4F5QA

Closed ternary complex of r283k dna polymerase beta
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
326
structure length
320
Chain Sequence
TLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMKAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title Structures of dNTP Intermediate States during DNA Polymerase Active Site Assembly.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase, lyase/dna
total genus 105
structure length 320
sequence length 326
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4f5qA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4f5qA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4f5qA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4f5qA03
5J2GA 4I27A 4RT2A 4XQ8A 1NZPA 4O3PA 1JXEA 5KFUA 1RYSA 4M9GA 1D8YA 7ICEA 8ICQA 1TK0A 4I2EA 3AQLA 1KFDA 5J0OA 1QSYA 3GFKB 9ICUA 8ICZA 4DLEA 4YCXA 1ZQTA 1ZQVA 2V9WA 3ORYA 4M0AA 7ICFA 3JZ0A 3RRGA 2HW3A 8ICLA 2ZH2A 4F5OA 2KFZA 4KLQA 2R8GA 4Q8EA 3OSPA 1BPBA 4RPYA 1KLNA 2FLPA 1U48A 1CUKA 4TQSA 3HT3A 9ICPA 1ZETA 5DB8A 4RQ6A 3GV8B 3BJYA 5KFEA 4C8NA 4DSFA 4P2HA 7ICUA 4RWPA 2Q66A 4WC2A 2ZH9A 4UAYA 4MF8A 2PFNA 4KLDA 1Y88A 1ZJNA 3RBEA 3PW0A 1RXVA 7ICNA 5HRBA 4LT6A 2W9CA 1ZQZA 4DQQA 2XCPA 3MR5A 3RB0A 1L3UA 5KFAA 3V7JA 1MQ2A 1COOA 3MDCA 3H8SA 1U45A 3TAPA 1XS9D 4DSIA 4E80A 3OSNA 1ZQYA 2NRVA 4YMOA 4M9JA 1N48A 4F91B 4F50A 4ELUA 1KFTA 5DB6A 8ICRA 9ICLA 2ID1A 4M9NA 4PPXA 3OUYB 4J9LA 4I2IA 1N56A 7ICSA 4YN4A 4YVZA 4X4QA 4X4SA 5F9NA 1ZQIA 4X4NA 2AGPA 2BKEA 3C1ZA 2JEFA 4KLUA 1BPXA 2XCAA 4WC7A 2AGOA 4DFMA 3HW8A 2IHMA 3RJKA 3PW7A 7ICPA 3OJUA 5KG5A 1S0OA 2ZHAA 4YR3A 1HJPA 8ICAA 1X9WA 5HR9A 3C5FA 5BOLA 4ZH4A 5KTQA 1ZQRA 3RJGA 4NKUA 1JAJA 1KEJA 4XUSA 2O5AA 4YXMA 1EXNA 4JWMA 2KP7A 1OU5A 4RWQA 5JUMA 4J9RA 5KFPA 2ZH3A 5KG2A 4M5DA 1Z00B 1NKCA 9ICOA 4WBZA 3N4MB 3OV7A 4QWAA 5C5JA 4KN7A 4DFKA 4QZAA 2FLLA 1BPDA 2ATLA 5KFNA 4R64A 1UA0A 3TANA 4JWNA 4RU9A 4K4HA 4DFJA 4P4OA 2PFPA 4ATBA 4I2AA 1X9MA 1U49A 1ZQFA 1F5AA 4YXJA 1X9SA 3AQNA 4F4YA 1BPYA 3E2EA 2A1JB 1S77D 3RJJA 3KHGA 1NK0A 1XWLA 8ICPA 2H5XA 2ZJ8A 2BCQA 4NM1A 3V6HA 2UVVA 2HHWA 9ICBA 8ICUA 2HVIA 4RPZA 2XGPA 3LQCB 5DG9A 4DQSA 1JMSA 5IILA 2C2RA 3ETLA 1ZJMA 3PMNA 1QSSA 4NLZA 2R8HA 4PGQA 2BGWA 4KLOA 2M2VA 1UEUA 2DR8A 1V9PA 5DEDA 1XU4A 4XA5A 8ICWA 7ICIA 4Q45A 3JPSA 4I2CA 4R8UA 4MF2A 4YMMA 1A76A 4DF4A 4YR0A 5J0TA 4M9HA 4UB3A 4DEZA 4F4WA 9ICWA 5HRKA 4J9NA 1SZPA 4J9SA 2ZTDA 1S76D 3RBDA 3G6XA 5DB9A 2WTFA 1QSLA 4BWMA 4AT7B 1NK9A 2ZH4A 5DGBA 3SYZA 3GIKA 5D46A 1CEZA 5HRDA 4BXOB 2ZH7A 4F5NA 4GC7A 5HRGA 5J2BA 4UAWA 5IIKA 3Q8QB 4FO6A 2PFOA 4BWJA 2F1HA 2XO7A 4ELTA 5DQHA 3MGIA 5KFHA 4I2BA 1UT8A 3PR4A 3JPPA 3PO5A 2KZMA 1KSPA 3QEAZ 4MEXA 4WC0A 4BGDA 9ICMA 4G3IA 3EWAA 4MFCA 3HWTA 8ICOA 4EP7A 1B43A 4JV0A 4TUPA 1XC9A 2Y1JA 5TZVA 1S97A 1ZQMA 1BPZA 4NLKA 7ICOA 5L1JA 2FMSA 3AU2A 3NGDA 5J0XA 4ECYA 3H4BA 4UD5A 2NRTA 5KFVA 2ASJA 9ICKA 3ZDCA 7ICRA 4KLEA 3H39A 3ZD9A 5HRHA 3UQ0A 2W9BA 1ZQUA 3PX4A 4O3QA 4YP3A 5DECA 5DBAA 5DQGA 3BQ2A 3T5LA 4F8RA 2HHQA 1RYRA 4DO9A 3OHBA 1D8LA 4TUQA 3UPQA 3TARA 4X5VA 2DR9A 1ZQJA 4AT8A 5CR0A 4QZHA 4CCHA 8ICGA 4Z6CA 4IQWA 1L3SA 5KFBA 1Z3EB 3T5HA 4F4ZA 3OVSA 4O3NA 4UB1A 1ZQKA 4IR1A 4O5KA 9ICQA 4QZ9A 4Q44A 3PNCA 2KZZA 4WBYA 1XSNA 4IR9A 4LZGA 4ED7A 4FHWA 3RH4A 3QZ8A 4I2JA 5EWEA 5HMLA 2BQRA 5L1LA 2J6SA 2BCSA 3ZD8A 1S9FA 2UVUA 4M9LA 2JZBB 5DB7A 4EBDA 3GV5B 3V6KA 2HHUA 7ICVA 9ICAA 2GWSA 3WFSC 1DOQA 4QWCA 4FHYA 4FS1A 3RB3A 3BQTA 4KLLA 4EZ9A 3MFHA 1Q79A 3G6YA 1DK3A 2BPGA 4TURA 1XSPA 4PHEA 5IIJA 4DF8A 9ICNA 4M47A 2KZ3A 4Z6EA 4GXIA 7ICHA 2F1JA 4UAZA 2XC9A 4GXJA 4RWOA 4RNNA 5IIMA 2NRWA 8ICCA 1SL0A 1U9LA 2J6TA 4UQGA 3UQ2A 1C7YA 1DK2A 8ICEA 3WFPA 2C2DA 4JK1A 4IRKA 3RB4A 1TAUA 2ZTCA 3T5JA 4ECSA 1SL1A 1HUZA 1R89A 3B0XA 5DBBA 4X4PA 2I1QA 4F4XA 3M9MB 4QWBA 3MR6A 7ICGA 1VJ7A 4RQ1A 5CP2A 4IQVA 7ICKA 4WCWA 3C66A 1UETA 3PR5B 4B9UA 5HP4A 2M2TA 5J2FA 3UPSA 4KN4A 4I28A 4TQRA 5KFGA 1WCLA 8ICNA 1JQRA 4WC4A 3TFRA 2BHNA 1FA0A 4NXZA 2BDPA 2PFQA 5KFJA 4UD4A 4K4GA 3H37A 2HHVA 5DG8A 4EZ6A 5KG6A 3GQCA 1TVAA 5L9XA 5J2JA 5CB1A 4O9MA 5KT2A 4F5QA 4X0BA 2AGQA 1H38A 4O5EA 3ISCA 5J0WA 1NK5A 5KG3A 1JIHA 5KFOA 4ELVA 3MABA 9ICGA 2M2WA 3OVAA 4RT3A 3V6JA 3RTVA 1SKRA 9ICHA 2KFNA 4B9VA 1MIWA 4X4OA 1ZQAA 7ICQA 1B22A 2BCRA 4P4PA 3MR2A 7ICLA 9ICVA 1MIVA 5HHIA 3C18A 3Q8KA 4NLGA 2XY7A 4Q8FA 3H3AA 4E0DA 3EPGA 1ZQWA 2FPMA 3BQ0A 1A77A 2BCVA 4AT9B 3HPOA 3OVBA 4RUAA 3V7LA 2VA3A 4JV2A 3LK9A 1ZQGA 2MUTB 3AQKA 5KFIA 4MFFA 1LB2B 1RPLA 4MFAA 2NRKA 5KFXA 3NYBA 1S10A 4WC1A 2HVHA 1KFSA 4DL2A 3PX0A 4QZFA 4EBCA 2DRAA 5J2CA 5KG4A 1TFWA 5KFSA 2W8LA 5DLGA 4XRHA 1Z00A 4ECVA 3THVA 2R8KA 4F4KA 3PV8A 5KT7A 1MIYA 5KT5A 2DPIA 5KFQA 3MBYA 3UXPA 4F5PA 2ISOA 4DSJA 4RPXA 3C2KA 2LYHA 2Y1IA 4F5RA 4J9QA 2ZH6A 5J0SA 4DFPA 2PI4A 2W9MA 1V4AA 5DQIA 3FDSA 1RZTA 1SKSA 2A1JA 5DDMA 1TV9A 4O0IA 4F2RA 1BNOA 1T4GA 8ICKA 1PZNA 5J0UA 4UB2A 3EW9A 3AQMA 2AQ0A 3K75D 1UT5A 3RR8A 3M9NB 3EYZA 3GIMA 3C2LA 4JV1A 8ICIA 5KFMA 1NOMA 4YQWA 2W9AA 3Q8PB 1IXRA 3QZ7A 4ECWA 9ICJA 1R8AA 3HJ4A 2KN7A 3GDXA 3ZDDA 4I2FA 4FHXA 4HYKA 1S0NA 2M9NA 2XY6A 4FHPA 4WC3A 1Q78A 3JPTA 1X2IA 1NJYA 1SL2A 3LDAA 4P4MA 4DL4A 1U4BA 3LWMA 3BDPA 5J2IA 3ISBA 2VANA 2ZTEA 4KLFA 1SKWA 3TAQA 4FHVA 4X4UA 5HMMA 2BR0A 5J2HA 2DFLA 2ASLA 2DPJA 1R8BA 4FH3A 2NRZA 5HNKA 3JPQA 2JEJA 4XQ7A 3V7KA 4AT7A 1ZQHA 2AQ4A 2RDIA 1NJXA 2I9GA 4KLIA 4RNMA 4F93B 1WOTA 1VFGA 4J9MA 4DQIA 3H8JA 3Q8SB 4IQUA 3RAXA 4BXOA 2AJQA 4EBJA 1R8CA 7ICJA 4DS4A 3RR7A 4I29A 2ZH8A 3LWLA 1JXLA 3ZDEA 4DS5A 2ALZA 1NKBA 4X0AA 1QLNA 1TFRA 2F1IA 1RXWA 2IBKA 2Q0ZX 4ECQA 5KT4A 2FMQA 4RQ0A 4ECTA 3PW2A 7ICTA 3RB6A 3RH5A 1BNPA 2OWOA 2ZH5A 1TFYA 4UBBA 1TK5A 5BOMA 8ICJA 4PGXA 3GILA 4NKTA 4RQ2A 2W8KA 3MFIA 8ICTA 4IQTA 4ED0A 2ZH1A 2VA2A 3QEBZ 1ZQLA 5HHHA 5KFWA 2AU0A 4M2YA 1XSLA 2IMWP 4M6WA 4PHPA 4GXKA 3PO4A 1K1SA 2P6RA 4DWIA 4EEYA 4KLHA 4DOBA 1KNYA 4QZBA 2BQUA 4O3SA 1NK8A 4MEYA 3JPOA 2PXIA 4KLJA 4X4VA 2FPLA 4QZ8A 2J6UA 4KLMA 5DBCA 5J2AA 4YFKA 8ICXA 2MAXA 4FBTA 2W9CB 4EYHB 3ZDAA 5HREA 2DR7A 4YD1A 4QZIA 5J29A 4M04A 4TUSA 3EZ5A 1QTMA 3RJIA 4O3OA 5KFCA 5IIIA 9ICIA 4O5CA 4X4TA 1NJWA 4RQ7A 3TI0A 3RJFA 4X4RA 4Z6FA 3GIIA 4ED6A 4E7XA 3HX0A 3Q8LA 3T5KA 2HHTA 4I2DA 1KDHA 3HP6A 2V4QA 3HIYA 3HJ1A 3TFSA 4ECXA 4UB4A 3NTUA 8ICYA 2BPFA 5F2VO 4QZDA 1NKEA 2JZBA 5KFLA 2C22A 1ZQDA 3KTQA 2VA8A 1AROP 4DL3A 3M8SA 1D9DA 3RJEA 4QZEA 2JEIA 3OJSA 4RQ3A 3N97B 4R63A 9ICEA 9ICXA 5EOZA 9ICTA 1IM4A 2BPCA 1D9FA 4FH5A 3QE9Y 4S3NA 5KFZA 3SV4A 3M9OB 2R8IA 4QZGA 4DOCA 2FMPA 4F2SA 3MDAA 8ICMA 2ZUCA 3C23A 1NK7A 5J2KA 9ICFA 4E8FA 3SV3A 4LVSA 1BGXT 4DL5A 3WFOA 5KG0A 2UVWA 4DL6A 4DL7A 5KFYA 4PHAA 5KG7A 4YMNA 3Q8MA 1U47A 4NY8A 4Q43A 4DOAA 3WFRE 1BPEA 5KFRA 3M8RA 4QZCA 8ICFA 4IG8A 9ICRA 5J2DA 1BVSA 5CHGA 2DRBA 4B9NA 3OUYA 4R66A 3PX6A 3JYYA 5KG1A 2C2EA 2ZJ5A 4PH5A 3KHLA 4B9TA 1S0MA 2PBEA 4RQ5A 5IINA 3L9DA 2HHXA 5HRLA 5DKWA 4GLXA 2XY5A 5HRFA 4YD2A 4ATBB 4ED3A 3AUOA 3TQ1A 2C28A 3SZ2A 1T3NA 4C8MA 5DGAA 1L5UA 1ZQCA 1S0VA 3GIJA 4QW9A 4PHDA 2P66A 4KLTA 3ISDA 4QW8A 4Z6DA 4UBCA 4R65A 3RH6A 1T7PA 4NLNA 3KHRA 5DG7A 3SI8A 1UEVA 4KMUA 2BQ3A 4NM2A 5KT6A 3BQ1A 4DSKA 3UXOA 5KFTA 5IIOA 3OHAA 4PGYA 4B9LA 4DSLA 2IHNA 4ED8A 4ECRA 8ICSA 4QWDA 4YR2A 3MR3A 1HUOA 4RUCA 1ZQSA 4C8LA 2ZUBA 5DLFA 3V72A 3EPIA 1ZQPA 1KRPA 4KITB 3PMLA 4ED2A 1MC8A 1TKDA 1ZQBA 4R8UB 4J9KA 4O3RA 3GV7B 1ZQNA 4DLGA 5L1IA 7ICMA 3H38A 4RWNA 2XGQA 3PY8A 2M2UA 4AT9A 4WC6A 4C8OA 5KFDA 4QWEA 4KLSA 1UA1A 4DQPA 3KHHA 2MUTA 3RRHA 5J0YA 4EYIB 5J0PA 5CWRA 4IRDA 4YG2A 1ZQOA 3IM1A 4EBKA 4UB5A 3T3FA 1KTQA 3PW4A 4GC6A 1TK8A 4I2HA 1NO5A 2B21A 2IA6A 4BDPA 8ICHA 1NJZA 1DGSA 5BPCA 4RZRA 3JPNA 3H40A 4ED1A 2ASDA 2BCUA 4I2GA 4J9OA 4F92B 3ZDBA 2V4RA 1NK6A 1L3TA 1ZQQA 2DR5A 2P6UA 5J0QA 5D49A 4FS2A 5DDYA 2R8JA 4C8KA 1K1QA 3H4DA 3C5GA 2ZUDA 3IHQB 5D4BA 2FLNA 2RDJA 3WFQE 5KFKA 8ICVA 1MSWD 5F9LA 2ISPA 2HHSA 5EWGA 1L3VA 3K4GA 3G6VA 1ZQEA 2O1PA 2UVRA 1XO1A 5KFFA 1ZQXA 4EBEA 4FBUA 4RQ4A 1ZYQA 3RJHA 8ICBA 1PX5A 3PW5A 3OGUA 3C21A 1JX4A 5J0RA 3MGHA 2W9BB 4J9PA 4DSEA 4RQ8A 3C2MA 1WCNA 4F3OA 4KLGA 3B0YA 5KT3A 4DQRA 3AU6A 3UXNA 5CA7A 5EWFA 4ECUA 4ECZA 2DVIA 4KTQA 3C1YA 4LZDA 4WC5A 3FYHA 4AT8B 4JUZA 2FPKA 9ICSA 2RFFA 2JEGA 1LV5A 3H8WA 1T8EA 4K4IA 1YLQA 2KTQA 2NRXA 4IRCA 9ICCA 5HRIA 5L1KA 5HC9A 1JN3A 4M6WB 2ZHBA 5CJ7A 2BE3A 1NK4A 2HHPA 2ZJAA 3H7IA 3RAQA 4RNOA 1MQ3A 3PVXA 4B9SA 3JPRA 4B9MA 1TAQA 5J2EA 2PI5A 3Q8RB
chains in the Genus database with same CATH superfamily
