR7 A;  4YCX A;  4XA5 A;  3IHQ B;  4PHP A;  3Q8L A;  4YVZ A;  3UXO A;  4QZG A;  5J0Y A;  4B9U A;  1JAJ A;  5J2D A;  3GIL A;  4X4N A;  2KN7 A;  3HP6 A;  2IHM A;  2ZH6 A;  2FPK A;  5IIN A;  4Q45 A;  3QEB Z;  3RJH A;  4ATB A;  4ED1 A;  1S9F A;  1QSS A;  2F1J A;  2ZTD A;  3ZD8 A;  4YFK A;  3T5L A;  1L3U A;  3ZDC A;  4NLZ A;  4X4U A;  3PY8 A;  4I2J A;  3OVA A;  4QZ9 A;  3HX0 A;  3PW7 A;  3M8S A;  2XY5 A;  2HW3 A;  4WC2 A;  4ECT A;  4AT8 B;  4YD2 A;  2AJQ A;  5J0R A;  7ICS A;  4DFM A;  8ICU A;  4ECY A;  4O3N A;  4YN4 A;  4DL7 A;  4Z6F A;  2HHX A;  4AT8 A;  4KLJ A;  2ZJA A;  2FLP A;  4LZG A;  1Z3E B;  3RBE A;  4IG8 A;  4PGQ A;  1KRP A;  2HVI A;  4JV1 A;  2HHQ A;  2FLL A;  4Z6C A;  4ED2 A;  2AGQ A;  1TKD A;  4K4I A;  1JQR A;  4KLT A;  5DBA A;  1SL0 A;  1YLQ A;  1ZQK A;  4IR1 A;  2Y1J A;  4CCH A;  4RQ4 A;  1NJW A;  1RXW A;  3GFK B;  2JEF A;  5J0O A;  2LYH A;  2W9B B;  3UPQ A;  3V6K A;  2ISP A;  4FS1 A;  3MDC A;  2R8H A;  3RR8 A;  3G6Y A;  4DSJ A;  5J0W A;  1NK5 A;  4IQU A;  5KFQ A;  3FYH A;  4E7X A;  5F9N A;  5KFH A;  5KFD A;  3KHH A;  3T5H A;  2DR9 A;  4P4M A;  5EWF A;  3M9N B;  3M8R A;  4KMU A;  1X9W A;  4FHP A;  3B0X A;  4RQ2 A;  4NM2 A;  4RNO A;  4PGX A;  4GLX A;  3NYB A;  3MFI A;  1NJX A;  4FHX A;  1HJP A;  3PO5 A;  4LT6 A;  1UEV A;  2ASD A;  5J2E A;  3OVS A;  7ICQ A;  1UT5 A;  2NRZ A;  3M9M B;  5HML A;  4F4Y A;  2DFL A;  3RH5 A;  1TV9 A;  2B21 A;  8ICP A;  4ZH4 A;  1HUZ A;  5KG5 A;  4I29 A;  4MFC A;  4DL6 A;  5L1I A;  2XY6 A;  2ATL A;  4C8L A;  4C8K A;  5KG1 A;  7ICM A;  2M2W A;  4EEY A;  2DR5 A;  1TFY A;  4JWM A;  4B9N A;  3ZDD A;  1JN3 A;  4AT7 A;  5KFO A;  3PX0 A;  3UXP A;  2I9G A;  5DKW A;  4O3O A;  2ASL A;  9ICB A;  4QZC A;  3QEA Z;  4B9M A;  5DGB A;  3WFP A;  4F5N A;  4WC5 A;  4R64 A;  4M9H A;  4BWM A;  5KFL A;  2NRT A;  3PR5 B;  4BDP A;  7ICR A;  5F2V O;  4F5R A;  4IR9 A;  4ELT A;  4DF4 A;  4KLF A;  4QWD A;  1K1S A;  2BGW A;  4KLS A;  5III A;  5DB9 A;  2W8L A;  4Z6D A;  2C2R A;  2BCQ A;  2FMQ A;  5KG7 A;  1ZQI A;  3C23 A;  2BQ3 A;  4DQP A;  2Q0Z X;  2PBE A;  1RPL A;  9ICM A;  1SZP A;  3AQL A;  5HRL A;  3C2L A;  1MQ2 A;  2FLN A;  4GXK