4F5QA

Closed ternary complex of r283k dna polymerase beta
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
326
structure length
320
Chain Sequence
TLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMKAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase, lyase/dna
molecule keywords DNA polymerase beta
publication title Structures of dNTP Intermediate States during DNA Polymerase Active Site Assembly.
pubmed doi rcsb
source organism Homo sapiens
total genus 105
structure length 320
sequence length 326
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2012-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4f5qA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4f5qA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4f5qA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4f5qA03
2HHUA 5L1IA 2W8KA 1NK6A 5JUMA 4R63A 4XUSA 4GC6A 4ED8A 3N97B 2UVVA 5HR9A 4YR0A 4XA5A 4X4OA 4B9SA 3BQ0A 2KFNA 9ICJA 9ICVA 4DLGA 4I2CA 4YMOA 3T5JA 4WC4A 4J9LA 1T4GA 1JQRA 2AQ4A 4XQ8A 3ZD8A 4QZAA 1ZQKA 4RQ0A 1S76D 2GWSA 2J6SA 4UBCA 1S10A 1U45A 4O5EA 4RQ5A 5KFNA 1BPDA 5IIMA 7ICMA 4AT8B 4XRHA 4R66A 3LWLA 3GIIA 4ED2A 4G3IA 3T3FA 2RFFA 1NJWA 4AT9A 1WCLA 4I2JA 5CJ7A 5TZVA 4RZRA 4I2DA 3QZ7A 5J2DA 1L3SA 5HRFA 4JV0A 4R8UB 4UB1A 2VA8A 3MGIA 3SV4A 2W9BB 1Q78A 2HW3A 1SL1A 1NJXA 2I9GA 5KFYA 2WTFA 1BVSA 1BPYA 4K4IA 5DECA 5KFTA 1S0NA 4LT6A 1ZQOA 2BCUA 3H8SA 2R8KA 4PGYA 1RYSA 1BPBA 1JX4A 4C8KA 5F9NA 3TI0A 2FLLA 8ICFA 1JN3A 1NZPA 4IRCA 3HJ1A 4DSLA 1UEUA 3E2EA 4IQUA 3H3AA 1ZQQA 4I2EA 4I2HA 4F8RA 1HJPA 3RRGA 4ED7A 7ICHA 3GV7B 5HHIA 3MR5A 1U9LA 4F93B 3RB3A 5KFVA 1T8EA 8ICJA 3L9DA 4UD5A 5CP2A 3C21A 4KTQA 5J2CA 5KT2A 1NKCA 4ECWA 4X4VA 2BR0A 3V6KA 5KFIA 4J9OA 4F4XA 2PBEA 1TK5A 1SKWA 2NRVA 4QZIA 4DSEA 4MFCA 4LZDA 4I27A 2Y1JA 5KFXA 3C2MA 5KG5A 4I28A 4RQ6A 2R8IA 5J2KA 2JEGA 4I29A 2HHWA 4P2HA 4J9MA 5D49A 3KHHA 2AQ0A 2PXIA 4X5VA 1QTMA 4M9JA 4M5DA 3ZDCA 2XY6A 1TAUA 4KLUA 4F4KA 5HRIA 5KG0A 3B0YA 4RQ7A 3BJYA 4E80A 4YFKA 2AGOA 4B9TA 5KFGA 5DBBA 3HW8A 4EBCA 2BQUA 8ICTA 1PX5A 3AQKA 2ASLA 5DLGA 3T5KA 4Z6EA 3QEBZ 1NJZA 1NK9A 4NY8A 3PX4A 8ICSA 4X0BA 2ZJAA 