5J2GA 4I27A 1Z1BA 1RYSA 2HMXA 4I2EA 3WKCA 3QU4A 4YCXA 1ZQTA 3ORYA 4M0AA 7ICFA 2ZH2A 2FLPA 2AHOB 5EE3A 3SEIA 1ZETA 5DB8A 4RQ6A 2Q66A 2ZH9A 2E8PA 4UAYA 1N60A 2JMGA 2HCFA 3QNMA 2XCPA 3CW2C 3KOOA 1MQ2A 4BJQA 2E8NA 3MDCA 1U45A 1XS9D 4DSIA 4E80A 4Y2XA 1MA7A 4YMOA 1N48A 4F91B 1KFTA 5DB6A 2LBOA 3B9JA 2QARB 3OUYB 3IRUA 4J9LA 1N56A 2KSOB 4LJXA 5F9NA 5KL8B 1ZQIA 2EAOA 2VIXA 5E79U 3QUCA 4WC7A 1SV0C 2AGOA 3HW8A 1S0OA 2OH2A 2ZHAA 5HR9A 1JAJA 3IG8A 2YMPA 2HBKA 5KFPA 4J9RA 5KG2A 1Z00B 9ICOA 4WBZA 3N4MB 5AI0A 2FLLA 2ATLA 3SAFA 4DFJA 2PFPA 2OEHA 4UW9A 1ZQFA 1F5AA 4P0QB 5AKEA 3E2EA 3OTQA 1V85A 2H5XA 2BCQA 2F8LA 5C0YA 2KKVA 9ICBA 4RPZA 2DQNB 3LQCB 1Z19A 4K98A 5IILA 2C2RA 4C4SA 3PMNA 4NLZA 4LEYA 3NVWA 5AI5A 1V9PA 3RF9A 5AM3A 1RG6A 4XA5A 4WH5A 3JPSA 1X6JA 1A76A 3AN1A 2NV3A 4F4WA 3C28A 5DB9A 2YB4A 1O03A 1CEZA 5HRDA 5HRGA 4UAWA 5IIKA 2PFOA 4BWJA 2F1HA 4ELTA 3N7RC 3MGIA 3JPPA 1KSPA 3QEAZ 9ICMA 1FFUA 3EWAA 4MFCA 8ICOA 3A0BU 1S97A 3SQIA 1BPZA 7ICOA 2K4EA 4UD5A 9ICKA 2ASJA 3ZDCA 1V97A 1WUDA 5HRHA 5DBAA 5DQGA 3BQ2A 4DO9A 2A1AA 1D8LA 5ALHA 4MHVA 4X5VA 3NRWA 8ICGA 5KFBA 5B3QA 4F4ZA 3OVSA 4O3NA 4ICAA 1ZQKA 4IR1A 3PSTA 4WBYA 3QZ8A 1S9FA 1N5WA 5DB7A 7ICVA 3NKUA 1DOQA 4FS1A 4EZ9A 2BPGA 4Y2YA 5IIJA 2KZ3A 4GXIA 2ZIWA 3UMGA 4JLXA 4OO1J 1SL0A 4Y2PA 3UQ2A 2J6TA 4EGWA 4IRKA 1TAUA 3T5JA 1SL1A 4X4PA 4QWBA 3MR6A 5CP2A 2Y9UA 4IQVA 4WCWA 3ICXA 4B9UA 5HP4A 5J2FA 3TADC 4TQRA 1COKA 1GO3F 4NXZA 2AH5A 5DG8A 1TVAA 5J2JA 4F5QA 3OVAA 3QXGA 1ZD4A 3WK6A 1SKRA 4X4OA 2H3QA 2BCRA 2CN1A 2PKEA 9ICVA 4NJ8A 1MIVA 3C18A 2FE9A 1PK1B 1ZQWA 3BQ0A 3QX7A 4P0PB 3GU3A 3LK9A 4MFFA 2HOQA 2NRKA 4WC1A 4K8VA 3KZIU 4QZFA 2F3NA 4K9BA 5KG4A 3L5KA 2R8KA 4F4KA 3C29A 5CHEA 5ALMA 2EDUA 5KFQA 2HOFA 2DKXA 5J0SA 1V4AA 2W9MA 3D6JA 2NYVA 2KJ8A 1SKSA 2A1JA 4F2RA 3L3FX 3TACB 2WF5A 1KL9A 2K4PA 3IN5A 1IIPA 2K4HA 2AQ0A 4JB3A 1T3QA 3K75D 1UT5A 1ZD5A 2KK0A 3HJ4A 3Q8PB 1R8AA 2ZG6A 2KKPA 2LM1A 3CP8A 3JPTA 1NJYA 4DL4A 1U4BA 2VANA 1SKWA 1SXEA 1KBUA 1S5LU 2NRZA 5D62A 1ZQHA 2I9GA 2RDIA 4J9MA 3H8JA 3Q8SB 4IQUA 2AJQA 1Q8KA 2D3DA 4EX7A 1R8CA 2OXOA 4I29A 1JXLA 1RQLA 3ALRA 1JI7A 4X0AA 1TFWA 1BNPA 5KT4A 4ECTA 2DGZA 1TK5A 3MFIA 2G09A 2VA2A 2I5HA 2IMWP 4GXKA 3PO4A 1K1SA 4DWIA 4EEYA 1SXDA 3QU2A 4O3SA 2FPLA 5B3PA 3NVYA 1L8OA 2Y0SC 3KKAC 5HREA 3N28A 2DR7A 2EWRA 2ZIXA 5AKGA 4O3OA 4O5CA 1NJWA 4RQ7A 1ECWA 2K4IA 3GIIA 3BQ7A 2D6FC 1KDHA 4ECXA 5F2VO 2LHTA 2VA8A 2W7PA 3RJEA 4RQ3A 9ICEA 9ICTA 4FH5A 2XIDA 4Y2VA 3M9OB 5J8YA 4KMOB 2XI9A 3C23A 1NK7A 4E8FA 3SV3A 4AP9A 5KG0A 2F77X 1M6YA 4NY8A 4YMNA 1U47A 5ALYA 4Q43A 4DOAA 5FP0A 4C0ZA 5J2DA 1BVSA 9ICRA 3OUYA 2H3FA 3PX6A 2JH1A 4B9TA 5DKWA 4RQMA 1L5UA 1T3NA 1ZQCA 1PX5A 5DGAA 1S0VA 4OJLA 1N2XA 3GIJA 2WF7A 4QW8A 3RH6A 4PZOA 4KMUA 5KT6A 4PZNA 5KFTA 5JTIA 5IIOA 4DSLA 5JU5A 3MR3A 1HUOA 4C8LA 3ETRA 3V72A 1ZQPA 5AM0A 5AICA 2YMMA 1PVPA 2XGQA 4A8EA 4C8OA 5KFDA 4KLSA 3LYSA 4DQPA 4FFDA 3RRHA 5J0PA 1DGSA 5BPCA 3H40A 3NRZA 1ZXIA 2DR5A 3R9KA 2P6UA 4FS2A 3C66A 4MKPA 2ZUDA 5KFKA 2KNJA 5F9LA 5EWGA 4I0UA 2UVRA 1F44A 4WQKA 8ICBA 5AKLA 2WF9A 1JX4A 5J0RA 4IL6U 3C2MA 4KLGA 2OYYA 3AU6A 2DVIA 4LZDA 4EENA 2RFFA 1DGJA 3H8WA 5ALZA 5HC9A 5L1KA 4M6WB 5CJ7A 3H7IA 3RAQA 4RNOA 1MQ3A 1SGGA 1TAQA 2PI5A 3Q8RB 4RT2A 4O3PA 1JXEA 1AQ6A 1TK0A 3WK4A 2KVCA 8ICZA 4DLEA 2YN4A 1IG6A 2ZIWB 5JTGA 3WK8A 2HW3A 8ICLA 3HJEA 2KFZA 1BPBA 4RPYA 1KLNA 9ICPA 1S8OA 3S6JA 4P2HA 3D2QA 4RWPA 2QKQA 4MF8A 4UATA 4KLDA 4UB8U 3RBEA 2W9CA 1ZQZA 4PL2A 5AKJA 2B6GA 3MR5A 4NLCA 5KFAA 2QLTA 3TAPA 3OSNA 1Z4NA 4O3MA 2NRVA 3NASA 4F50A 3MGVA 3CYMA 9ICLA 4PPXA 5ALXA 7ICSA 4K96A 4X4NA 2AGPA 3C1ZA 1Q3VA 2G0AA 4DFMA 2IHMA 3RJKA 2HSZA 5KG5A 5KTQA 1ZQRA 4NKUA 4XUSA 4YXMA 3PSPA 1EXNA 4JWMA 4RWQA 5JUMA 2ZH3A 4M5DA 1NKCA 3OV7A 5C5JA 4KN7A 4QZAA 1BPDA 1UA0A 4JWNA 4K4HA 1YZ6A 4P4OA 1TE2A 2EANA 2JV3A 1X9MA 1U49A 1RM6C 4YXJA 1X9SA 4F4YA 2A1JB 1S77D 3QU7A 4CF3A 3V6HA 2HVIA 2XGPA 2KOBA 4NL9A 4DQSA 4ZOHC 2Y0SF 3UMBA 1QSSA 2R8HA 2M2VA 1UEUA 4QJFB 8ICWA 7ICIA 4Q45A 4CNQA 2H3IA 1SWWA 4UB3A 5HRKA 1S76D 3G6XA 1QSLA 4BWMA 5DGBA 3SYZA 2DF4B 5D46A 4O6AA 1PK3A 1UCVA 3K7DA 3Q8QB 4FO6A 2XO7A 4NLGA 5DQHA 2KZMA 3PR4A 4WC0A 4BGDA 3L4PA 3SD7A 4EP7A 3HWTA 1B43A 4TUPA 1XC9A 2H3VA 5GTHU 1ZQMA 2DKZA 3NGDA 4C4TA 4K99A 4K9AA 3IDWA 3QYPA 2OM6A 3KZXA 1KQQA 4KLEA 3ZD9A 3PX4A 3NVZA 4F8RA 4TUQA 1VJ5A 3N7SC 5ALSA 5AKYA 4AT8A 5CR0A 5B66U 4Z6CA 4IQWA 2ZIXB 1ZQ1C 1ED1A 3PNCA 2AXTU 4QIWC 4NXWA 1XSNA 4FHWA 4FHXA 4I2JA 2J6SA 2UVUA 5L1LA 2BCSA 4EBDA 2HHUA 3V6KA 9ICAA 4QWCA 3BQTA 4OCZA 3G6YA 4TURA 1QQ6A 4PHEA 2LYAA 4DF8A 9ICNA 4M47A 4Z6EA 3ER8C 7ICHA 2F1JA 4RWOA 1U9LA 4JK1A 3RB4A 2KMDA 2ZTCA 2CRXA 5L1MA 3B0XA 5DBBA 7ICGA 4NXVA 5KL1B 1UETA 3ONNA 3PR5B 2M2TA 5D61A 2QB1A 8ICNA 1F0MA 3TFRA 2BHNA 3MC1A 5KFJA 4K4GA 3SR6A 5KT2A 3KFUF 4X0BA 4O5EA 5K4LA 3ISCA 4US9A 1NK5A 2M2WA 5KG3A 5KFOA 4ELVA 9ICGA 4RT3A 9ICHA 1ZQAA 3H0RB 4CDGA 3LVVA 7ICLA 3Q8KA 4Q8FA 2XY7A 4O67A 3H3AA 4WQLA 2FPMA 2BBHA 3BS7A 2KHQA 2W3RA 4RUAA 1A6SA 5KFIA 2HDOA 4DL2A 4CRXA 3PX0A 2WF6A 5KFSA 3BZKA 3IP4B 4ECVA 3PV8A 5KT7A 4F5PA 1FFVA 4FZLA 4DSJA 2Y1IA 4J9QA 4DFPA 1RZTA 1TV9A 1J2MA 2B51A 1T4GA 5CRXA 1Z1VA 3EW9A 2KHVA 3BZCA 3RR8A 3EYZA 3C2LA 4JV1A 5KFMA 1IXRA 2OHFA 2XY6A 1SL2A 2K8AA 3LWMA 4KLFA 3ISBA 2ZTEA 3TAQA 2BR0A 3PSFA 2ASLA 4XQ7A 3JPQA 4AT7A 3V7KA 2KVSA 3VC8A 4KLIA 4RNMA 4F93B 1WOTA 3WKDA 5CFTA 2ZXIA 7ICJA 4DS4A 2ALZA 1NKBA 5A0LA 3JYYA 7ICTA 1TFYA 4UARA 3GILA 1VLBA 3QEBZ 1XSLA 4M6WA 1NK8A 2PXIA 4KLJA 2IHOA 3QU9A 1SV0A 2WFAA 2W9CB 4EYHB 3ZDAA 4YD1A 4QZIA 3AL0B 3QUQA 5G5HA 2N1RA 4ED6A 4E7XA 2ZIUA 3HX0A 3T5KA 2HHTA 4I2DA 3HJ1A 5ALVA 5AKHA 2EQYA 2BPFA 2JZBA 4PL1A 5KFLA 2C22A 1AROP 2FJ6A 4BX9C 3M8SA 2KV2A 4EEDA 2XVTA 1J2NA 5EOZA 2BPCA 4U6PA 3M6ZA 1D9FA 1QQ5A 5KAFU 5KFZA 4DOCA 3MDAA 2A3VA 5AM2A 3PZPA 5ALGA 1BGXT 4DL5A 3SMVA 3Q8MA 1X6IA 3WKEA 4QZCA 8ICFA 4IG8A 4B9NA 2D8CA 2MSNA 3KHLA 5IINA 3U26A 5HRLA 2WF8A 1NI3A 3TQ1A 2C28A 2KICA 3AEVA 4QW9A 4Z6DA 4R65A 1T7PA 3KHRA 5DG7A 2F44A 3SI8A 1UEVA 1RQNA 3DV9A 3OHAA 4PGYA 2IHNA 4YR2A 2H3ZA 2KJ9A 4KITB 2FI1A 3BS5B 1ZQBA 2E3TA 5AKZA 4J9KA 4O3RA 7ICMA 2WB1C 4NLBA 1ZOLA 4QIWF 1WWVA 2KE7A 4AT9A 2ESEA 3I28A 2GAFD 5J0YA 3FAHA 4OJ6A 5J8YC 4IRDA 3T3FA 4I2HA 4EELA 5AK5A 3NVOA 4J03A 3JPNA 4ED1A 4J9OA 1NK6A 1O08A 5J0QA 5D49A 2R8JA 4C8KA 3H4DA 2GA9D 3C5GA 3WFQE 2FLNA 3ED5A 1MSWD 1F5SA 2ISPA 3K4GA 2O1PA 2BZFA 2O6KA 4FBUA 2YMLA 1ZYQA 4DSEA 5HR6A 1WCNA 4F3OA 2JGAA 4ECUA 5ALRA 5CA7A 4KTQA 2ZXHA 2BBJA 4AT8B 2FPKA 3CRXA 1T8EA 2KTQA 3F5AA 9ICCA 5HRIA 4LEVA 2BE3A 2EH9A 2ZJAA 2HBLA 4B9MA 3TADA 4G9BA 2EZXA 5EE1A 3AQLA 5J0OA 9ICUA 2LM4A 2MA1A 1ZQVA 4F5OA 4KLQA 5H2FU 1U48A 2E8OA 1CUKA 1RYUA 4EEKA 1UQVA 4DSFA 5KFEA 4C8NA 3AQEA 2WHEA 4UAVA 1Y88A 1ZJNA 3PW0A 1RXVA 4LT6A 2HOIA 1L3UA 5G5GA 3AM9A 3H8SA 3ZI4A 1OUQA 2M0NA 4UAUA 4M9JA 4F72A 4ELUA 8ICRA 2ID1A 3HILA 4M9NA 4I2IA 4KX5A 5F3XB 4YN4A 4GFJA 4YVZA 4X4SA 2JHDA 2JEFA 4KLUA 1BPXA 2XCAA 2HN2A 3OJUA 8ICAA 1X9WA 1KEJA 1N62A 2KP7A 1SWVA 1QQ7A 4C80A 4DFKA 1N63A 4R64A 5AK6A 4HAIA 4RU9A 4ATBA 2DL0A 2QB0B 1MN8A 3F2BA 3AQNA 1BPYA 1NK0A 8ICPA 3FC4A 4NM1A 2HHWA 2RQ5A 3HKZC 3KBBA 3H8MA 4PGQA 2BGWA 4MF2A 4YMMA 4DF4A 4B6JA 5J0TA 1Z4OA 4M9HA 4DEZA 9ICWA 2FCLA 4J9NA 2ZTDA 2WTFA 1PUZA 4AT7B 2ZH4A 2E5SA 5CFUA 2PMZC 2ZH7A 4F5NA 4GC7A 5J2BA 3KKAA 5KNIA 3PO5A 3EUB2 4O69A 4JV0A 2F2AB 2Y1JA 4CGZA 3F2CA 2FMSA 3AU2A 5J0XA 2NRTA 5AHXA 7ICRA 2JXJA 2W9BA 1ZQUA 4O3QA 4YP3A 2HHQA 1LVHA 3UPQA 2DR9A 1LKYA 1ZQJA 4QZHA 3VCBA 4CCHA 3T5HA 3QUBA 4O5KA 2E1FA 3DDHA 4OJOA 2ZIUB 2G5HB 4IR9A 4K97A 5HMLA 4XJEA 2JZBB 3GV5B 2WB1F 2W04A 4FHYA 3RB3A 3J81j 1Q79A 2Q4TA 1DK3A 2EZZA 2W7OA 2XC9A 2WAQC 1KW4A 2B4VA 4UQGA 1DK2A 2HBMA 3SAHA 3WFPA 1HUZA 4ECSA 2I1QA 3M9MB 3F53A 1VJ7A 3CK6A 2NO5A 3N7PD 3LVWA 3UPSA 4I28A 2MU2A 1FA0A 2G5IB 3H37A 2HHVA 4EZ6A 5KG6A 1KN5A 4O9MA 1V38A 2AGQA 2KIVA 3ERCC 3MABA 1MIWA 2NO4A 4B9VA 1B22A 2GO7A 4P4PA 4NXUA 4RQNA 4ACOA 5HHIA 4OAFA 4E0DA 1SV4A 1A77A 4AT9B 3HPOA 2VA3A 1ZQGA 4MFAA 3NYBA 5KFXA 1KFSA 4EBCA 2DRAA 5J2CA 2HN1A 2EAMA 4XRHA 4OJPA 3I76A 3BS5A 5KT5A 3UXPA 2ISOA 4RPXA 3C2KA 4F5RA 2ZH6A 2PI4A 5DQIA 2JR5A 5DDMA 4O0IA 2ODGA 2VJ5A 2KD1A 8ICIA 4YQWA 1NOMA 2W9AA 4ECWA 2KN7A 4I2FA 4FHPA 2ZH8A 2K8CB 1S0NA 2M9NA 4WC3A 1X2IA 3LDAA 4P4MA 3BDPA 5J2IA 4FHVA 4X4UA 5HMMA 2DPJA 2DFLA 1R8BA 2JEJA 5HNKA 1NJXA 1VFGA 4BXOA 4F71A 3RR7A 3LWLA 1PVQA 4DCCA 5AM5A 3NS1A 1QLNA 1DRGA 1TFRA 2IBKA 2Q0ZX 4ECQA 3RB6A 3RH5A 2OWOA 3AQFA 5JRTA 5BOMA 5ALDA 4PGXA 4NKTA 8ICTA 4ED0A 1ZQLA 5HHHA 5KFWA 4M2YA 3D2NA 2P6RA 2RRDA 5ALFA 4BUGA 2W55A 5ALUA 4MEYA 3JPOA 2J6UA 2DUYA 4KLMA 8ICXA 4FBTA 1YZ7A 5AK4A 2KG5A 2MRLA 4TUSA 3EZ5A 1QTMA 3HKZF 3RJIA 3TI0A 3WU2U 4X4RA 4Z6FA 3Q8LA 3HIYA 2LPEA 2V4QA 3TFSA 4O68A 4UB4A 3NTUA 1NKEA 1ZQDA 1HIWA 4LEWA 2LI6A 3OJSA 3N97B 1QH9A 9ICXA 1IM4A 3MCRA 3QE9Y 4EX6A 3SV4A 2P35A 2PMZF 4QZGA 4F2SA 1L7NA 8ICMA 2ZUCA 5CFSA 4LVSA 4DL6A 4PHAA 3WFRE 2LMRA 1BPEA 1X42A 2ZIVA 5KG1A 4PH5A 4RQ5A 3L9DA 5AIAA 2HHXA 2OCEA 2XY5A 5AI6A 4ED3A 3AUOA 4ATBB 3SZ2A 4C8MA 4HX0A 2GLEA 3H39A 4UBCA 4NM2A 3BQ1A 4B9LA 4ED8A 4ECRA 8ICSA 5DLFA 3EPIA 3E58A 1B4FA 1TKDA 5ALWA 1FIQA 2KEYA 2QB0A 4RWNA 2M2UA 4WC6A 4QWEA 1UA1A 2MUTA 3WKBA 5CWRA 1ZQOA 3T79A 1NO5A 5AKKA 4GC6A 1TK8A 2B21A 4BDPA 8ICHA 2ASDA 4F92B 1X40A 2V4RA 3F2DA 2BDUA 2WAQF 1L3TA 1ZQQA 2IUBA 1JRPA 4JLZA 5DDYA 1K1QA 4OJ5A 5D4BA 4CF5A 2RDJA 4DFDA 1XO0A 1L3VA 3G6VA 4USAA 1ZQEA 2FDRA 1CI4A 3F5EA 1ZQXA 4RQ4A 3PW5A 2W9BB 4J9PA 4EV6A 4NXTA 