A;  1L3S A;  5KG2 A;  4UQG A;  8ICO A;  4TUR A;  5KT3 A;  1XS9 D;  1TVA A;  4ECQ A;  4B9T A;  2ZHB A;  4J9P A;  1S0O A;  3HPO A;  4ECW A;  4QZF A;  2V4R A;  1IM4 A;  4BGD A;  2W9A A;  5J2I A;  5KT5 A;  4DL5 A;  3LWL A;  8ICK A;  3OJU A;  8ICT A;  4RQ0 A;  4DOA A;  8ICC A;  2HHP A;  2AGO A;  3Q8P B;  4JK1 A;  9ICL A;  4FH3 A;  4F91 B;  3GIK A;  1ZQZ A;  5KFA A;  1NOM A;  4DFP A;  1NJY A;  1MSW D;  3AQN A;  5DED A;  4DL2 A;  4QZA A;  4QZD A;  3HT3 A;  1D9D A;  4Q8F A;  4X0A A;  4XUS A;  4F2S A;  4DWI A;  3GIM A;  4P4O A;  7ICI A;  1DK2 A;  8ICZ A;  4UBB A;  1RYR A;  5DDY A;  5L1J A;  4DOC A;  1N48 A;  1X9S A;  2J6S A;  9ICV A;  4J9Q A;  5KTQ A;  1XSN A;  3ZD9 A;  3ZDA A;  1WCN A;  1T3N A;  1ZQB A;  4UB4 A;  4XRH A;  3G6V A;  4RZR A;  4F5Q A;  2M2U A;  7ICP A;  5J2G A;  5CB1 A;  4EZ6 A;  4I2D A;  4O3R A;  3SV3 A;  1UT8 A;  4LVS A;  4RWQ A;  8ICA A;  4C8O A;  4PPX A;  1DGS A;  4FBU A;  3C21 A;  4MF2 A;  4KLG A;  3MGH A;  1R8C A;  5TZV A;  2PFP A;  3MR2 A;  3RRH A;  5J2B A;  1SKS A;  2J6T A;  1NK0 A;  1NKC A;  5IIK A;  3PX6 A;  4YMN A;  2RDI A;  4M04 A;  2VA3 A;  4J9L A;  4GC7 A;  1QTM A;  2O5A A;  5CR0 A;  2MUT A;  4F2R A;  2NRW A;  3HJ1 A;  2AQ0 A;  3RTV A;  1CUK A;  3TFR A;  2PI5 A;  2NRK A;  3V7K A;  5J0P A;  4F5O A;  4YXM A;  5KT4 A;  9ICX A;  2KZM A;  3RJK A;  1S0N A;  4R65 A;  3JPO A;  4X4Q A;  3OSN A;  4DS4 A;  3RBD A;  4M0A A;  3C5G A;  4FH5 A;  1NK6 A;  1RYS A;  4NKT A;  5KFJ A;  1T7P A;  1QLN A;  1NK4 A;  4BXO B;  3WFS C;  5F9L A;  5KG4 A;  2PFQ A;  2P6R A;  9ICI A;  9ICO A;  4WBZ A;  4WC3 A;  1ZET A;  5KFC A;  1S10 A;  4B9V A;  2HHT A;  1Q79 A;  5DBB A;  2C28 A;  4UD4 A;  4C8M A;  1QSL A;  4YR2 A;  5KFT A;  1UEU A;  4UBC A;  3THV A;  1KEJ A;  1JX4 A;  4DQQ A;  1ZQF A;  5KT7 A;  5J2F A;  3MR5 A;  5DQI A;  4ECZ A;  4S3N A;  4R8U A;  4FHY A;  1PZN A;  1ZQV A;  4NM1 A;  1ZQC A;  5HRI A;  4WC4 A;  3EW9 A;  4TQR A;  4DQR A;  3KTQ A;  1DK3 A;  5KFS A;  4ED6 A;  4I2E A;  4DS5 A;  4ED8 A;  4NLN A;  3K4G A;  3QZ8 A;  1WCL A;  4J9R A;  2BHN A;  3B0Y A;  4Q44 A;  2ZTE A;  4JUZ A;  1V9P A;  3LK9 A;  4I28 A;  4X5V A;  2BDP A;  4M9G A;  1B22 A;  