4F2SA 3OGUA 4Z6FA 4C8OA 3HJ4A 2F1IA 1S9FA 1ZYQA 4QZEA 5KFUA 2IHMA 5DBAA 4O5KA 1L3UA 1D8YA 4O3RA 2A1JA 4O3NA 4EEYA 3AU6A 2KFZA 2B21A 3K4GA 4DS5A 5J0XA 1SL2A 3RJHA 3SI8A 4RQ2A 3RBEA 3TFSA 3RR8A 4FBUA 1B43A 1TAQA 3M9NB 4NLGA 7ICEA 9ICPA 3ZDEA 4PHDA 1NK7A 5KFSA 5J2GA 3JPOA 2HHSA 2BCSA 1ZQXA 3T5HA 2M2UA 5DKWA 4NLKA 1Y88A 2XC9A 1KNYA 2NRTA 5DQIA 1K1QA 1SKSA 9ICIA 4ECTA 5KFWA 1LB2B 4DQIA 3NYBA 3GIKA 7ICUA 2C2RA 5KFOA 9ICLA 5DG9A 3ISBA 4YXJA 4X4UA 2OWOA 3H8JA 1T7PA 1UA0A 3PO4A 4PHAA 4ECQA 4DFKA 1D9DA 3FDSA 1U4BA 7ICNA 1KFTA 1KEJA 4GXKA 4X4QA 4FO6A 7ICQA 3H4DA 5DDMA 4PGQA 4JUZA 3TARA 1BPXA 3ORYA 4QZCA 1QSLA 3GV8B 9ICOA 1TK8A 4EZ9A 4WC6A 5HREA 3QE9Y 3PNCA 1VFGA 4NKTA 4QZFA 2R8JA 4B9NA 5HMLA 3C1ZA 4R64A 2BPGA 1R8AA 2F1HA 3H7IA 3Q8PB 2KN7A 1ZQVA 8ICXA 5KFMA 1S0MA 1PZNA 3PW2A 1T3NA 4CCHA 3PW0A 1YLQA 2BHNA 3G6XA 3Q8MA 2W9MA 5L1KA 7ICJA 5KT6A 4MFAA 2KZZA 3PMNA 4RQ1A 2W9CB 3H38A 1NOMA 5IIIA 2V4RA 4JV2A 5EWGA 2ZH8A 2UVRA 3RJFA 2HHVA 2VANA 5F2VO 5KFLA 4F3OA 4YN4A 9ICHA 4PPXA 3H39A 5J0WA 2C28A 1ZQHA 2ZHBA 2W9AA 2ZTEA 2A1JB 4FS2A 3KHRA 2FMPA 3V6HA 1MC8A 1DGSA 4K4GA 4RWQA 5J0RA 2KP7A 4WC2A 7ICSA 9ICNA 5DQHA 4NM2A 1NK8A 2PFOA 5HMMA 8ICRA 4S3NA 1NK4A 3OHAA 4YXMA 4UBBA 4BWJA 1ZQAA 2BQRA 3TQ1A 8ICVA 3G6VA 1OU5A 4YD2A 2ID1A 2Q66A 3M9MB 3UXNA 2P6UA 5KFEA 5KFRA 4DOCA 2XY5A 8ICEA 3FYHA 5L1LA 7ICGA 1K1SA 3Q8RB 1U47A 2PI5A 4M9GA 4EYHB 2ZH1A 5J2BA 5J2HA 3GFKB 4KLOA 2ZJ5A 4GXIA 1EXNA 1HUZA 3LQCB 7ICVA 4I2FA 4LZGA 1N48A 2ISPA 1BPZA 2MUTA 4IQWA 2ZH2A 4NKUA 1XSLA 4R65A 3GDXA 4DLEA 3JZ0A 3Q8SB 3V7KA 4E0DA 1SKRA 4QZ8A 5IINA 3V72A 1CEZA 4EBEA 1KRPA 1L5UA 3RH5A 1JXEA 5CB1A 3UPSA 4E7XA 5BOLA 4KLTA 4HYKA 1F5AA 4AT7B 2BCQA 9ICQA 1QLNA 4DL6A 1NK5A 4XQ7A 3AQLA 1DOQA 1UEVA 1KFSA 4RU9A 5J2JA 4BXOA 3ETLA 4M0AA 3EYZA 4Z6DA 4C8LA 9ICRA 1UETA 9ICEA 4DSFA 3C23A 4YG2A 4F92B 3RAQA 4EP7A 1ZQJA 2M9NA 2ZUBA 4QW9A 3RH4A 2DR8A 4WBYA 3MBYA 1TFRA 9ICGA 5CR0A 5L1JA 4F4YA 4UAYA 4KLHA 9ICWA 3JPRA 3OUYA 4MEXA 1ZQWA 3NTUA 1XS9D 5KT7A 9ICBA 4DOAA 4DS4A 2ZH3A 1B22A 3KHLA 4WC0A 3WFRE 5CWRA 8ICAA 3LK9A 5J2EA 4UB2A 3JPSA 3RTVA 7ICFA 2AGQA 3JYYA 4WC5A 4GC7A 4I2AA 2ZTCA 5J0OA 3AQMA 