4DQRA 2F8KA 5AM1A 5EWFA 4ECZA 4QNLA 2RP5A 3C1YA 4GIBA 1LKYB 3FYHA 2VJ4A 4U7CA 1YLQA 2G07A 5AM4A 2NRXA 4IRCA 1VDVA 1JN3A 2ZHBA 2R18A 1NK4A 2VKQA 2B56A 5J2EA 1JMSA 1NZPA 4XQ8A 5KFUA 8ICQA 4M9GA 1D8YA 7ICEA 1KFDA 1QSYA 3GFKB 4N7RA 4KX3A 2KIWA 2V9WA 3JZ0A 3RRGA 2R8GA 4Q8EA 3OSPA 1JUDA 1TAMA 4TQSA 3HT3A 4UASA 1SB3C 7ICUA 3GV8B 3BJYA 2CXYA 4WC2A 2PFNA 7ICNA 5HRBA 2JH7A 4DQQA 3DEEA 3RB0A 4FE3A 3V7JA 1COOA 2YX8A 1ZQYA 5GTIU 1FO4A 2YMQA 4X4QA 1P7DA 3WK7A 2BKEA 1X9XA 3EF2A 5KAIU 3PW7A 7ICPA 1L7PA 4YR3A 1HJPA 3WK5A 3C5FA 5BOLA 4ZH4A 3RJGA 2O5AA 3RFAA 1FEZA 1OU5A 2L5YA 4Y2SA 3A0HU 4QWAA 3K1RB 1JROA 5KFNA 3NWIA 3TANA 4I2AA 4WJ3B 2E1EA 1URJA 3RJJA 3KHGA 1XWLA 2YB1A 2ZJ8A 1XNSA 2UVVA 8ICUA 5DG9A 4Y2TA 3ETLA 1ZJMA 3D2SA 4KLOA 2DR8A 5DEDA 1XU4A 4I2CA 4R8UA 4Y2UA 4YR0A 3PHZA 1SZPA 2LYBA 4J9SA 4JMUA 3RBDA 3WKAA 1NK9A 5T14A 1N61A 5ALOA 3GIKA 4BXOB 1WG8A 4NXXA 1ZRMA 2HI0A 1OW5A 3GZFA 2G08A 5AKXA 5KFHA 5ALKA 1UT8A 4I2BA 3SAGA 4MEXA 2YY6A 4G3IA 1Q3UA 4NWIA 5TZVA 4CF4A 4NLKA 4KM5A 5L1JA 2HBJA 3QU5A 4ECYA 3H4BA 5AI8A 5KFVA 2W54A 3H0LB 3UQ0A 5DECA 3T5LA 1C20A 1RYRA 3QUTA 3OHBA 3TARA 1Q46A 1L3SA 1Z3EB 4UB1A 1DXSA 9ICQA 4QZ9A 4Q44A 2KZZA 4OD0A 4LZGA 4ED7A 3RH4A 5EWEA 2BQRA 2F76X 3ZD8A 2PBEA 4M9LA 1N5XA 2GWSA 3WFSC 4KLLA 3MFHA 2LKYA 1XSPA 5B5EU 4KB6A 4UAZA 4GXJA 4RNNA 5IIMA 2NRWA 8ICCA 4CE6A 3O0FA 1C7YA 8ICEA 2C2DA 3WK9A 2YQEA 1L7OA 1R89A 4C4RA 3NVVA 2ZIVB 4F4XA 4RQ1A 7ICKA 4KN4A 5KFGA 1WCLA 3I1YA 1JQRA 4WC4A 5EE9A 4OAIZ 4AYBC 2B0CA 4US8A 2BDPA 2PFQA 1ZD2P 4UD4A 5AKIA 3GQCA 4LEZA 5ALLA 5L9XA 5CB1A 1H38A 5J0WA 1JIHA 2JRZA 2QARA 3RTVA 3V6JA 2KFNA 1WWUA 7ICQA 2KSOA 3MR2A 2IOHA 1GPJA 3EPGA 2K8BB 2BCVA 3OVBA 2Y9TA 3V7LA 4JV2A 2MUTB 3AQKA 4Y2QA 1LB2B 1SIJA 1RPLA 2G06A 1S10A 2E8MA 2HVHA 1K5OA 2W8LA 5DLGA 1Z00A 4EEBA 3THVA 1MIYA 2DPIA 3MBYA 2W11A 2EAPA 2LYHA 4WOYA 2W3SA 1UPHA 3FDSA 4P0QA 1BNOA 3TKAA 2ES6A 4FZMA 5AIBA 8ICKA 1PZNA 4Y2JA 5J0UA 4UB2A 3AQMA 3M9NB 3GIMA 4C7ZA 3OWGA 3CNHA 9ICJA 3QZ7A 3GDXA 3ZDDA 4HYKA 1Q78A 3E0FA 2W43A 5ALQA 5J2HA 4FH3A 2AQ4A 2DBYA 4DQIA 3RAXA 4EBJA 2IOFK 1CRXA 2Z7JA 5TISU 3ZDEA 4NL9C 3UM9A 4DS5A 5AK3A 2F1IA 1RXWA 2FMQA 4FZNA 4RQ0A 3PW2A 2ZH5A 4PJ0U 4UBBA 8ICJA 4RQ2A 2W8KA 2RLTA 4IQTA 2ZH1A 2AU0A 2YTUA 4C7YA 4PHPA 4KLHA 1KNYA 4DOBA 4QZBA 2BQUA 4OAHA 4X4VA 1ZD3A 5D63A 4QZ8A 5DBCA 5J2AA 4YFKA 5HR7A 2MAXA 5EE0A 1B0XA 1YT3A 5J29A 4M04A 3UMCA 5KFCA 2IOFA 5IIIA 9ICIA 4X4TA 1X66A 4NV0A 3RJFA 5ALEA 1ZRNA 4OAGA 5AI4A 1L6NA 3HP6A 5ALJA 2CPRA 8ICYA 4QZDA 3KTQA 4FO1A 3JCFA 4DL3A 1D9DA 2JEIA 4QZEA 1JALA 3PSIA 4R63A 1NNLA 4S3NA 2R8IA 2FMPA 5J2KA 9ICFA 3WFOA 2UVWA 4DL7A 5KFYA 5KG7A 2W03A 3M8RA 5KFRA 2A19A 2DRBA 5CHGA 1QCKA 2K89A 4R66A 1A0PA 2C2EA 2ZJ5A 1J97A 1S0MA 3FM9A 5HRFA 4GLXA 2XICA 3K1ZA 5ALPA 4YD2A 3KD3A 2I6XA 3SENA 1WYGA 1IV8A 2P66A 4PHDA 4KLTA 3ISDA 1NZBA 4NLNA 4DSKA 2BQ3A 3UXOA 3HRDD 2RHFA 3IV6A 4QWDA 4RUCA 1ZQSA 2ZUBA 4UB6U 1KRPA 3PMLA 4ED2A 5ALIA 1MC8A 1OXJA 1HEKA 2GH1A 5CEHA 4R8UB 3GV7B 2K60A 1ZQNA 3M7DA 4DLGA 5L1IA 3H38A 4P0PA 1PK1A 3PY8A 5ALTA 2DWQA 2GOLA 3KHHA 1D8BA 3AMZA 4EYIB 3OPXA 4YG2A 4EBKA 3IM1A 3IG5A 4UB5A 3PW4A 1KTQA 2KJ5A 3M6KA 2IA6A 4Y2RA 1T94A 3M1YA 1NJZA 4RZRA 2BCUA 4I2GA 3ZDBA 3IHQB 8ICVA 2HHSA 3ER9B 1UHUA 1XO1A 5KFFA 4EBEA 3RJHA 3OGUA 1L7MA 3C21A 3MGHA 4RQ8A 3B0YA 5KT3A 1RDFA 3UXNA 5AI9A 3NUQA 4AYBF 4WC5A 1KKXA 4JUZA 4IS7A 1L8LA 9ICSA 2JEGA 1LV5A 5ALNA 4K4IA 3H0MB 1SZHA 2HHPA 2EZYA 4IC9A 3PVXA 3JPRA 1PVRA 4B9SA
chains in the Genus database with same CATH topology
5J2GA 4I27A 4RT2A 4XQ8A 1NZPA 4O3PA 1JXEA 5KFUA 1RYSA 4M9GA 1D8YA 7ICEA 8ICQA 1TK0A 4I2EA 3AQLA 1KFDA 5J0OA 1QSYA 3GFKB 9ICUA 8ICZA 4DLEA 4YCXA 1ZQTA 1ZQVA 2V9WA 3ORYA 4M0AA 7ICFA 3JZ0A 3RRGA 2HW3A 8ICLA 2ZH2A 4F5OA 2KFZA 4KLQA 2R8GA 4Q8EA 3OSPA 1BPBA 4RPYA 1KLNA 2FLPA 1U48A 1CUKA 4TQSA 3HT3A 9ICPA 1ZETA 5DB8A 4RQ6A 3GV8B 3BJYA 5KFEA 4C8NA 4DSFA 4P2HA 7ICUA 4RWPA 2Q66A 4WC2A 2ZH9A 4UAYA 4MF8A 2PFNA 4KLDA 1Y88A 1ZJNA 3RBEA 3PW0A 1RXVA 7ICNA 5HRBA 4LT6A 2W9CA 1ZQZA 4DQQA 2XCPA 3MR5A 3RB0A 1L3UA 5KFAA 3V7JA 1MQ2A 1COOA 3MDCA 3H8SA 1U45A 3TAPA 1XS9D 4DSIA 4E80A 3OSNA 1ZQYA 2NRVA 4YMOA 4M9JA 1N48A 4F91B 4F50A 4ELUA 1KFTA 5DB6A 8ICRA 9ICLA 2ID1A 4M9NA 4PPXA 3OUYB 4J9LA 4I2IA 1N56A 7ICSA 4YN4A 4YVZA 4X4QA 4X4SA 5F9NA 1ZQIA 4X4NA 2AGPA 2BKEA 3C1ZA 2JEFA 4KLUA 1BPXA 2XCAA 4WC7A 2AGOA 4DFMA 3HW8A 2IHMA 3RJKA 3PW7A 7ICPA 3OJUA 5KG5A 1S0OA 2ZHAA 4YR3A 1HJPA 8ICAA 1X9WA 5HR9A 3C5FA 5BOLA 4ZH4A 5KTQA 1ZQRA 3RJGA 4NKUA 1JAJA 1KEJA 4XUSA 2O5AA 4YXMA 1EXNA 4JWMA 2KP7A 1OU5A 4RWQA 5JUMA 4J9RA 5KFPA 2ZH3A 5KG2A 4M5DA 1Z00B 1NKCA 9ICOA 4WBZA 3N4MB 3OV7A 4QWAA 5C5JA 4KN7A 4DFKA 4QZAA 2FLLA 1BPDA 2ATLA 5KFNA 4R64A 1UA0A 3TANA 4JWNA 4RU9A 4K4HA 4DFJA 4P4OA 2PFPA 4ATBA 4I2AA 1X9MA 1U49A 1ZQFA 1F5AA 4YXJA 1X9SA 3AQNA 4F4YA 1BPYA 3E2EA 2A1JB 1S77D 3RJJA 3KHGA 1NK0A 1XWLA 8ICPA 2H5XA 2ZJ8A 2BCQA 4NM1A 3V6HA 2UVVA 2HHWA 9ICBA 8ICUA 2HVIA 4RPZA 2XGPA 3LQCB 5DG9A 4DQSA 1JMSA 5IILA 2C2RA 3ETLA 1ZJMA 3PMNA 1QSSA 4NLZA 2R8HA 4PGQA 2BGWA 4KLOA 2M2VA 1UEUA 2DR8A 1V9PA 5DEDA 1XU4A 4XA5A 8ICWA 7ICIA 4Q45A 3JPSA 4I2CA 4R8UA 4MF2A 4YMMA 1A76A 4DF4A 4YR0A 5J0TA 4M9HA 4UB3A 4DEZA 4F4WA 9ICWA 5HRKA 4J9NA 1SZPA 4J9SA 2ZTDA 1S76D 3RBDA 3G6XA 5DB9A 2WTFA 1QSLA 4BWMA 4AT7B 1NK9A 2ZH4A 5DGBA 3SYZA 3GIKA 5D46A 1CEZA 5HRDA 4BXOB 2ZH7A 4F5NA 4GC7A 5HRGA 5J2BA 4UAWA 5IIKA 3Q8QB 4FO6A 2PFOA 4BWJA 2F1HA 2XO7A 4ELTA 5DQHA 3MGIA 5KFHA 4I2BA 1UT8A 3PR4A 3JPPA 3PO5A 2KZMA 1KSPA 3QEAZ 4MEXA 4WC0A 4BGDA 9ICMA 4G3IA 3EWAA 4MFCA 3HWTA 8ICOA 4EP7A 1B43A 4JV0A 4TUPA 1XC9A 2Y1JA 5TZVA 1S97A 1ZQMA 1BPZA 4NLKA 7ICOA 5L1JA 2FMSA 3AU2A 3NGDA 5J0XA 4ECYA 3H4BA 4UD5A 2NRTA 5KFVA 2ASJA 9ICKA 3ZDCA 7ICRA 4KLEA 3H39A 3ZD9A 5HRHA 3UQ0A 2W9BA 1ZQUA 3PX4A 4O3QA 4YP3A 5DECA 5DBAA 5DQGA 3BQ2A 3T5LA 4F8RA 2HHQA 1RYRA 4DO9A 3OHBA 1D8LA 4TUQA 3UPQA 3TARA 4X5VA 2DR9A 1ZQJA 4AT8A 5CR0A 4QZHA 4CCHA 8ICGA 4Z6CA 4IQWA 1L3SA 5KFBA 1Z3EB 3T5HA 4F4ZA 3OVSA 4O3NA 4UB1A 1ZQKA 4IR1A 4O5KA 9ICQA 4QZ9A 4Q44A 3PNCA 2KZZA 4WBYA 1XSNA 4IR9A 4LZGA 4ED7A 4FHWA 3RH4A 3QZ8A 4I2JA 5EWEA 5HMLA 2BQRA 5L1LA 2J6SA 2BCSA 3ZD8A 1S9FA 2UVUA 4M9LA 2JZBB 5DB7A 4EBDA 3GV5B 3V6KA 2HHUA 7ICVA 9ICAA 2GWSA 3WFSC 1DOQA 4QWCA 4FHYA 4FS1A 3RB3A 3BQTA 4KLLA 4EZ9A 3MFHA 1Q79A 3G6YA 1DK3A 2BPGA 4TURA 1XSPA 4PHEA 5IIJA 4DF8A 9ICNA 4M47A 2KZ3A 4Z6EA 4GXIA 7ICHA 2F1JA 4UAZA 2XC9A 4GXJA 4RWOA 4RNNA 5IIMA 2NRWA 8ICCA 1SL0A 1U9LA 2J6TA 4UQGA 3UQ2A 1C7YA 1DK2A 8ICEA 3WFPA 2C2DA 4JK1A 4IRKA 3RB4A 1TAUA 2ZTCA 3T5JA 4ECSA 1SL1A 1HUZA 1R89A 3B0XA 5DBBA 4X4PA 2I1QA 4F4XA 3M9MB 4QWBA 3MR6A 7ICGA 1VJ7A 4RQ1A 5CP2A 4IQVA 7ICKA 4WCWA 3C66A 1UETA 3PR5B 4B9UA 5HP4A 2M2TA 5J2FA 3UPSA 4KN4A 4I28A 4TQRA 5KFGA 1WCLA 8ICNA 1JQRA 4WC4A 3TFRA 2BHNA 1FA0A 4NXZA 2BDPA 2PFQA 5KFJA 4UD4A 4K4GA 3H37A 2HHVA 5DG8A 4EZ6A 5KG6A 3GQCA 1TVAA 5L9XA 5J2JA 5CB1A 4O9MA 5KT2A 4F5QA 4X0BA 2AGQA 1H38A 4O5EA 3ISCA 5J0WA 1NK5A 5KG3A 1JIHA 5KFOA 4ELVA 3MABA 9ICGA 2M2WA 3OVAA 4RT3A 3V6JA 3RTVA 1SKRA 9ICHA 2KFNA 4B9VA 1MIWA 4X4OA 1ZQAA 7ICQA 1B22A 2BCRA 4P4PA 3MR2A 7ICLA 9ICVA 1MIVA 5HHIA 3C18A 3Q8KA 4NLGA 2XY7A 4Q8FA 3H3AA 4E0DA 3EPGA 1ZQWA 2FPMA 3BQ0A 1A77A 2BCVA 4AT9B 3HPOA 3OVBA 4RUAA 3V7LA 2VA3A 4JV2A 3LK9A 1ZQGA 2MUTB 3AQKA 5KFIA 4MFFA 1LB2B 1RPLA 4MFAA 2NRKA 5KFXA 3NYBA 1S10A 4WC1A 2HVHA 1KFSA 4DL2A 3PX0A 4QZFA 4EBCA 2DRAA 5J2CA 5KG4A 1TFWA 5KFSA 2W8LA 5DLGA 4XRHA 1Z00A 4ECVA 3THVA 2R8KA 4F4KA 3PV8A 5KT7A 1MIYA 5KT5A 2DPIA 5KFQA 3MBYA 3UXPA 4F5PA 2ISOA 4DSJA 4RPXA 3C2KA 2LYHA 2Y1IA 4F5RA 4J9QA 2ZH6A 5J0SA 4DFPA 2PI4A 2W9MA 1V4AA 5DQIA 3FDSA 1RZTA 1SKSA 2A1JA 5DDMA 1TV9A 4O0IA 4F2RA 1BNOA 1T4GA 8ICKA 1PZNA 5J0UA 4UB2A 3EW9A 3AQMA 2AQ0A 3K75D 1UT5A 3RR8A 3M9NB 3EYZA 3GIMA 3C2LA 4JV1A 8ICIA 5KFMA 1NOMA 4YQWA 2W9AA 3Q8PB 1IXRA 3QZ7A 4ECWA 9ICJA 1R8AA 3HJ4A 2KN7A 3GDXA 3ZDDA 4I2FA 4FHXA 4HYKA 1S0NA 2M9NA 2XY6A 4FHPA 4WC3A 1Q78A 3JPTA 1X2IA 1NJYA 1SL2A 3LDAA 4P4MA 4DL4A 1U4BA 3LWMA 3BDPA 5J2IA 3ISBA 2VANA 2ZTEA 4KLFA 1SKWA 3TAQA 4FHVA 4X4UA 5HMMA 2BR0A 5J2HA 2DFLA 2ASLA 2DPJA 1R8BA 4FH3A 2NRZA 5HNKA 3JPQA 2JEJA 4XQ7A 3V7KA 4AT7A 1ZQHA 2AQ4A 2RDIA 1NJXA 2I9GA 4KLIA 4RNMA 4F93B 1WOTA 1VFGA 4J9MA 4DQIA 3H8JA 3Q8SB 4IQUA 3RAXA 4BXOA 2AJQA 4EBJA 1R8CA 7ICJA 4DS4A 3RR7A 4I29A 2ZH8A 3LWLA 1JXLA 3ZDEA 4DS5A 2ALZA 1NKBA 4X0AA 1QLNA 1TFRA 2F1IA 1RXWA 2IBKA 2Q0ZX 4ECQA 5KT4A 2FMQA 4RQ0A 4ECTA 3PW2A 7ICTA 3RB6A 3RH5A 1BNPA 2OWOA 2ZH5A 1TFYA 4UBBA 1TK5A 5BOMA 8ICJA 4PGXA 3GILA 4NKTA 4RQ2A 2W8KA 3MFIA 8ICTA 4IQTA 4ED0A 2ZH1A 2VA2A 3QEBZ 1ZQLA 5HHHA 5KFWA 2AU0A 4M2YA 1XSLA 2IMWP 4M6WA 4PHPA 4GXKA 3PO4A 1K1SA 2P6RA 4DWIA 4EEYA 4KLHA 4DOBA 1KNYA 4QZBA 2BQUA 4O3SA 1NK8A 4MEYA 3JPOA 2PXIA 4KLJA 4X4VA 2FPLA 4QZ8A 2J6UA 4KLMA 5DBCA 5J2AA 4YFKA 8ICXA 2MAXA 4FBTA 2W9CB 4EYHB 3ZDAA 5HREA 2DR7A 4YD1A 4QZIA 5J29A 4M04A 4TUSA 3EZ5A 1QTMA 3RJIA 4O3OA 5KFCA 5IIIA 9ICIA 4O5CA 4X4TA 1NJWA 4RQ7A 3TI0A 3RJFA 4X4RA 4Z6FA 3GIIA 4ED6A 