5KFP A;  1JMS A;  4ATB B;  5J0T A;  1LV5 A;  4O3S A;  5J29 A;  4AT9 A;  4JWN A;  4TUS A;  1LB2 B;  1F5A A;  4IRD A;  2DR8 A;  4KLQ A;  4EP7 A;  2VA8 A;  4FBT A;  1NZP A;  2I1Q A;  1ZQN A;  4NXZ A;  3H37 A;  9ICH A;  4E0D A;  1ZQQ A;  4RPX A;  1KSP A;  3PW2 A;  4KLL A;  5KFX A;  2KFN A;  4EZ9 A;  4YMM A;  3ISB A;  5D46 A;  5J2A A;  3TAP A;  4KLI A;  2FPL A;  1EXN A;  4X4V A;  5DGA A;  4WC0 A;  4FHW A;  4DSI A;  4UB3 A;  3E2E A;  1ZQO A;  2JEG A;  4KTQ A;  1ZQS A;  4M9N A;  4WBY A;  4J9S A;  1KTQ A;  3EYZ A;  4TUQ A;  1ZQG A;  3GQC A;  4RQ6 A;  4FO6 A;  4JV0 A;  5HHI A;  3TI0 A;  4R8U B;  2F1H A;  1BVS A;  5J2J A;  3M9O B;  3BQ1 A;  4DSF A;  5CJ7 A;  4ED0 A;  3RH4 A;  8ICR A;  1SL1 A;  7ICV A;  4UAW A;  9ICK A;  1UA0 A;  3TQ1 A;  5L9X A;  4KN7 A;  3C5F A;  1XSL A;  2ID1 A;  9ICQ A;  4QWC A;  4E8F A;  3EPI A;  5KFZ A;  3G6X A;  4ECU A;  4MEY A;  4J9N A;  1MIV A;  4I2C A;  5CHG A;  5IIJ A;  4Z6E A;  3V7L A;  2AGP A;  4WCW A;  9ICC A;  3EWA A;  1U9L A;  4DSE A;  1UA1 A;  1B43 A;  2ZJ5 A;  2R8J A;  2KTQ A;  4QW8 A;  4F4W A;  4I2H A;  4O0I A;  3HW8 A;  4M9L A;  1RXV A;  1BPB A;  4MF8 A;  8ICG A;  2ZUD A;  3OUY A;  3BQT A;  1H38 A;  5HC9 A;  1L3T A;  1R89 A;  2HHW A;  4M6W A;  1FA0 A;  4DSL A;  1RZT A;  1ZYQ A;  2UVW A;  5KFN A;  3OV7 A;  5DG7 A;  4F92 B;  2R8G A;  5KFG A;  4DSK A;  4UB1 A;  4TUP A;  4M5D A;  9ICP A;  5L1K A;  2W9C B;  3FDS A;  3ZDE A;  3RB3 A;  9ICF A;  4RQ3 A;  4ECV A;  3RJG A;  4EBD A;  1BPD A;  5EWE A;  3OSP A;  1L3V A;  2BCR A;  4O9M A;  5HRK A;  2ZH9 A;  1TK5 A;  2WTF A;  4IQW A;  8ICQ A;  1BNO A;  3JPT A;  4QWE A;  2UVV A;  7ICE A;  1KFD A;  4M6W B;  3NTU A;  5DG8 A;  3C2M A;  1U48 A;  4BXO A;  3TAQ A;  7ICO A;  4Q8E A;  1MC8 A;  3JPQ A;  4P4P A;  3MFH A;  3H39 A;  2ZH3 A;  3OJS A;  1KFT A;  3HJ4 A;  4DQI A;  1COO A;  2IHN A;  5J0X A;  1S0M A;  1KNY A;  5KFW A;  2XGQ A;  8ICI A;  5BPC A;  7ICU A;  5KFY A;  1V4A A;  2KZZ A;  1ZQD A;  3UPS A;  4P2H A;  4DF8 A;  4X4P A;  3Q8M A;  1ZQT A;  4ECS A;  2DPI A;  4GXJ A;  1NKE A;  3JPN A;  3KHL A;  4YMO A;  5JUM A;  1NK8 A;  1ZJM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...