2LYHA 1CUKA 5KT3A 4TUPA 1QSSA 2IHNA 3ZDDA 4WBZA 4M9HA 4PH5A 4GXJA 4KLJA 3NGDA 3HT3A 4DL5A 5KG2A 2J6UA 1SL0A 1KLNA 2XGPA 3MR2A 4DFMA 1Q79A 3PR5B 1IM4A 2H5XA 1XSPA 2C2EA 1ZQCA 4UAZA 4FBTA 2ZH7A 4DL7A 3RRHA 1TFYA 4M9NA 5EOZA 4DQRA 4RQ8A 2Y1IA 5J0TA 1MSWD 2ATLA 9ICSA 2MUTB 3PR4A 3UPQA 4QWAA 1KFDA 4F50A 4DO9A 2ZHAA 3JPQA 3H37A 4M6WA 2P66A 4IR1A 4AT9B 2ZH9A 4IQVA 5DGAA 3Q8QB 3OSPA 1TKDA 1S77D 4E8FA 3OHBA 3RBDA 4RQ4A 3RJKA 1S0VA 1RYRA 5KG6A 4YMNA 4YR2A 4UB4A 3SV3A 1ZQDA 4KLDA 4RWNA 2NRKA 4YCXA 5CHGA 5IIKA 2BPFA 2FLPA 4IRKA 9ICXA 3MDCA 3M9OB 4F5QA 3MABA 4MFFA 3PV8A 4WC1A 5BOMA 4PGXA 1NKEA 4WCWA 1TK0A 4B9VA 1JAJA 3OJUA 4FHVA 2V4QA 4MF8A 4J9QA 3QEAZ 1C7YA 4KLQA 8ICHA 2ALZA 1U48A 2DFLA 1S0OA 4QZBA 3GIJA 4ATBA 4O0IA 8ICCA 1MQ2A 3AU2A 3HIYA 3PX0A 4EBDA 3ISCA 1MIWA 4C8NA 2AGPA 3ZD9A 3PO5A 4J9RA 1AROP 4FHXA 4F5NA 1HUOA 4DSJA 4Q8EA 1JMSA 1R8CA 4O3OA 2ZH6A 3PW7A 1BNPA 5KFHA 5HP4A 1A76A 4DFPA 4PHEA 3EW9A 2C22A 7ICPA 1DK3A 4RPZA 4UB3A 1ZETA 2FLNA 5DG8A 4EBKA 5D46A 2ZUCA 3GV5B 3EPIA 1D9FA 3UXOA 5KFDA 4KMUA 8ICZA 8ICLA 4KLIA 4Z6CA 4IR9A 2DVIA 3BQ2A 1TV9A 2BKEA 4QZHA 1QSYA 1UT8A 1KTQA 4F2RA 2ZUDA 3C5FA 3MR3A 5IILA 2JEJA 2VA3A 1Z00A 4FHYA 1V9PA 4RUCA 2AJQA 4ECZA 4ED1A 8ICYA 1COOA 1XU4A 4R8UA 1ZQZA 4BWMA 5KFJA 2PFPA 4RT3A 1X9MA 2W9BA 3RH6A 2IBKA 3GILA 1ZQRA 4KLFA 9ICTA 4DL2A 4X4RA 3GIMA 3PVXA 1ZQEA 4DQQA 1FA0A 8ICPA 4TURA 3WFSC 3AQNA 2RDIA 3V7JA 2PFNA 4RNOA 3G6YA 3WFQE 5KFZA 4J9KA 2ZH5A 3V7LA 5J29A 5DDYA 4RNNA 3RJGA 4BGDA 4RNMA 3PMLA 5HRHA 1RXWA 4RUAA 3V6JA 2IA6A 1R89A 4ZH4A 2RDJA 4KLEA 1RPLA 4ECVA 2BCVA 5KFKA 5J0SA 1ZQLA 2JZBA 2JEIA 9ICUA 4F4WA 1N56A 8ICOA 4F91B 3OJSA 4ED3A 1ZQNA 4Q8FA 7ICKA 7ICOA 4ATBB 2AU0A 4I2BA 2M2WA 2DR9A 4NLZA 3UXPA 4NM1A 5KT4A 5BPCA 2FMSA 5DB7A 4EZ6A 1R8BA 5IIOA 5DEDA 7ICLA 3TAPA 3MR6A 1ZQTA 1S97A 4DSKA 4KLSA 8ICGA 1ZQFA 4NLNA 2I1QA 2PFQA 4ELVA 4X4SA 3JPNA 1ZQMA 4KLMA 5KFFA 5KT5A 4QWBA 5KG3A 7ICIA 2IMWP 4B9UA 4ECRA 2ZJ8A 3H40A 4O5CA 2NRWA 1X9SA 3WFPA 4O3PA 3UQ2A 2MAXA 5HRLA 3RB0A 4P4PA 3RJIA 2ASDA 1H38A 3MFHA 2BQ3A 1BNOA 2XGQA 3MFIA 4DFJA 1JXLA 1XSNA 5KG7A 4RWPA 3C1YA 3OVBA 4JWNA 4X4NA 3THVA 1Z00B 3MDAA 3TANA 2R8HA 