4E7XA 3HX0A 3Q8LA 3T5KA 2HHTA 4I2DA 1KDHA 3HP6A 2V4QA 3HIYA 3HJ1A 3TFSA 4ECXA 4UB4A 3NTUA 8ICYA 2BPFA 5F2VO 4QZDA 1NKEA 2JZBA 5KFLA 2C22A 1ZQDA 3KTQA 2VA8A 1AROP 4DL3A 3M8SA 1D9DA 3RJEA 4QZEA 2JEIA 3OJSA 4RQ3A 3N97B 4R63A 9ICEA 9ICXA 5EOZA 9ICTA 1IM4A 2BPCA 1D9FA 4FH5A 3QE9Y 4S3NA 5KFZA 3SV4A 3M9OB 2R8IA 4QZGA 4DOCA 2FMPA 4F2SA 3MDAA 8ICMA 2ZUCA 3C23A 1NK7A 5J2KA 9ICFA 4E8FA 3SV3A 4LVSA 1BGXT 4DL5A 3WFOA 5KG0A 2UVWA 4DL6A 4DL7A 5KFYA 4PHAA 5KG7A 4YMNA 3Q8MA 1U47A 4NY8A 4Q43A 4DOAA 3WFRE 1BPEA 5KFRA 3M8RA 4QZCA 8ICFA 4IG8A 9ICRA 5J2DA 1BVSA 5CHGA 2DRBA 4B9NA 3OUYA 4R66A 3PX6A 3JYYA 5KG1A 2C2EA 2ZJ5A 4PH5A 3KHLA 4B9TA 1S0MA 2PBEA 4RQ5A 5IINA 3L9DA 2HHXA 5HRLA 5DKWA 4GLXA 2XY5A 5HRFA 4YD2A 4ATBB 4ED3A 3AUOA 3TQ1A 2C28A 3SZ2A 1T3NA 4C8MA 5DGAA 1L5UA 1ZQCA 1S0VA 3GIJA 4QW9A 4PHDA 2P66A 4KLTA 3ISDA 4QW8A 4Z6DA 4UBCA 4R65A 3RH6A 1T7PA 4NLNA 3KHRA 5DG7A 3SI8A 1UEVA 4KMUA 2BQ3A 4NM2A 5KT6A 3BQ1A 4DSKA 3UXOA 5KFTA 5IIOA 3OHAA 4PGYA 4B9LA 4DSLA 2IHNA 4ED8A 4ECRA 8ICSA 4QWDA 4YR2A 3MR3A 1HUOA 4RUCA 1ZQSA 4C8LA 2ZUBA 5DLFA 3V72A 3EPIA 1ZQPA 1KRPA 4KITB 3PMLA 4ED2A 1MC8A 1TKDA 1ZQBA 4R8UB 4J9KA 4O3RA 3GV7B 1ZQNA 4DLGA 5L1IA 7ICMA 3H38A 4RWNA 2XGQA 3PY8A 2M2UA 4AT9A 4WC6A 4C8OA 5KFDA 4QWEA 4KLSA 1UA1A 4DQPA 3KHHA 2MUTA 3RRHA 5J0YA 4EYIB 5J0PA 5CWRA 4IRDA 4YG2A 1ZQOA 3IM1A 4EBKA 4UB5A 3T3FA 1KTQA 3PW4A 4GC6A 1TK8A 4I2HA 1NO5A 2B21A 2IA6A 4BDPA 8ICHA 1NJZA 1DGSA 5BPCA 4RZRA 3JPNA 3H40A 4ED1A 2ASDA 2BCUA 4I2GA 4J9OA 4F92B 3ZDBA 2V4RA 1NK6A 1L3TA 1ZQQA 2DR5A 2P6UA 5J0QA 5D49A 4FS2A 5DDYA 2R8JA 4C8KA 1K1QA 3H4DA 3C5GA 2ZUDA 3IHQB 5D4BA 2FLNA 2RDJA 3WFQE 5KFKA 8ICVA 1MSWD 5F9LA 2ISPA 2HHSA 5EWGA 1L3VA 3K4GA 3G6VA 1ZQEA 2O1PA 2UVRA 1XO1A 5KFFA 1ZQXA 4EBEA 4FBUA 4RQ4A 1ZYQA 3RJHA 8ICBA 1PX5A 3PW5A 3OGUA 3C21A 1JX4A 5J0RA 3MGHA 2W9BB 4J9PA 4DSEA 4RQ8A 3C2MA 1WCNA 4F3OA 4KLGA 3B0YA 5KT3A 4DQRA 3AU6A 3UXNA 5CA7A 5EWFA 4ECUA 4ECZA 2DVIA 4KTQA 3C1YA 4LZDA 4WC5A 3FYHA 4AT8B 4JUZA 2FPKA 9ICSA 2RFFA 2JEGA 1LV5A 3H8WA 1T8EA 4K4IA 1YLQA 2KTQA 2NRXA 4IRCA 9ICCA 5HRIA 5L1KA 5HC9A 1JN3A 4M6WB 2ZHBA 5CJ7A 2BE3A 1NK4A 2HHPA 2ZJAA 3H7IA 3RAQA 4RNOA 1MQ3A 3PVXA 4B9SA 3JPRA 4B9MA 1TAQA 5J2EA 2PI5A 3Q8RB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J2G A;  4I27 A;  4RT2 A;  4XQ8 A;  1NZP A;  4O3P A;  1JXE A;  5KFU A;  1RYS A;  4M9G A;  1D8Y A;  7ICE A;  8ICQ A;  1TK0 A;  4I2E A;  3AQL A;  1KFD A;  5J0O A;  1QSY A;  3GFK B;  9ICU A;  8ICZ A;  4DLE A;  4YCX A;  1ZQT A;  1ZQV A;  2V9W A;  3ORY A;  4M0A A;  7ICF A;  3JZ0 A;  3RRG A;  2HW3 A;  8ICL A;  2ZH2 A;  4F5O A;  2KFZ A;  4KLQ A;  2R8G A;  4Q8E A;  3OSP A;  1BPB A;  4RPY A;  1KLN A;  2FLP A;  1U48 A;  1CUK A;  4TQS A;  3HT3 A;  9ICP A;  1ZET A;  5DB8 A;  4RQ6 A;  3GV8 B;  3BJY A;  5KFE A;  4C8N A;  4DSF A;  4P2H A;  7ICU A;  4RWP A;  2Q66 A;  4WC2 A;  2ZH9 A;  4UAY A;  4MF8 A;  2PFN A;  4KLD A;  1Y88 A;  1ZJN A;  3RBE A;  3PW0 A;  1RXV A;  7ICN A;  5HRB A;  4LT6 A;  2W9C A;  1ZQZ A;  4DQQ A;  2XCP A;  3MR5 A;  3RB0 A;  1L3U A;  5KFA A;  3V7J A;  1MQ2 A;  1COO A;  3MDC A;  3H8S A;  1U45 A;  3TAP A;  1XS9 D;  4DSI A;  4E80 A;  3OSN A;  1ZQY A;  2NRV A;  4YMO A;  4M9J A;  1N48 A;  4F91 B;  4F50 A;  4ELU A;  1KFT A;  5DB6 A;  8ICR A;  9ICL A;  2ID1 A;  4M9N A;  4PPX A;  3OUY B;  4J9L A;  4I2I A;  1N56 A;  7ICS A;  4YN4 A;  4YVZ A;  4X4Q A;  4X4S A;  5F9N A;  1ZQI A;  4X4N A;  2AGP A;  2BKE A;  3C1Z A;  2JEF A;  4KLU A;  1BPX A;  2XCA A;  4WC7 A;  2AGO A;  4DFM A;  3HW8 A;  2IHM A;  3RJK A;  3PW7 A;  7ICP A;  3OJU A;  5KG5 A;  1S0O A;  2ZHA A;  4YR3 A;  1HJP A;  8ICA A;  1X9W A;  5HR9 A;  3C5F A;  5BOL A;  4ZH4 A;  5KTQ A;  1ZQR A;  3RJG A;  4NKU A;  1JAJ A;  1KEJ A;  4XUS A;  2O5A A;  4YXM A;  1EXN A;  4JWM A;  2KP7 A;  1OU5 A;  4RWQ A;  5JUM A;  4J9R A;  5KFP A;  2ZH3 A;  5KG2 A;  4M5D A;  1Z00 B;  1NKC A;  9ICO A;  4WBZ A;  3N4M B;  3OV7 A;  4QWA A;  5C5J A;  4KN7 A;  4DFK A;  4QZA A;  2FLL A;  1BPD A;  2ATL A;  5KFN A;  4R64 A;  1UA0 A;  3TAN A;  4JWN A;  4RU9 A;  4K4H A;  4DFJ A;  4P4O A;  2PFP A;  4ATB A;  4I2A A;  1X9M A;  1U49 A;  1ZQF A;  1F5A A;  4YXJ A;  1X9S A;  3AQN A;  4F4Y A;  1BPY A;  3E2E A;  2A1J B;  1S77 D;  3RJJ A;  3KHG A;  1NK0 A;  1XWL A;  8ICP A;  2H5X A;  2ZJ8 A;  2BCQ A;  4NM1 A;  3V6H A;  2UVV A;  2HHW A;  9ICB A;  8ICU A;  2HVI A;  4RPZ A;  2XGP A;  3LQC B;  5DG9 A;  4DQS A;  1JMS A;  5IIL A;  2C2R A;  3ETL A;  1ZJM A;  3PMN A;  1QSS A;  4NLZ A;  2R8H A;  4PGQ A;  2BGW A;  4KLO A;  2M2V A;  1UEU A;  2DR8 A;  1V9P A;  5DED A;  1XU4 A;  4XA5 A;  8ICW A;  7ICI A;  4Q45 A;  3JPS A;  4I2C A;  4R8U A;  4MF2 A;  4YMM A;  1A76 A;  4DF4 A;  4YR0 A;  5J0T A;  4M9H A;  4UB3 A;  4DEZ A;  4F4W A;  9ICW A;  5HRK A;  4J9N A;  1SZP A;  4J9S A;  2ZTD A;  1S76 D;  3RBD A;  3G6X A;  5DB9 A;  2WTF A;  1QSL A;  4BWM A;  4AT7 B;  1NK9 A;  2ZH4 A;  5DGB A;  3SYZ A;  3GIK A;  5D46 A;  1CEZ A;  5HRD A;  4BXO B;  2ZH7 A;  4F5N A;  4GC7 A;  5HRG A;  5J2B A;  4UAW A;  5IIK A;  3Q8Q B;  4FO6 A;  2PFO A;  4BWJ A;  2F1H A;  2XO7 A;  4ELT A;  5DQH A;  3MGI A;  5KFH A;  4I2B A;  1UT8 A;  3PR4 A;  3JPP A;  3PO5 A;  2KZM A;  1KSP A;  3QEA Z;  4MEX A;  4WC0 A;  4BGD A;  9ICM A;  4G3I A;  3EWA A;  4MFC A;  3HWT A;  8ICO A;  4EP7 A;  1B43 A;  4JV0 A;  4TUP A;  1XC9 A;  2Y1J A;  5TZV A;  1S97 A;  1ZQM A;  1BPZ A;  4NLK A;  7ICO A;  5L1J A;  2FMS A;  3AU2 A;  3NGD A;  5J0X A;  4ECY A;  3H4B A;  4UD5 A;  2NRT A;  5KFV A;  2ASJ A;  9ICK A;  3ZDC A;  7ICR A;  4KLE A;  3H39 A;  3ZD9 A;  5HRH A;  3UQ0 A;  2W9B A;  1ZQU A;  3PX4 A;  4O3Q A;  4YP3 A;  5DEC A;  5DBA A;  5DQG A;  3BQ2 A;  3T5L A;  4F8R A;  2HHQ A;  1RYR A;  4DO9 A;  3OHB A;  1D8L A;  4TUQ A;  3UPQ A;  3TAR A;  4X5V A;  2DR9 A;  1ZQJ A;  4AT8 A;  5CR0 A;  4QZH A;  4CCH A;  8ICG A;  4Z6C A;  4IQW A;  1L3S A;  5KFB A;  1Z3E B;  3T5H A;  4F4Z A;  3OVS A;  4O3N A;  4UB1 A;  1ZQK A;  4IR1 A;  4O5K A;  9ICQ A;  4QZ9 A;  4Q44 A;  3PNC A;  2KZZ A;  4WBY A;  1XSN A;  4IR9 A;  4LZG A;  4ED7 A;  4FHW A;  3RH4 A;  3QZ8 A;  4I2J A;  5EWE A;  5HML A;  2BQR A;  5L1L A;  2J6S A;  2BCS A;  3ZD8 A;  1S9F A;  2UVU A;  4M9L A;  2JZB B;  5DB7 A;  4EBD A;  3GV5 B;  3V6K A;  2HHU A;  7ICV A;  9ICA A;  2GWS A;  3WFS C;  1DOQ A;  4QWC A;  4FHY A;  4FS1 A;  3RB3 A;  3BQT A;  4KLL A;  4EZ9 A;  3MFH A;  1Q79 A;  3G6Y A;  1DK3 A;  2BPG A;  4TUR A;  1XSP A;  4PHE A;  5IIJ A;  4DF8 A;  9ICN A;  4M47 A;  2KZ3 A;  4Z6E A;  4GXI A;  7ICH A;  2F1J A;  4UAZ A;  2XC9 A;  4GXJ A;  4RWO A;  4RNN A;  5IIM A;  2NRW A;  8ICC A;  1SL0 A;  1U9L A;  2J6T A;  4UQG A;  3UQ2 A;  1C7Y A;  1DK2 A;  8ICE A;  3WFP A;  2C2D A;  4JK1 A;  4IRK A;  3RB4 A;  1TAU A;  2ZTC A;  3T5J A;  4ECS A;  1SL1 A;  1HUZ A;  1R89 A;  3B0X A;  5DBB A;  4X4P A;  2I1Q A;  4F4X A;  3M9M B;  4QWB A;  3MR6 A;  7ICG A;  1VJ7 A;  4RQ1 A;  5CP2 A;  4IQV A;  7ICK A;  4WCW A;  3C66 A;  1UET A;  3PR5 B;  4B9U A;  5HP4 A;  2M2T A;  5J2F A;  3UPS A;  4KN4 A;  4I28 A;  4TQR A;  5KFG A;  1WCL A;  8ICN A;  1JQR A;  4WC4 A;  3TFR A;  2BHN A;  1FA0 A;  4NXZ A;  2BDP A;  2PFQ A;  5KFJ A;  4UD4 A;  4K4G A;  3H37 A;  2HHV A;  5DG8 A;  4EZ6 A;  5KG6 A;  3GQC A;  1TVA A;  5L9X A;  5J2J A;  5CB1 A;  4O9M A;  5KT2 A;  4F5Q A;  4X0B A;  2AGQ A;  1H38 A;  4O5E A;  3ISC A;  5J0W A;  1NK5 A;  5KG3 A;  1JIH A;  5KFO A;  4ELV A;  3MAB A;  9ICG A;  2M2W A;  3OVA A;  4RT3 A;  3V6J A;  3RTV A;  1SKR A;  9ICH A;  2KFN A;  4B9V A;  1MIW A;  4X4O A;  1ZQA A;  7ICQ A;  1B22 A;  2BCR A;  4P4P A;  3MR2 A;  7ICL A;  9ICV A;  1MIV A;  5HHI A;  3C18 A;  3Q8K A;  4NLG A;  2XY7 A;  4Q8F A;  3H3A A;  4E0D A;  3EPG A;  1ZQW A;  2FPM A;  3BQ0 A;  1A77 A;  2BCV A;  4AT9 B;  3HPO A;  3OVB A;  4RUA A;  3V7L A;  2VA3 A;  4JV2 A;  3LK9 A;  1ZQG A;  2MUT B;  3AQK A;  5KFI A;  4MFF A;  1LB2 B;  1RPL A;  4MFA A;  2NRK A;  5KFX A;  3NYB A;  1S10 A;  4WC1 A;  2HVH A;  1KFS A;  4DL2 A;  3PX0 A;  4QZF A;  4EBC A;  2DRA A;  5J2C A;  5KG4 A;  1TFW A;  5KFS A;  2W8L A;  5DLG A;  4XRH A;  1Z00 A;  4ECV A;  3THV A;  2R8K A;  4F4K A;  3PV8 A;  5KT7 A;  1MIY A;  5KT5 A;  2DPI A;  5KFQ A;  3MBY A;  3UXP A;  4F5P A;  2ISO A;  4DSJ A;  4RPX A;  3C2K A;  2LYH A;  2Y1I A;  4F5R A;  4J9Q A;  2ZH6 A;  5J0S A;  4DFP A;  2PI4 A;  2W9M A;  1V4A A;  5DQI A;  3FDS A;  1RZT A;  1SKS A;  2A1J A;  5DDM A;  1TV9 A;  4O0I A;  4F2R A;  1BNO A;  1T4G A;  8ICK A;  1PZN A;  5J0U A;  4UB2 A;  3EW9 A;  3AQM A;  2AQ0 A;  3K75 D;  1UT5 A;  3RR8 A;  3M9N B;  3EYZ A;  3GIM A;  3C2L A;  4JV1 A;  8ICI A;  5KFM A;  1NOM A;  4YQW A;  2W9A A;  3Q8P B;  1IXR A;  3QZ7 A;  4ECW A;  9ICJ A;  1R8A A;  3HJ4 A;  2KN7 A;  3GDX A;  3ZDD A;  4I2F A;  4FHX A;  4HYK A;  1S0N A;  2M9N A;  2XY6 A;  4FHP A;  4WC3 A;  1Q78 A;  3JPT A;  1X2I A;  1NJY A;  1SL2 A;  3LDA A;  4P4M A;  4DL4 A;  1U4B A;  3LWM A;  3BDP A;  5J2I A;  3ISB A;  2VAN A;  2ZTE A;  4KLF A;  1SKW A;  3TAQ A;  4FHV A;  4X4U A;  5HMM A;  2BR0 A;  5J2H A;  2DFL A;  2ASL A;  2DPJ A;  1R8B A;  4FH3 A;  2NRZ A;  5HNK A;  3JPQ A;  2JEJ A;  4XQ7 A;  3V7K A;  4AT7 A;  1ZQH A;  2AQ4 A;  2RDI A;  1NJX A;  2I9G A;  4KLI A;  4RNM A;  4F93 B;  1WOT A;  1VFG A;  4J9M A;  4DQI A;  3H8J A;  3Q8S B;  4IQU A;  3RAX A;  4BXO A;  2AJQ A;  4EBJ A;  1R8C A;  7ICJ A;  4DS4 A;  3RR7 A;  4I29 A;  2ZH8 A;  3LWL A;  1JXL A;  3ZDE A;  4DS5 A;  2ALZ A;  1NKB A;  4X0A A;  1QLN A;  1TFR A;  2F1I A;  1RXW A;  2IBK A;  2Q0Z X;  4ECQ A;  5KT4 A;  2FMQ A;  4RQ0 A;  4ECT A;  3PW2 A;  7ICT A;  3RB6 A;  3RH5 A;  1BNP A;  2OWO A;  2ZH5 A;  1TFY A;  4UBB A;  1TK5 A;  5BOM A;  8ICJ A;  4PGX A;  3GIL A;  4NKT A;  4RQ2 A;  2W8K A;  3MFI A;  8ICT A;  4IQT A;  4ED0 A;  2ZH1 A;  2VA2 A;  3QEB Z;  1ZQL A;  5HHH A;  5KFW A;  2AU0 A;  4M2Y A;  1XSL A;  2IMW P;  4M6W A;  4PHP A;  4GXK A;  3PO4 A;  1K1S A;  2P6R A;  4DWI A;  4EEY A;  4KLH A;  4DOB A;  1KNY A;  4QZB A;  2BQU A;  4O3S A;  1NK8 A;  4MEY A;  3JPO A;  2PXI A;  4KLJ A;  4X4V A;  2FPL A;  4QZ8 A;  2J6U A;  4KLM A;  5DBC A;  5J2A A;  4YFK A;  8ICX A;  2MAX A;  4FBT A;  2W9C B;  4EYH B;  3ZDA A;  5HRE A;  2DR7 A;  4YD1 A;  4QZI A;  5J29 A;  4M04 A;  4TUS A;  3EZ5 A;  1QTM A;  3RJI A;  4O3O A;  5KFC A;  5III A;  9ICI A;  4O5C A;  4X4T A;  1NJW A;  4RQ7 A;  3TI0 A;  3RJF A;  4X4R A;  4Z6F A;  3GII A;  4ED6 A;  4E7X A;  3HX0 A;  3Q8L A;  3T5K A;  2HHT A;  4I2D A;  1KDH A;  3HP6 A;  2V4Q A;  3HIY A;  3HJ1 A;  3TFS A;  4ECX A;  4UB4 A;  3NTU A;  8ICY A;  2BPF A;  5F2V O;  4QZD A;  1NKE A;  2JZB A;  5KFL A;  2C22 A;  1ZQD A;  3KTQ A;  2VA8 A;  1ARO P;  4DL3 A;  3M8S A;  1D9D A;  3RJE A;  4QZE A;  2JEI A;  3OJS A;  4RQ3 A;  3N97 B;  4R63 A;  9ICE A;  9ICX A;  5EOZ A;  9ICT A;  1IM4 A;  2BPC A;  1D9F A;  4FH5 A;  3QE9 Y;  4S3N A;  5KFZ A;  3SV4 A;  3M9O B;  2R8I A;  4QZG A;  4DOC A;  2FMP A;  4F2S A;  3MDA A;  8ICM A;  2ZUC A;  3C23 A;  1NK7 A;  5J2K A;  9ICF A;  4E8F A;  3SV3 A;  4LVS A;  1BGX T;  4DL5 A;  3WFO A;  5KG0 A;  2UVW A;  4DL6 A;  4DL7 A;  5KFY A;  4PHA A;  5KG7 A;  4YMN A;  3Q8M A;  1U47 A;  4NY8 A;  4Q43 A;  4DOA A;  3WFR E;  1BPE A;  5KFR A;  3M8R A;  4QZC A;  8ICF A;  4IG8 A;  9ICR A;  5J2D A;  1BVS A;  5CHG A;  2DRB A;  4B9N A;  3OUY A;  4R66 A;  3PX6 A;  3JYY A;  5KG1 A;  2C2E A;  2ZJ5 A;  4PH5 A;  3KHL A;  4B9T A;  1S0M A;  2PBE A;  4RQ5 A;  5IIN A;  3L9D A;  2HHX A;  5HRL A;  5DKW A;  4GLX A;  2XY5 A;  5HRF A;  4YD2 A;  4ATB B;  4ED3 A;  3AUO A;  3TQ1 A;  2C28 A;  3SZ2 A;  1T3N A;  4C8M A;  5DGA A;  1L5U A;  1ZQC A;  1S0V A;  3GIJ A;  4QW9 A;  4PHD A;  2P66 A;  4KLT A;  3ISD A;  4QW8 A;  4Z6D A;  4UBC A;  4R65 A;  3RH6 A;  1T7P A;  4NLN A;  3KHR A;  5DG7 A;  3SI8 A;  1UEV A;  4KMU A;  2BQ3 A;  4NM2 A;  5KT6 A;  3BQ1 A;  4DSK A;  3UXO A;  5KFT A;  5IIO A;  3OHA A;  4PGY A;  4B9L A;  4DSL A;  2IHN A;  4ED8 A;  4ECR A;  8ICS A;  4QWD A;  4YR2 A;  3MR3 A;  1HUO A;  4RUC A;  1ZQS A;  4C8L A;  2ZUB A;  5DLF A;  3V72 A;  3EPI A;  1ZQP A;  1KRP A;  4KIT B;  3PML A;  4ED2 A;  1MC8 A;  1TKD A;  1ZQB A;  4R8U B;  4J9K A;  4O3R A;  3GV7 B;  1ZQN A;  4DLG A;  5L1I A;  7ICM A;  3H38 A;  4RWN A;  2XGQ A;  3PY8 A;  2M2U A;  4AT9 A;  4WC6 A;  4C8O A;  5KFD A;  4QWE A;  4KLS A;  1UA1 A;  4DQP A;  3KHH A;  2MUT A;  3RRH A;  5J0Y A;  4EYI B;  5J0P A;  5CWR A;  4IRD A;  4YG2 A;  1ZQO A;  3IM1 A;  4EBK A;  4UB5 A;  3T3F A;  1KTQ A;  3PW4 A;  4GC6 A;  1TK8 A;  4I2H A;  1NO5 A;  2B21 A;  2IA6 A;  4BDP A;  8ICH A;  1NJZ A;  1DGS A;  5BPC A;  4RZR A;  3JPN A;  3H40 A;  4ED1 A;  2ASD A;  2BCU A;  4I2G A;  4J9O A;  4F92 B;  3ZDB A;  2V4R A;  1NK6 A;  1L3T A;  1ZQQ A;  2DR5 A;  2P6U A;  5J0Q A;  5D49 A;  4FS2 A;  5DDY A;  2R8J A;  4C8K A;  1K1Q A;  3H4D A;  3C5G A;  2ZUD A;  3IHQ B;  5D4B A;  2FLN A;  2RDJ A;  3WFQ E;  5KFK A;  8ICV A;  1MSW D;  5F9L A;  2ISP A;  2HHS A;  5EWG A;  1L3V A;  3K4G A;  3G6V A;  1ZQE A;  2O1P A;  2UVR A;  1XO1 A;  5KFF A;  1ZQX A;  4EBE A;  4FBU A;  4RQ4 A;  1ZYQ A;  3RJH A;  8ICB A;  1PX5 A;  3PW5 A;  3OGU A;  3C21 A;  1JX4 A;  5J0R A;  3MGH A;  2W9B B;  4J9P A;  4DSE A;  4RQ8 A;  3C2M A;  1WCN A;  4F3O A;  4KLG A;  3B0Y A;  5KT3 A;  4DQR A;  3AU6 A;  3UXN A;  5CA7 A;  5EWF A;  4ECU A;  4ECZ A;  2DVI A;  4KTQ A;  3C1Y A;  4LZD A;  4WC5 A;  3FYH A;  4AT8 B;  4JUZ A;  2FPK A;  9ICS A;  2RFF A;  2JEG A;  1LV5 A;  3H8W A;  1T8E A;  4K4I A;  1YLQ A;  2KTQ A;  2NRX A;  4IRC A;  9ICC A;  5HRI A;  5L1K A;  5HC9 A;  1JN3 A;  4M6W B;  2ZHB A;  5CJ7 A;  2BE3 A;  1NK4 A;  2HHP A;  2ZJA A;  3H7I A;  3RAQ A;  4RNO A;  1MQ3 A;  3PVX A;  4B9S A;  3JPR A;  4B9M A;  1TAQ A;  5J2E A;  2PI5 A;  3Q8R B; 
#chains in the Genus database with same CATH topology
 5J2G A;  4I27 A;  1Z1B A;  1RYS A;  2HMX A;  4I2E A;  3WKC A;  3QU4 A;  4YCX A;  1ZQT A;  3ORY A;  4M0A A;  7ICF A;  2ZH2 A;  2FLP A;  2AHO B;  5EE3 A;  3SEI A;  1ZET A;  5DB8 A;  4RQ6 A;  2Q66 A;  2ZH9 A;  2E8P A;  4UAY A;  1N60 A;  2JMG A;  2HCF A;  3QNM A;  2XCP A;  3CW2 C;  3KOO A;  1MQ2 A;  4BJQ A;  2E8N A;  3MDC A;  1U45 A;  1XS9 D;  4DSI A;  4E80 A;  4Y2X A;  1MA7 A;  4YMO A;  1N48 A;  4F91 B;  1KFT A;  5DB6 A;  2LBO A;  3B9J A;  2QAR B;  3OUY B;  3IRU A;  4J9L A;  1N56 A;  2KSO B;  4LJX A;  5F9N A;  5KL8 B;  1ZQI A;  2EAO A;  2VIX A;  5E79 U;  3QUC A;  4WC7 A;  1SV0 C;  2AGO A;  3HW8 A;  1S0O A;  2OH2 A;  2ZHA A;  5HR9 A;  1JAJ A;  3IG8 A;  2YMP A;  2HBK A;  5KFP A;  4J9R A;  5KG2 A;  1Z00 B;  9ICO A;  4WBZ A;  3N4M B;  5AI0 A;  2FLL A;  2ATL A;  3SAF A;  4DFJ A;  2PFP A;  2OEH A;  4UW9 A;  1ZQF A;  1F5A A;  4P0Q B;  5AKE A;  3E2E A;  3OTQ A;  1V85 A;  2H5X A;  2BCQ A;  2F8L A;  5C0Y A;  2KKV A;  9ICB A;  4RPZ A;  2DQN B;  3LQC B;  1Z19 A;  4K98 A;  5IIL A;  2C2R A;  4C4S A;  3PMN A;  4NLZ A;  4LEY A;  3NVW A;  5AI5 A;  1V9P A;  3RF9 A;  5AM3 A;  1RG6 A;  4XA5 A;  4WH5 A;  3JPS A;  1X6J A;  1A76 A;  3AN1 A;  2NV3 A;  4F4W A;  3C28 A;  5DB9 A;  2YB4 A;  1O03 A;  1CEZ A;  5HRD A;  5HRG A;  4UAW A;  5IIK A;  2PFO A;  4BWJ A;  2F1H A;  4ELT A;  3N7R C;  3MGI A;  3JPP A;  1KSP A;  3QEA Z;  9ICM A;  1FFU A;  3EWA A;  4MFC A;  8ICO A;  3A0B U;  1S97 A;  3SQI A;  1BPZ A;  7ICO A;  2K4E A;  4UD5 A;  9ICK A;  2ASJ A;  3ZDC A;  1V97 A;  1WUD A;  5HRH A;  5DBA A;  5DQG A;  3BQ2 A;  4DO9 A;  2A1A A;  1D8L A;  5ALH A;  4MHV A;  4X5V A;  3NRW A;  8ICG A;  5KFB A;  5B3Q A;  4F4Z A;  3OVS A;  4O3N A;  4ICA A;  1ZQK A;  4IR1 A;  3PST A;  4WBY A;  3QZ8 A;  1S9F A;  1N5W A;  5DB7 A;  7ICV A;  3NKU A;  1DOQ A;  4FS1 A;  4EZ9 A;  2BPG A;  4Y2Y A;  5IIJ A;  2KZ3 A;  4GXI A;  2ZIW A;  3UMG A;  4JLX A;  4OO1 J;  1SL0 A;  4Y2P A;  3UQ2 A;  2J6T A;  4EGW A;  4IRK A;  1TAU A;  3T5J A;  1SL1 A;  4X4P A;  4QWB A;  3MR6 A;  5CP2 A;  2Y9U A;  4IQV A;  4WCW A;  3ICX A;  4B9U A;  5HP4 A;  5J2F A;  3TAD C;  4TQR A;  1COK A;  1GO3 F;  4NXZ A;  2AH5 A;  5DG8 A;  1TVA A;  5J2J A;  4F5Q A;  3OVA A;  3QXG A;  1ZD4 A;  3WK6 A;  1SKR A;  4X4O A;  2H3Q A;  2BCR A;  2CN1 A;  2PKE A;  9ICV A;  4NJ8 A;  1MIV A;  3C18 A;  2FE9 A;  1PK1 B;  1ZQW A;  3BQ0 A;  3QX7 A;  4P0P B;  3GU3 A;  3LK9 A;  4MFF A;  2HOQ A;  2NRK A;  4WC1 A;  4K8V A;  3KZI U;  4QZF A;  2F3N A;  4K9B A;  5KG4 A;  3L5K A;  2R8K A;  4F4K A;  3C29 A;  5CHE A;  5ALM A;  2EDU A;  5KFQ A;  2HOF A;  2DKX A;  5J0S A;  1V4A A;  2W9M A;  3D6J A;  2NYV A;  2KJ8 A;  1SKS A;  2A1J A;  4F2R A;  3L3F X;  3TAC B;  2WF5 A;  1KL9 A;  2K4P A;  3IN5 A;  1IIP A;  2K4H A;  2AQ0 A;  4JB3 A;  1T3Q A;  3K75 D;  1UT5 A;  1ZD5 A;  2KK0 A;  3HJ4 A;  3Q8P B;  1R8A A;  2ZG6 A;  2KKP A;  2LM1 A;  3CP8 A;  3JPT A;  1NJY A;  4DL4 A;  1U4B A;  2VAN A;  1SKW A;  1SXE A;  1KBU A;  1S5L U;  2NRZ A;  5D62 A;  1ZQH A;  2I9G A;  2RDI A;  4J9M A;  3H8J A;  3Q8S B;  4IQU A;  2AJQ A;  1Q8K A;  2D3D A;  4EX7 A;  1R8C A;  2OXO A;  4I29 A;  1JXL A;  1RQL A;  3ALR A;  1JI7 A;  4X0A A;  1TFW A;  1BNP A;  5KT4 A;  4ECT A;  2DGZ A;  1TK5 A;  3MFI A;  2G09 A;  2VA2 A;  2I5H A;  2IMW P;  4GXK A;  3PO4 A;  1K1S A;  4DWI A;  4EEY A;  1SXD A;  3QU2 A;  4O3S A;  2FPL A;  5B3P A;  3NVY A;  1L8O A;  2Y0S C;  3KKA C;  5HRE A;  3N28 A;  2DR7 A;  2EWR A;  2ZIX A;  5AKG A;  4O3O A;  4O5C A;  1NJW A;  4RQ7 A;  1ECW A;  2K4I A;  3GII A;  3BQ7 A;  2D6F C;  1KDH A;  4ECX A;  5F2V O;  2LHT A;  2VA8 A;  2W7P A;  3RJE A;  4RQ3 A;  9ICE A;  9ICT A;  4FH5 A;  2XID A;  4Y2V A;  3M9O B;  5J8Y A;  4KMO B;  2XI9 A;  3C23 A;  1NK7 A;  4E8F A;  3SV3 A;  4AP9 A;  5KG0 A;  2F77 X;  1M6Y A;  4NY8 A;  4YMN A;  1U47 A;  5ALY A;  4Q43 A;  4DOA A;  5FP0 A;  4C0Z A;  5J2D A;  1BVS A;  9ICR A;  3OUY A;  2H3F A;  3PX6 A;  2JH1 A;  4B9T A;  5DKW A;  4RQM A;  1L5U A;  1T3N A;  1ZQC A;  1PX5 A;  5DGA A;  1S0V A;  4OJL A;  1N2X A;  3GIJ A;  2WF7 A;  4QW8 A;  3RH6 A;  4PZO A;  4KMU A;  5KT6 A;  4PZN A;  5KFT A;  5JTI A;  5IIO A;  4DSL A;  5JU5 A;  3MR3 A;  1HUO A;  4C8L A;  3ETR A;  3V72 A;  1ZQP A;  5AM0 A;  5AIC A;  2YMM A;  1PVP A;  2XGQ A;  4A8E A;  4C8O A;  5KFD A;  4KLS A;  3LYS A;  4DQP A;  4FFD A;  3RRH A;  5J0P A;  1DGS A;  5BPC A;  3H40 A;  3NRZ A;  1ZXI A;  2DR5 A;  3R9K A;  2P6U A;  4FS2 A;  3C66 A;  4MKP A;  2ZUD A;  5KFK A;  2KNJ A;  5F9L A;  5EWG A;  4I0U A;  2UVR A;  1F44 A;  4WQK A;  8ICB A;  5AKL A;  2WF9 A;  1JX4 A;  5J0R A;  4IL6 U;  3C2M A;  4KLG A;  2OYY A;  3AU6 A;  2DVI A;  4LZD A;  4EEN A;  2RFF A;  1DGJ A;  3H8W A;  5ALZ A;  5HC9 A;  5L1K A;  4M6W B;  5CJ7 A;  3H7I A;  3RAQ A;  4RNO A;  1MQ3 A;  1SGG A;  1TAQ A;  2PI5 A;  3Q8R B;  4RT2 A;  4O3P A;  1JXE A;  1AQ6 A;  1TK0 A;  3WK4 A;  2KVC A;  8ICZ A;  4DLE A;  2YN4 A;  1IG6 A;  2ZIW B;  5JTG A;  3WK8 A;  2HW3 A;  8ICL A;  3HJE A;  2KFZ A;  1BPB A;  4RPY A;  1KLN A;  9ICP A;  1S8O A;  3S6J A;  4P2H A;  3D2Q A;  4RWP A;  2QKQ A;  4MF8 A;  4UAT A;  4KLD A;  4UB8 U;  3RBE A;  2W9C A;  1ZQZ A;  4PL2 A;  5AKJ A;  2B6G A;  3MR5 A;  4NLC A;  5KFA A;  2QLT A;  3TAP A;  3OSN A;  1Z4N A;  4O3M A;  2NRV A;  3NAS A;  4F50 A;  3MGV A;  3CYM A;  9ICL A;  4PPX A;  5ALX A;  7ICS A;  4K96 A;  4X4N A;  2AGP A;  3C1Z A;  1Q3V A;  2G0A A;  4DFM A;  2IHM A;  3RJK A;  2HSZ A;  5KG5 A;  5KTQ A;  1ZQR A;  4NKU A;  4XUS A;  4YXM A;  3PSP A;  1EXN A;  4JWM A;  4RWQ A;  5JUM A;  2ZH3 A;  4M5D A;  1NKC A;  3OV7 A;  5C5J A;  4KN7 A;  4QZA A;  1BPD A;  1UA0 A;  4JWN A;  4K4H A;  1YZ6 A;  4P4O A;  1TE2 A;  2EAN A;  2JV3 A;  1X9M A;  1U49 A;  1RM6 C;  4YXJ A;  1X9S A;  4F4Y A;  2A1J B;  1S77 D;  3QU7 A;  4CF3 A;  3V6H A;  2HVI A;  2XGP A;  2KOB A;  4NL9 A;  4DQS A;  4ZOH C;  2Y0S F;  3UMB A;  1QSS A;  2R8H A;  2M2V A;  1UEU A;  4QJF B;  8ICW A;  7ICI A;  4Q45 A;  4CNQ A;  2H3I A;  1SWW A;  4UB3 A;  5HRK A;  1S76 D;  3G6X A;  1QSL A;  4BWM A;  5DGB A;  3SYZ A;  2DF4 B;  5D46 A;  4O6A A;  1PK3 A;  1UCV A;  3K7D A;  3Q8Q B;  4FO6 A;  2XO7 A;  4NLG A;  5DQH A;  2KZM A;  3PR4 A;  4WC0 A;  4BGD A;  3L4P A;  3SD7 A;  4EP7 A;  3HWT A;  1B43 A;  4TUP A;  1XC9 A;  2H3V A;  5GTH U;  1ZQM A;  2DKZ A;  3NGD A;  4C4T A;  4K99 A;  4K9A A;  3IDW A;  3QYP A;  2OM6 A;  3KZX A;  1KQQ A;  4KLE A;  3ZD9 A;  3PX4 A;  3NVZ A;  4F8R A;  4TUQ A;  1VJ5 A;  3N7S C;  5ALS A;  5AKY A;  4AT8 A;  5CR0 A;  5B66 U;  4Z6C A;  4IQW A;  2ZIX B;  1ZQ1 C;  1ED1 A;  3PNC A;  2AXT U;  4QIW C;  4NXW A;  1XSN A;  4FHW A;  4FHX A;  4I2J A;  2J6S A;  2UVU A;  5L1L A;  2BCS A;  4EBD A;  2HHU A;  3V6K A;  9ICA A;  4QWC A;  3BQT A;  4OCZ A;  3G6Y A;  4TUR A;  1QQ6 A;  4PHE A;  2LYA A;  4DF8 A;  9ICN A;  4M47 A;  4Z6E A;  3ER8 C;  7ICH A;  2F1J A;  4RWO A;  1U9L A;  4JK1 A;  3RB4 A;  2KMD A;  2ZTC A;  2CRX A;  5L1M A;  3B0X A;  5DBB A;  7ICG A;  4NXV A;  5KL1 B;  1UET A;  3ONN A;  3PR5 B;  2M2T A;  5D61 A;  2QB1 A;  8ICN A;  1F0M A;  3TFR A;  2BHN A;  3MC1 A;  5KFJ A;  4K4G A;  3SR6 A;  5KT2 A;  3KFU F;  4X0B A;  4O5E A;  5K4L A;  3ISC A;  4US9 A;  1NK5 A;  2M2W A;  5KG3 A;  5KFO A;  4ELV A;  9ICG A;  4RT3 A;  9ICH A;  1ZQA A;  3H0R B;  4CDG A;  3LVV A;  7ICL A;  3Q8K A;  4Q8F A;  2XY7 A;  4O67 A;  3H3A A;  4WQL A;  2FPM A;  2BBH A;  3BS7 A;  2KHQ A;  2W3R A;  4RUA A;  1A6S A;  5KFI A;  2HDO A;  4DL2 A;  4CRX A;  3PX0 A;  2WF6 A;  5KFS A;  3BZK A;  3IP4 B;  4ECV A;  3PV8 A;  5KT7 A;  4F5P A;  1FFV A;  4FZL A;  4DSJ A;  2Y1I A;  4J9Q A;  4DFP A;  1RZT A;  1TV9 A;  1J2M A;  2B51 A;  1T4G A;  5CRX A;  1Z1V A;  3EW9 A;  2KHV A;  3BZC A;  3RR8 A;  3EYZ A;  3C2L A;  4JV1 A;  5KFM A;  1IXR A;  2OHF A;  2XY6 A;  1SL2 A;  2K8A A;  3LWM A;  4KLF A;  3ISB A;  2ZTE A;  3TAQ A;  2BR0 A;  3PSF A;  2ASL A;  4XQ7 A;  3JPQ A;  4AT7 A;  3V7K A;  2KVS A;  3VC8 A;  4KLI A;  4RNM A;  4F93 B;  1WOT A;  3WKD A;  5CFT A;  2ZXI A;  7ICJ A;  4DS4 A;  2ALZ A;  1NKB A;  5A0L A;  3JYY A;  7ICT A;  1TFY A;  4UAR A;  3GIL A;  1VLB A;  3QEB Z;  1XSL A;  4M6W A;  1NK8 A;  2PXI A;  4KLJ A;  2IHO A;  3QU9 A;  1SV0 A;  2WFA A;  2W9C B;  4EYH B;  3ZDA A;  4YD1 A;  4QZI A;  3AL0 B;  3QUQ A;  5G5H A;  2N1R A;  4ED6 A;  4E7X A;  2ZIU A;  3HX0 A;  3T5K A;  2HHT A;  4I2D A;  3HJ1 A;  5ALV A;  5AKH A;  2EQY A;  2BPF A;  2JZB A;  4PL1 A;  5KFL A;  2C22 A;  1ARO P;  2FJ6 A;  4BX9 C;  3M8S A;  2KV2 A;  4EED A;  2XVT A;  1J2N A;  5EOZ A;  2BPC A;  4U6P A;  3M6Z A;  1D9F A;  1QQ5 A;  5KAF U;  5KFZ A;  4DOC A;  3MDA A;  2A3V A;  5AM2 A;  3PZP A;  5ALG A;  1BGX T;  4DL5 A;  3SMV A;  3Q8M A;  1X6I A;  3WKE A;  4QZC A;  8ICF A;  4IG8 A;  4B9N A;  2D8C A;  2MSN A;  3KHL A;  5IIN A;  3U26 A;  5HRL A;  2WF8 A;  1NI3 A;  3TQ1 A;  2C28 A;  2KIC A;  3AEV A;  4QW9 A;  4Z6D A;  4R65 A;  1T7P A;  3KHR A;  5DG7 A;  2F44 A;  3SI8 A;  1UEV A;  1RQN A;  3DV9 A;  3OHA A;  4PGY A;  2IHN A;  4YR2 A;  2H3Z A;  2KJ9 A;  4KIT B;  2FI1 A;  3BS5 B;  1ZQB A;  2E3T A;  5AKZ A;  4J9K A;  4O3R A;  7ICM A;  2WB1 C;  4NLB A;  1ZOL A;  4QIW F;  1WWV A;  2KE7 A;  4AT9 A;  2ESE A;  3I28 A;  2GAF D;  5J0Y A;  3FAH A;  4OJ6 A;  5J8Y C;  4IRD A;  3T3F A;  4I2H A;  4EEL A;  5AK5 A;  3NVO A;  4J03 A;  3JPN A;  4ED1 A;  4J9O A;  1NK6 A;  1O08 A;  5J0Q A;  5D49 A;  2R8J A;  4C8K A;  3H4D A;  2GA9 D;  3C5G A;  3WFQ E;  2FLN A;  3ED5 A;  1MSW D;  1F5S A;  2ISP A;  3K4G A;  2O1P A;  2BZF A;  2O6K A;  4FBU A;  2YML A;  1ZYQ A;  4DSE A;  5HR6 A;  1WCN A;  4F3O A;  2JGA A;  4ECU A;  5ALR A;  5CA7 A;  4KTQ A;  2ZXH A;  2BBJ A;  4AT8 B;  2FPK A;  3CRX A;  1T8E A;  2KTQ A;  3F5A A;  9ICC A;  5HRI A;  4LEV A;  2BE3 A;  2EH9 A;  2ZJA A;  2HBL A;  4B9M A;  3TAD A;  4G9B A;  2EZX A;  5EE1 A;  3AQL A;  5J0O A;  9ICU A;  2LM4 A;  2MA1 A;  1ZQV A;  4F5O A;  4KLQ A;  5H2F U;  1U48 A;  2E8O A;  1CUK A;  1RYU A;  4EEK A;  1UQV A;  4DSF A;  5KFE A;  4C8N A;  3AQE A;  2WHE A;  4UAV A;  1Y88 A;  1ZJN A;  3PW0 A;  1RXV A;  4LT6 A;  2HOI A;  1L3U A;  5G5G A;  3AM9 A;  3H8S A;  3ZI4 A;  1OUQ A;  2M0N A;  4UAU A;  4M9J A;  4F72 A;  4ELU A;  8ICR A;  2ID1 A;  3HIL A;  4M9N A;  4I2I A;  4KX5 A;  5F3X B;  4YN4 A;  4GFJ A;  4YVZ A;  4X4S A;  2JHD A;  2JEF A;  4KLU A;  1BPX A;  2XCA A;  2HN2 A;  3OJU A;  8ICA A;  1X9W A;  1KEJ A;  1N62 A;  2KP7 A;  1SWV A;  1QQ7 A;  4C80 A;  4DFK A;  1N63 A;  4R64 A;  5AK6 A;  4HAI A;  4RU9 A;  4ATB A;  2DL0 A;  2QB0 B;  1MN8 A;  3F2B A;  3AQN A;  1BPY A;  1NK0 A;  8ICP A;  3FC4 A;  4NM1 A;  2HHW A;  2RQ5 A;  3HKZ C;  3KBB A;  3H8M A;  4PGQ A;  2BGW A;  4MF2 A;  4YMM A;  4DF4 A;  4B6J A;  5J0T A;  1Z4O A;  4M9H A;  4DEZ A;  9ICW A;  2FCL A;  4J9N A;  2ZTD A;  2WTF A;  1PUZ A;  4AT7 B;  2ZH4 A;  2E5S A;  5CFU A;  2PMZ C;  2ZH7 A;  4F5N A;  4GC7 A;  5J2B A;  3KKA A;  5KNI A;  3PO5 A;  3EUB 2;  4O69 A;  4JV0 A;  2F2A B;  2Y1J A;  4CGZ A;  3F2C A;  2FMS A;  3AU2 A;  5J0X A;  2NRT A;  5AHX A;  7ICR A;  2JXJ A;  2W9B A;  1ZQU A;  4O3Q A;  4YP3 A;  2HHQ A;  1LVH A;  3UPQ A;  2DR9 A;  1LKY A;  1ZQJ A;  4QZH A;  3VCB A;  4CCH A;  3T5H A;  3QUB A;  4O5K A;  2E1F A;  3DDH A;  4OJO A;  2ZIU B;  2G5H B;  4IR9 A;  4K97 A;  5HML A;  4XJE A;  2JZB B;  3GV5 B;  2WB1 F;  2W04 A;  4FHY A;  3RB3 A;  3J81 j;  1Q79 A;  2Q4T A;  1DK3 A;  2EZZ A;  2W7O A;  2XC9 A;  2WAQ C;  1KW4 A;  2B4V A;  4UQG A;  1DK2 A;  2HBM A;  3SAH A;  3WFP A;  1HUZ A;  4ECS A;  2I1Q A;  3M9M B;  3F53 A;  1VJ7 A;  3CK6 A;  2NO5 A;  3N7P D;  3LVW A;  3UPS A;  4I28 A;  2MU2 A;  1FA0 A;  2G5I B;  3H37 A;  2HHV A;  4EZ6 A;  5KG6 A;  1KN5 A;  4O9M A;  1V38 A;  2AGQ A;  2KIV A;  3ERC C;  3MAB A;  1MIW A;  2NO4 A;  4B9V A;  1B22 A;  2GO7 A;  4P4P A;  4NXU A;  4RQN A;  4ACO A;  5HHI A;  4OAF A;  4E0D A;  1SV4 A;  1A77 A;  4AT9 B;  3HPO A;  2VA3 A;  1ZQG A;  4MFA A;  3NYB A;  5KFX A;  1KFS A;  4EBC A;  2DRA A;  5J2C A;  2HN1 A;  2EAM A;  4XRH A;  4OJP A;  3I76 A;  3BS5 A;  5KT5 A;  3UXP A;  2ISO A;  4RPX A;  3C2K A;  4F5R A;  2ZH6 A;  2PI4 A;  5DQI A;  2JR5 A;  5DDM A;  4O0I A;  2ODG A;  2VJ5 A;  2KD1 A;  8ICI A;  4YQW A;  1NOM A;  2W9A A;  4ECW A;  2KN7 A;  4I2F A;  4FHP A;  2ZH8 A;  2K8C B;  1S0N A;  2M9N A;  4WC3 A;  1X2I A;  3LDA A;  4P4M A;  3BDP A;  5J2I A;  4FHV A;  4X4U A;  5HMM A;  2DPJ A;  2DFL A;  1R8B A;  2JEJ A;  5HNK A;  1NJX A;  1VFG A;  4BXO A;  4F71 A;  3RR7 A;  3LWL A;  1PVQ A;  4DCC A;  5AM5 A;  3NS1 A;  1QLN A;  1DRG A;  1TFR A;  2IBK A;  2Q0Z X;  4ECQ A;  3RB6 A;  3RH5 A;  2OWO A;  3AQF A;  5JRT A;  5BOM A;  5ALD A;  4PGX A;  4NKT A;  8ICT A;  4ED0 A;  1ZQL A;  5HHH A;  5KFW A;  4M2Y A;  3D2N A;  2P6R A;  2RRD A;  5ALF A;  4BUG A;  2W55 A;  5ALU A;  4MEY A;  3JPO A;  2J6U A;  2DUY A;  4KLM A;  8ICX A;  4FBT A;  1YZ7 A;  5AK4 A;  2KG5 A;  2MRL A;  4TUS A;  3EZ5 A;  1QTM A;  3HKZ F;  3RJI A;  3TI0 A;  3WU2 U;  4X4R A;  4Z6F A;  3Q8L A;  3HIY A;  2LPE A;  2V4Q A;  3TFS A;  4O68 A;  4UB4 A;  3NTU A;  1NKE A;  1ZQD A;  1HIW A;  4LEW A;  2LI6 A;  3OJS A;  3N97 B;  1QH9 A;  9ICX A;  1IM4 A;  3MCR A;  3QE9 Y;  4EX6 A;  3SV4 A;  2P35 A;  2PMZ F;  4QZG A;  4F2S A;  1L7N A;  8ICM A;  2ZUC A;  5CFS A;  4LVS A;  4DL6 A;  4PHA A;  3WFR E;  2LMR A;  1BPE A;  1X42 A;  2ZIV A;  5KG1 A;  4PH5 A;  4RQ5 A;  3L9D A;  5AIA A;  2HHX A;  2OCE A;  2XY5 A;  5AI6 A;  4ED3 A;  3AUO A;  4ATB B;  3SZ2 A;  4C8M A;  4HX0 A;  2GLE A;  3H39 A;  4UBC A;  4NM2 A;  3BQ1 A;  4B9L A;  4ED8 A;  4ECR A;  8ICS A;  5DLF A;  3EPI A;  3E58 A;  1B4F A;  1TKD A;  5ALW A;  1FIQ A;  2KEY A;  2QB0 A;  4RWN A;  2M2U A;  4WC6 A;  4QWE A;  1UA1 A;  2MUT A;  3WKB A;  5CWR A;  1ZQO A;  3T79 A;  1NO5 A;  5AKK A;  4GC6 A;  1TK8 A;  2B21 A;  4BDP A;  8ICH A;  2ASD A;  4F92 B;  1X40 A;  2V4R A;  3F2D A;  2BDU A;  2WAQ F;  1L3T A;  1ZQQ A;  2IUB A;  1JRP A;  4JLZ A;  5DDY A;  1K1Q A;  4OJ5 A;  5D4B A;  4CF5 A;  2RDJ A;  4DFD A;  1XO0 A;  1L3V A;  3G6V A;  4USA A;  1ZQE A;  2FDR A;  1CI4 A;  3F5E A;  1ZQX A;  4RQ4 A;  3PW5 A;  2W9B B;  4J9P A;  4EV6 A;  4NXT A;  4DQR A;  2F8K A;  5AM1 A;  5EWF A;  4ECZ A;  4QNL A;  2RP5 A;  3C1Y A;  4GIB A;  1LKY B;  3FYH A;  2VJ4 A;  4U7C A;  1YLQ A;  2G07 A;  5AM4 A;  2NRX A;  4IRC A;  1VDV A;  1JN3 A;  2ZHB A;  2R18 A;  1NK4 A;  2VKQ A;  2B56 A;  5J2E A;  1JMS A;  1NZP A;  4XQ8 A;  5KFU A;  8ICQ A;  4M9G A;  1D8Y A;  7ICE A;  1KFD A;  1QSY A;  3GFK B;  4N7R A;  4KX3 A;  2KIW A;  2V9W A;  3JZ0 A;  3RRG A;  2R8G A;  4Q8E A;  3OSP A;  1JUD A;  1TAM A;  4TQS A;  3HT3 A;  4UAS A;  1SB3 C;  7ICU A;  3GV8 B;  3BJY A;  2CXY A;  4WC2 A;  2PFN A;  7ICN A;  5HRB A;  2JH7 A;  4DQQ A;  3DEE A;  3RB0 A;  4FE3 A;  3V7J A;  1COO A;  2YX8 A;  1ZQY A;  5GTI U;  1FO4 A;  2YMQ A;  4X4Q A;  1P7D A;  3WK7 A;  2BKE A;  1X9X A;  3EF2 A;  5KAI U;  3PW7 A;  7ICP A;  1L7P A;  4YR3 A;  1HJP A;  3WK5 A;  3C5F A;  5BOL A;  4ZH4 A;  3RJG A;  2O5A A;  3RFA A;  1FEZ A;  1OU5 A;  2L5Y A;  4Y2S A;  3A0H U;  4QWA A;  3K1R B;  1JRO A;  5KFN A;  3NWI A;  3TAN A;  4I2A A;  4WJ3 B;  2E1E A;  1URJ A;  3RJJ A;  3KHG A;  1XWL A;  2YB1 A;  2ZJ8 A;  1XNS A;  2UVV A;  8ICU A;  5DG9 A;  4Y2T A;  3ETL A;  1ZJM A;  3D2S A;  4KLO A;  2DR8 A;  5DED A;  1XU4 A;  4I2C A;  4R8U A;  4Y2U A;  4YR0 A;  3PHZ A;  1SZP A;  2LYB A;  4J9S A;  4JMU A;  3RBD A;  3WKA A;  1NK9 A;  5T14 A;  1N61 A;  5ALO A;  3GIK A;  4BXO B;  1WG8 A;  4NXX A;  1ZRM A;  2HI0 A;  1OW5 A;  3GZF A;  2G08 A;  5AKX A;  5KFH A;  5ALK A;  1UT8 A;  4I2B A;  3SAG A;  4MEX A;  2YY6 A;  4G3I A;  1Q3U A;  4NWI A;  5TZV A;  4CF4 A;  4NLK A;  4KM5 A;  5L1J A;  2HBJ A;  3QU5 A;  4ECY A;  3H4B A;  5AI8 A;  5KFV A;  2W54 A;  3H0L B;  3UQ0 A;  5DEC A;  3T5L A;  1C20 A;  1RYR A;  3QUT A;  3OHB A;  3TAR A;  1Q46 A;  1L3S A;  1Z3E B;  4UB1 A;  1DXS A;  9ICQ A;  4QZ9 A;  4Q44 A;  2KZZ A;  4OD0 A;  4LZG A;  4ED7 A;  3RH4 A;  5EWE A;  2BQR A;  2F76 X;  3ZD8 A;  2PBE A;  4M9L A;  1N5X A;  2GWS A;  3WFS C;  4KLL A;  3MFH A;  2LKY A;  1XSP A;  5B5E U;  4KB6 A;  4UAZ A;  4GXJ A;  4RNN A;  5IIM A;  2NRW A;  8ICC A;  4CE6 A;  3O0F A;  1C7Y A;  8ICE A;  2C2D A;  3WK9 A;  2YQE A;  1L7O A;  1R89 A;  4C4R A;  3NVV A;  2ZIV B;  4F4X A;  4RQ1 A;  7ICK A;  4KN4 A;  5KFG A;  1WCL A;  3I1Y A;  1JQR A;  4WC4 A;  5EE9 A;  4OAI Z;  4AYB C;  2B0C A;  4US8 A;  2BDP A;  2PFQ A;  1ZD2 P;  4UD4 A;  5AKI A;  3GQC A;  4LEZ A;  5ALL A;  5L9X A;  5CB1 A;  1H38 A;  5J0W A;  1JIH A;  2JRZ A;  2QAR A;  3RTV A;  3V6J A;  2KFN A;  1WWU A;  7ICQ A;  2KSO A;  3MR2 A;  2IOH A;  1GPJ A;  3EPG A;  2K8B B;  2BCV A;  3OVB A;  2Y9T A;  3V7L A;  4JV2 A;  2MUT B;  3AQK A;  4Y2Q A;  1LB2 B;  1SIJ A;  1RPL A;  2G06 A;  1S10 A;  2E8M A;  2HVH A;  1K5O A;  2W8L A;  5DLG A;  1Z00 A;  4EEB A;  3THV A;  1MIY A;  2DPI A;  3MBY A;  2W11 A;  2EAP A;  2LYH A;  4WOY A;  2W3S A;  1UPH A;  3FDS A;  4P0Q A;  1BNO A;  3TKA A;  2ES6 A;  4FZM A;  5AIB A;  8ICK A;  1PZN A;  4Y2J A;  5J0U A;  4UB2 A;  3AQM A;  3M9N B;  3GIM A;  4C7Z A;  3OWG A;  3CNH A;  9ICJ A;  3QZ7 A;  3GDX A;  3ZDD A;  4HYK A;  1Q78 A;  3E0F A;  2W43 A;  5ALQ A;  5J2H A;  4FH3 A;  2AQ4 A;  2DBY A;  4DQI A;  3RAX A;  4EBJ A;  2IOF K;  1CRX A;  2Z7J A;  5TIS U;  3ZDE A;  4NL9 C;  3UM9 A;  4DS5 A;  5AK3 A;  2F1I A;  1RXW A;  2FMQ A;  4FZN A;  4RQ0 A;  3PW2 A;  2ZH5 A;  4PJ0 U;  4UBB A;  8ICJ A;  4RQ2 A;  2W8K A;  2RLT A;  4IQT A;  2ZH1 A;  2AU0 A;  2YTU A;  4C7Y A;  4PHP A;  4KLH A;  1KNY A;  4DOB A;  4QZB A;  2BQU A;  4OAH A;  4X4V A;  1ZD3 A;  5D63 A;  4QZ8 A;  5DBC A;  5J2A A;  4YFK A;  5HR7 A;  2MAX A;  5EE0 A;  1B0X A;  1YT3 A;  5J29 A;  4M04 A;  3UMC A;  5KFC A;  2IOF A;  5III A;  9ICI A;  4X4T A;  1X66 A;  4NV0 A;  3RJF A;  5ALE A;  1ZRN A;  4OAG A;  5AI4 A;  1L6N A;  3HP6 A;  5ALJ A;  2CPR A;  8ICY A;  4QZD A;  3KTQ A;  4FO1 A;  3JCF A;  4DL3 A;  1D9D A;  2JEI A;  4QZE A;  1JAL A;  3PSI A;  4R63 A;  1NNL A;  4S3N A;  2R8I A;  2FMP A;  5J2K A;  9ICF A;  3WFO A;  2UVW A;  4DL7 A;  5KFY A;  5KG7 A;  2W03 A;  3M8R A;  5KFR A;  2A19 A;  2DRB A;  5CHG A;  1QCK A;  2K89 A;  4R66 A;  1A0P A;  2C2E A;  2ZJ5 A;  1J97 A;  1S0M A;  3FM9 A;  5HRF A;  4GLX A;  2XIC A;  3K1Z A;  5ALP A;  4YD2 A;  3KD3 A;  2I6X A;  3SEN A;  1WYG A;  1IV8 A;  2P66 A;  4PHD A;  4KLT A;  3ISD A;  1NZB A;  4NLN A;  4DSK A;  2BQ3 A;  3UXO A;  3HRD D;  2RHF A;  3IV6 A;  4QWD A;  4RUC A;  1ZQS A;  2ZUB A;  4UB6 U;  1KRP A;  3PML A;  4ED2 A;  5ALI A;  1MC8 A;  1OXJ A;  1HEK A;  2GH1 A;  5CEH A;  4R8U B;  3GV7 B;  2K60 A;  1ZQN A;  3M7D A;  4DLG A;  5L1I A;  3H38 A;  4P0P A;  1PK1 A;  3PY8 A;  5ALT A;  2DWQ A;  2GOL A;  3KHH A;  1D8B A;  3AMZ A;  4EYI B;  3OPX A;  4YG2 A;  4EBK A;  3IM1 A;  3IG5 A;  4UB5 A;  3PW4 A;  1KTQ A;  2KJ5 A;  3M6K A;  2IA6 A;  4Y2R A;  1T94 A;  3M1Y A;  1NJZ A;  4RZR A;  2BCU A;  4I2G A;  3ZDB A;  3IHQ B;  8ICV A;  2HHS A;  3ER9 B;  1UHU A;  1XO1 A;  5KFF A;  4EBE A;  3RJH A;  3OGU A;  1L7M A;  3C21 A;  3MGH A;  4RQ8 A;  3B0Y A;  5KT3 A;  1RDF A;  3UXN A;  5AI9 A;  3NUQ A;  4AYB F;  4WC5 A;  1KKX A;  4JUZ A;  4IS7 A;  1L8L A;  9ICS A;  2JEG A;  1LV5 A;  5ALN A;  4K4I A;  3H0M B;  1SZH A;  2HHP A;  2EZY A;  4IC9 A;  3PVX A;  3JPR A;  1PVR A;  4B9S A; 
#chains in the Genus database with same CATH homology
 5J2G A;  4I27 A;  4RT2 A;  4XQ8 A;  1NZP A;  4O3P A;  1JXE A;  5KFU A;  1RYS A;  4M9G A;  1D8Y A;  7ICE A;  8ICQ A;  1TK0 A;  4I2E A;  3AQL A;  1KFD A;  5J0O A;  1QSY A;  3GFK B;  9ICU A;  8ICZ A;  4DLE A;  4YCX A;  1ZQT A;  1ZQV A;  2V9W A;  3ORY A;  4M0A A;  7ICF A;  3JZ0 A;  3RRG A;  2HW3 A;  8ICL A;  2ZH2 A;  4F5O A;  2KFZ A;  4KLQ A;  2R8G A;  4Q8E A;  3OSP A;  1BPB A;  4RPY A;  1KLN A;  2FLP A;  1U48 A;  1CUK A;  4TQS A;  3HT3 A;  9ICP A;  1ZET A;  5DB8 A;  4RQ6 A;  3GV8 B;  3BJY A;  5KFE A;  4C8N A;  4DSF A;  4P2H A;  7ICU A;  4RWP A;  2Q66 A;  4WC2 A;  2ZH9 A;  4UAY A;  4MF8 A;  2PFN A;  4KLD A;  1Y88 A;  1ZJN A;  3RBE A;  3PW0 A;  1RXV A;  7ICN A;  5HRB A;  4LT6 A;  2W9C A;  1ZQZ A;  4DQQ A;  2XCP A;  3MR5 A;  3RB0 A;  1L3U A;  5KFA A;  3V7J A;  1MQ2 A;  1COO A;  3MDC A;  3H8S A;  1U45 A;  3TAP A;  1XS9 D;  4DSI A;  4E80 A;  3OSN A;  1ZQY A;  2NRV A;  4YMO A;  4M9J A;  1N48 A;  4F91 B;  4F50 A;  4ELU A;  1KFT A;  5DB6 A;  8ICR A;  9ICL A;  2ID1 A;  4M9N A;  4PPX A;  3OUY B;  4J9L A;  4I2I A;  1N56 A;  7ICS A;  4YN4 A;  4YVZ A;  4X4Q A;  4X4S A;  5F9N A;  1ZQI A;  4X4N A;  2AGP A;  2BKE A;  3C1Z A;  2JEF A;  4KLU A;  1BPX A;  2XCA A;  4WC7 A;  2AGO A;  4DFM A;  3HW8 A;  2IHM A;  3RJK A;  3PW7 A;  7ICP A;  3OJU A;  5KG5 A;  1S0O A;  2ZHA A;  4YR3 A;  1HJP A;  8ICA A;  1X9W A;  5HR9 A;  3C5F A;  5BOL A;  4ZH4 A;  5KTQ A;  1ZQR A;  3RJG A;  4NKU A;  1JAJ A;  1KEJ A;  4XUS A;  2O5A A;  4YXM A;  1EXN A;  4JWM A;  2KP7 A;  1OU5 A;  4RWQ A;  5JUM A;  4J9R A;  5KFP A;  2ZH3 A;  5KG2 A;  4M5D A;  1Z00 B;  1NKC A;  9ICO A;  4WBZ A;  3N4M B;  3OV7 A;  4QWA A;  5C5J A;  4KN7 A;  4DFK A;  4QZA A;  2FLL A;  1BPD A;  2ATL A;  5KFN A;  4R64 A;  1UA0 A;  3TAN A;  4JWN A;  4RU9 A;  4K4H A;  4DFJ A;  4P4O A;  2PFP A;  4ATB A;  4I2A A;  1X9M A;  1U49 A;  1ZQF A;  1F5A A;  4YXJ A;  1X9S A;  3AQN A;  4F4Y A;  1BPY A;  3E2E A;  2A1J B;  1S77 D;  3RJJ A;  3KHG A;  1NK0 A;  1XWL A;  8ICP A;  2H5X A;  2ZJ8 A;  2BCQ A;  4NM1 A;  3V6H A;  2UVV A;  2HHW A;  9ICB A;  8ICU A;  2HVI A;  4RPZ A;  2XGP A;  3LQC B;  5DG9 A;  4DQS A;  1JMS A;  5IIL A;  2C2R A;  3ETL A;  1ZJM A;  3PMN A;  1QSS A;  4NLZ A;  2R8H A;  4PGQ A;  2BGW A;  4KLO A;  2M2V A;  1UEU A;  2DR8 A;  1V9P A;  5DED A;  1XU4 A;  4XA5 A;  8ICW A;  7ICI A;  4Q45 A;  3JPS A;  4I2C A;  4R8U A;  4MF2 A;  4YMM A;  1A76 A;  4DF4 A;  4YR0 A;  5J0T A;  4M9H A;  4UB3 A;  4DEZ A;  4F4W A;  9ICW A;  5HRK A;  4J9N A;  1SZP A;  4J9S A;  2ZTD A;  1S76 D;  3RBD A;  3G6X A;  5DB9 A;  2WTF A;  1QSL A;  4BWM A;  4AT7 B;  1NK9 A;  2ZH4 A;  5DGB A;  3SYZ A;  3GIK A;  5D46 A;  1CEZ A;  5HRD A;  4BXO B;  2ZH7 A;  4F5N A;  4GC7 A;  5HRG A;  5J2B A;  4UAW A;  5IIK A;  3Q8Q B;  4FO6 A;  2PFO A;  4BWJ A;  2F1H A;  2XO7 A;  4ELT A;  5DQH A;  3MGI A;  5KFH A;  4I2B A;  1UT8 A;  3PR4 A;  3JPP A;  3PO5 A;  2KZM A;  1KSP A;  3QEA Z;  4MEX A;  4WC0 A;  4BGD A;  9ICM A;  4G3I A;  3EWA A;  4MFC A;  3HWT A;  8ICO A;  4EP7 A;  1B43 A;  4JV0 A;  4TUP A;  1XC9 A;  2Y1J A;  5TZV A;  1S97 A;  1ZQM A;  1BPZ A;  4NLK A;  7ICO A;  5L1J A;  2FMS A;  3AU2 A;  3NGD A;  5J0X A;  4ECY A;  3H4B A;  4UD5 A;  2NRT A;  5KFV A;  2ASJ A;  9ICK A;  3ZDC A;  7ICR A;  4KLE A;  3H39 A;  3ZD9 A;  5HRH A;  3UQ0 A;  2W9B A;  1ZQU A;  3PX4 A;  4O3Q A;  4YP3 A;  5DEC A;  5DBA A;  5DQG A;  3BQ2 A;  3T5L A;  4F8R A;  2HHQ A;  1RYR A;  4DO9 A;  3OHB A;  1D8L A;  4TUQ A;  3UPQ A;  3TAR A;  4X5V A;  2DR9 A;  1ZQJ A;  4AT8 A;  5CR0 A;  4QZH A;  4CCH A;  8ICG A;  4Z6C A;  4IQW A;  1L3S A;  5KFB A;  1Z3E B;  3T5H A;  4F4Z A;  3OVS A;  4O3N A;  4UB1 A;  1ZQK A;  4IR1 A;  4O5K A;  9ICQ A;  4QZ9 A;  4Q44 A;  3PNC A;  2KZZ A;  4WBY A;  1XSN A;  4IR9 A;  4LZG A;  4ED7 A;  4FHW A;  3RH4 A;  3QZ8 A;  4I2J A;  5EWE A;  5HML A;  2BQR A;  5L1L A;  2J6S A;  2BCS A;  3ZD8 A;  1S9F A;  2UVU A;  4M9L A;  2JZB B;  5DB7 A;  4EBD A;  3GV5 B;  3V6K A;  2HHU A;  7ICV A;  9ICA A;  2GWS A;  3WFS C;  1DOQ A;  4QWC A;  4FHY A;  4FS1 A;  3RB3 A;  3BQT A;  4KLL A;  4EZ9 A;  3MFH A;  1Q79 A;  3G6Y A;  1DK3 A;  2BPG A;  4TUR A;  1XSP A;  4PHE A;  5IIJ A;  4DF8 A;  9ICN A;  4M47 A;  2KZ3 A;  4Z6E A;  4GXI A;  7ICH A;  2F1J A;  4UAZ A;  2XC9 A;  4GXJ A;  4RWO A;  4RNN A;  5IIM A;  2NRW A;  8ICC A;  1SL0 A;  1U9L A;  2J6T A;  4UQG A;  3UQ2 A;  1C7Y A;  1DK2 A;  8ICE A;  3WFP A;  2C2D A;  4JK1 A;  4IRK A;  3RB4 A;  1TAU A;  2ZTC A;  3T5J A;  4ECS A;  1SL1 A;  1HUZ A;  1R89 A;  3B0X A;  5DBB A;  4X4P A;  2I1Q A;  4F4X A;  3M9M B;  4QWB A;  3MR6 A;  7ICG A;  1VJ7 A;  4RQ1 A;  5CP2 A;  4IQV A;  7ICK A;  4WCW A;  3C66 A;  1UET A;  3PR5 B;  4B9U A;  5HP4 A;  2M2T A;  5J2F A;  3UPS A;  4KN4 A;  4I28 A;  4TQR A;  5KFG A;  1WCL A;  8ICN A;  1JQR A;  4WC4 A;  3TFR A;  2BHN A;  1FA0 A;  4NXZ A;  2BDP A;  2PFQ A;  5KFJ A;  4UD4 A;  4K4G A;  3H37 A;  2HHV A;  5DG8 A;  4EZ6 A;  5KG6 A;  3GQC A;  1TVA A;  5L9X A;  5J2J A;  5CB1 A;  4O9M A;  5KT2 A;  4F5Q A;  4X0B A;  2AGQ A;  1H38 A;  4O5E A;  3ISC A;  5J0W A;  1NK5 A;  5KG3 A;  1JIH A;  5KFO A;  4ELV A;  3MAB A;  9ICG A;  2M2W A;  3OVA A;  4RT3 A;  3V6J A;  3RTV A;  1SKR A;  9ICH A;  2KFN A;  4B9V A;  1MIW A;  4X4O A;  1ZQA A;  7ICQ A;  1B22 A;  2BCR A;  4P4P A;  3MR2 A;  7ICL A;  9ICV A;  1MIV A;  5HHI A;  3C18 A;  3Q8K A;  4NLG A;  2XY7 A;  4Q8F A;  3H3A A;  4E0D A;  3EPG A;  1ZQW A;  2FPM A;  3BQ0 A;  1A77 A;  2BCV A;  4AT9 B;  3HPO A;  3OVB A;  4RUA A;  3V7L A;  2VA3 A;  4JV2 A;  3LK9 A;  1ZQG A;  2MUT B;  3AQK A;  5KFI A;  4MFF A;  1LB2 B;  1RPL A;  4MFA A;  2NRK A;  5KFX A;  3NYB A;  1S10 A;  4WC1 A;  2HVH A;  1KFS A;  4DL2 A;  3PX0 A;  4QZF A;  4EBC A;  2DRA A;  5J2C A;  5KG4 A;  1TFW A;  5KFS A;  2W8L A;  5DLG A;  4XRH A;  1Z00 A;  4ECV A;  3THV A;  2R8K A;  4F4K A;  3PV8 A;  5KT7 A;  1MIY A;  5KT5 A;  2DPI A;  5KFQ A;  3MBY A;  3UXP A;  4F5P A;  2ISO A;  4DSJ A;  4RPX A;  3C2K A;  2LYH A;  2Y1I A;  4F5R A;  4J9Q A;  2ZH6 A;  5J0S A;  4DFP A;  2PI4 A;  2W9M A;  1V4A A;  5DQI A;  3FDS A;  1RZT A;  1SKS A;  2A1J A;  5DDM A;  1TV9 A;  4O0I A;  4F2R A;  1BNO A;  1T4G A;  8ICK A;  1PZN A;  5J0U A;  4UB2 A;  3EW9 A;  3AQM A;  2AQ0 A;  3K75 D;  1UT5 A;  3RR8 A;  3M9N B;  3EYZ A;  3GIM A;  3C2L A;  4JV1 A;  8ICI A;  5KFM A;  1NOM A;  4YQW A;  2W9A A;  3Q8P B;  1IXR A;  3QZ7 A;  4ECW A;  9ICJ A;  1R8A A;  3HJ4 A;  2KN7 A;  3GDX A;  3ZDD A;  4I2F A;  4FHX A;  4HYK A;  1S0N A;  2M9N A;  2XY6 A;  4FHP A;  4WC3 A;  1Q78 A;  3JPT A;  1X2I A;  1NJY A;  1SL2 A;  3LDA A;  4P4M A;  4DL4 A;  1U4B A;  3LWM A;  3BDP A;  5J2I A;  3ISB A;  2VAN A;  2ZTE A;  4KLF A;  1SKW A;  3TAQ A;  4FHV A;  4X4U A;  5HMM A;  2BR0 A;  5J2H A;  2DFL A;  2ASL A;  2DPJ A;  1R8B A;  4FH3 A;  2NRZ A;  5HNK A;  3JPQ A;  2JEJ A;  4XQ7 A;  3V7K A;  4AT7 A;  1ZQH A;  2AQ4 A;  2RDI A;  1NJX A;  2I9G A;  4KLI A;  4RNM A;  4F93 B;  1WOT A;  1VFG A;  4J9M A;  4DQI A;  3H8J A;  3Q8S B;  4IQU A;  3RAX A;  4BXO A;  2AJQ A;  4EBJ A;  1R8C A;  7ICJ A;  4DS4 A;  3RR7 A;  4I29 A;  2ZH8 A;  3LWL A;  1JXL A;  3ZDE A;  4DS5 A;  2ALZ A;  1NKB A;  4X0A A;  1QLN A;  1TFR A;  2F1I A;  1RXW A;  2IBK A;  2Q0Z X;  4ECQ A;  5KT4 A;  2FMQ A;  4RQ0 A;  4ECT A;  3PW2 A;  7ICT A;  3RB6 A;  3RH5 A;  1BNP A;  2OWO A;  2ZH5 A;  1TFY A;  4UBB A;  1TK5 A;  5BOM A;  8ICJ A;  4PGX A;  3GIL A;  4NKT A;  4RQ2 A;  2W8K A;  3MFI A;  8ICT A;  4IQT A;  4ED0 A;  2ZH1 A;  2VA2 A;  3QEB Z;  1ZQL A;  5HHH A;  5KFW A;  2AU0 A;  4M2Y A;  1XSL A;  2IMW P;  4M6W A;  4PHP A;  4GXK A;  3PO4 A;  1K1S A;  2P6R A;  4DWI A;  4EEY A;  4KLH A;  4DOB A;  1KNY A;  4QZB A;  2BQU A;  4O3S A;  1NK8 A;  4MEY A;  3JPO A;  2PXI A;  4KLJ A;  4X4V A;  2FPL A;  4QZ8 A;  2J6U A;  4KLM A;  5DBC A;  5J2A A;  4YFK A;  8ICX A;  2MAX A;  4FBT A;  2W9C B;  4EYH B;  3ZDA A;  5HRE A;  2DR7 A;  4YD1 A;  4QZI A;  5J29 A;  4M04 A;  4TUS A;  3EZ5 A;  1QTM A;  3RJI A;  4O3O A;  5KFC A;  5III A;  9ICI A;  4O5C A;  4X4T A;  1NJW A;  4RQ7 A;  3TI0 A;  3RJF A;  4X4R A;  4Z6F A;  3GII A;  4ED6 A;  4E7X A;  3HX0 A;  3Q8L A;  3T5K A;  2HHT A;  4I2D A;  1KDH A;  3HP6 A;  2V4Q A;  3HIY A;  3HJ1 A;  3TFS A;  4ECX A;  4UB4 A;  3NTU A;  8ICY A;  2BPF A;  5F2V O;  4QZD A;  1NKE A;  2JZB A;  5KFL A;  2C22 A;  1ZQD A;  3KTQ A;  2VA8 A;  1ARO P;  4DL3 A;  3M8S A;  1D9D A;  3RJE A;  4QZE A;  2JEI A;  3OJS A;  4RQ3 A;  3N97 B;  4R63 A;  9ICE A;  9ICX A;  5EOZ A;  9ICT A;  1IM4 A;  2BPC A;  1D9F A;  4FH5 A;  3QE9 Y;  4S3N A;  5KFZ A;  3SV4 A;  3M9O B;  2R8I A;  4QZG A;  4DOC A;  2FMP A;  4F2S A;  3MDA A;  8ICM A;  2ZUC A;  3C23 A;  1NK7 A;  5J2K A;  9ICF A;  4E8F A;  3SV3 A;  4LVS A;  1BGX T;  4DL5 A;  3WFO A;  5KG0 A;  2UVW A;  4DL6 A;  4DL7 A;  5KFY A;  4PHA A;  5KG7 A;  4YMN A;  3Q8M A;  1U47 A;  4NY8 A;  4Q43 A;  4DOA A;  3WFR E;  1BPE A;  5KFR A;  3M8R A;  4QZC A;  8ICF A;  4IG8 A;  9ICR A;  5J2D A;  1BVS A;  5CHG A;  2DRB A;  4B9N A;  3OUY A;  4R66 A;  3PX6 A;  3JYY A;  5KG1 A;  2C2E A;  2ZJ5 A;  4PH5 A;  3KHL A;  4B9T A;  1S0M A;  2PBE A;  4RQ5 A;  5IIN A;  3L9D A;  2HHX A;  5HRL A;  5DKW A;  4GLX A;  2XY5 A;  5HRF A;  4YD2 A;  4ATB B;  4ED3 A;  3AUO A;  3TQ1 A;  2C28 A;  3SZ2 A;  1T3N A;  4C8M A;  5DGA A;  1L5U A;  1ZQC A;  1S0V A;  3GIJ A;  4QW9 A;  4PHD A;  2P66 A;  4KLT A;  3ISD A;  4QW8 A;  4Z6D A;  4UBC A;  4R65 A;  3RH6 A;  1T7P A;  4NLN A;  3KHR A;  5DG7 A;  3SI8 A;  1UEV A;  4KMU A;  2BQ3 A;  4NM2 A;  5KT6 A;  3BQ1 A;  4DSK A;  3UXO A;  5KFT A;  5IIO A;  3OHA A;  4PGY A;  4B9L A;  4DSL A;  2IHN A;  4ED8 A;  4ECR A;  8ICS A;  4QWD A;  4YR2 A;  3MR3 A;  1HUO A;  4RUC A;  1ZQS A;  4C8L A;  2ZUB A;  5DLF A;  3V72 A;  3EPI A;  1ZQP A;  1KRP A;  4KIT B;  3PML A;  4ED2 A;  1MC8 A;  1TKD A;  1ZQB A;  4R8U B;  4J9K A;  4O3R A;  3GV7 B;  1ZQN A;  4DLG A;  5L1I A;  7ICM A;  3H38 A;  4RWN A;  2XGQ A;  3PY8 A;  2M2U A;  4AT9 A;  4WC6 A;  4C8O A;  5KFD A;  4QWE A;  4KLS A;  1UA1 A;  4DQP A;  3KHH A;  2MUT A;  3RRH A;  5J0Y A;  4EYI B;  5J0P A;  5CWR A;  4IRD A;  4YG2 A;  1ZQO A;  3IM1 A;  4EBK A;  4UB5 A;  3T3F A;  1KTQ A;  3PW4 A;  4GC6 A;  1TK8 A;  4I2H A;  1NO5 A;  2B21 A;  2IA6 A;  4BDP A;  8ICH A;  1NJZ A;  1DGS A;  5BPC A;  4RZR A;  3JPN A;  3H40 A;  4ED1 A;  2ASD A;  2BCU A;  4I2G A;  4J9O A;  4F92 B;  3ZDB A;  2V4R A;  1NK6 A;  1L3T A;  1ZQQ A;  2DR5 A;  2P6U A;  5J0Q A;  5D49 A;  4FS2 A;  5DDY A;  2R8J A;  4C8K A;  1K1Q A;  3H4D A;  3C5G A;  2ZUD A;  3IHQ B;  5D4B A;  2FLN A;  2RDJ A;  3WFQ E;  5KFK A;  8ICV A;  1MSW D;  5F9L A;  2ISP A;  2HHS A;  5EWG A;  1L3V A;  3K4G A;  3G6V A;  1ZQE A;  2O1P A;  2UVR A;  1XO1 A;  5KFF A;  1ZQX A;  4EBE A;  4FBU A;  4RQ4 A;  1ZYQ A;  3RJH A;  8ICB A;  1PX5 A;  3PW5 A;  3OGU A;  3C21 A;  1JX4 A;  5J0R A;  3MGH A;  2W9B B;  4J9P A;  4DSE A;  4RQ8 A;  3C2M A;  1WCN A;  4F3O A;  4KLG A;  3B0Y A;  5KT3 A;  4DQR A;  3AU6 A;  3UXN A;  5CA7 A;  5EWF A;  4ECU A;  4ECZ A;  2DVI A;  4KTQ A;  3C1Y A;  4LZD A;  4WC5 A;  3FYH A;  4AT8 B;  4JUZ A;  2FPK A;  9ICS A;  2RFF A;  2JEG A;  1LV5 A;  3H8W A;  1T8E A;  4K4I A;  1YLQ A;  2KTQ A;  2NRX A;  4IRC A;  9ICC A;  5HRI A;  5L1K A;  5HC9 A;  1JN3 A;  4M6W B;  2ZHB A;  5CJ7 A;  2BE3 A;  1NK4 A;  2HHP A;  2ZJA A;  3H7I A;  3RAQ A;  4RNO A;  1MQ3 A;  3PVX A;  4B9S A;  3JPR A;  4B9M A;  1TAQ A;  5J2E A;  2PI5 A;  3Q8R B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...