3KTQA 2FPMA 2ZH4A 3M8SA 4RT2A 2DR7A 2PI4A 4KN7A 4M47A 5HRBA 2XCPA 1JIHA 2VA2A 4LVSA 3AUOA 8ICMA 4TUSA 3PW5A 5EWEA 4YD1A 5HHHA 4JK1A 3TFRA 2M2VA 4IQTA 1NO5A 3QZ8A 3LWMA 1D8LA 1ZQSA 4O9MA 2FMQA 2V9WA 3M8RA 4FH5A 3IM1A 1RXVA 1ZQGA 5HRKA 7ICTA 4P4OA 2KTQA 4Q43A 4WC7A 2ASJA 2ISOA 4JV1A 1XO1A 3KHGA 9ICCA 5DLFA 3T5LA 2JZBB 4ELUA 5HRDA 3OVAA 2DRAA 4TQSA 5KG4A 4KITB 5F9LA 4ECYA 3TAQA 2DR5A 1XWLA 1Z3EB 3EZ5A 2HHTA 3H8WA 4KN4A 4DQPA 2BDPA 3RJEA 5J2AA 3ISDA 4M9LA 4I2GA 3C66A 1TFWA 1LV5A 1KSPA 1ZQBA 4FHWA 4Q45A 2JEFA 3BQTA 4RPYA 5DG7A 1KDHA 2BE3A 3OVSA 5D4BA 3MGHA 4F5PA 1TVAA 2NRXA 2XCAA 4UD4A 2W8LA 3K75D 4YR3A 4UAWA 2C2DA 4RPXA 5DB6A 4QWCA 4J9SA 1U49A 8ICNA 3BQ1A 8ICWA 1BGXT 4FHPA 3HX0A 4J9NA 4Q44A 4ED6A 1VJ7A 3RAXA 5J0QA 3EPGA 4YVZA 1ZQUA 2W9CA 5KFBA 4ECXA 2FPLA 1UT5A 2BPCA 3Q8LA 2P6RA 4B9LA 9ICAA 2HHQA 4NXZA 5CA7A 4QWEA 8ICQA 5IIJA 4JWMA 4BXOB 5C5JA 3SZ2A 1XC9A 3IHQB 5DB9A 5J0YA 4IRDA 4MF2A 4K4HA 2HVHA 4UB5A 4QZ9A 9ICFA 5KFCA 5KTQA 1X9WA 1NKBA 5HC9A 4O3SA 4YMMA 3UQ0A 3C2KA 1MIVA 2KZ3A 4YP3A 1V4AA 2ZTDA 3OUYB 1ZQPA 2R8GA 4KLGA 3BDPA 4ECSA 4FH3A 4DEZA 1L3TA 4F5RA 5J2FA 2Q0ZX 4TQRA 3ZDAA 1A77A 4DQSA 1ZQIA 2UVUA 4M2YA 3B0XA 5DGBA 4UQGA 2XO7A 4GLXA 3RB4A 8ICKA 1MIYA 2HVIA 4ELTA 2BGWA 9ICMA 4EYIB 2HHPA 4RWOA 2DRBA 5KFPA 1RZTA 2FPKA 2F1JA 3JPPA 2HHXA 4X4TA 1X2IA 1ZJNA 3C18A 5J0PA 3JPTA 4ED0A 5HNKA 3HP6A 2KZMA 4EBJA 4C8MA 1MQ3A 4AT8A 4TUQA 4QZGA 4FS1A 2O1PA 3WFOA 4J9PA 2NRZA 5J2IA 4YQWA 3PX6A 4M04A 3SYZA 3RJJA 4DSIA 2UVWA 4QZDA 1SZPA 4P4MA 4DL3A 4M6WB 4DF4A 4IG8A 1ZJMA 3N4MB 4BDPA 5DBCA 3Q8KA 3RB6A 4X4PA 1IXRA 3HPOA 3RR7A 4F5OA 4DWIA 8ICUA 4DF8A 2BCRA 5KG1A 4PHPA 1UA1A 3C2LA 4AT7A 2M2TA 2J6TA 5L9XA 5DB8A 1BPEA 3PW4A 3EWAA 3LDAA 8ICBA 4B9MA 1L3VA 1ZQYA 1WCNA 4I2IA 4DOBA 3PY8A 4RQ3A 4WC3A 5KFAA 4O3QA 1NK0A 1WOTA 4F4ZA 4KLLA 8ICIA 5HRGA 5DQGA 2DPJA 3C5GA 4X0AA 3OV7A 3HWTA 5EWFA 3OSNA 2XY7A 3ZDBA 2O5AA 1DK2A 9ICKA 5J0UA 4DL4A 2DPIA 7ICRA 3H4BA 4QWDA 3GQCA 1NJYA 4ECUA 4QW8A 4MEYA 5KFQA
chains in the Genus database with same CATH superfamily
2MA1A 2HHUA 5L1IA 2LM4A 1J97A 2UVVA 4YR0A 4X4OA 4B9SA 4NXTA 3BQ0A 3HKZF 4I2CA 9ICVA 4YMOA 4WC4A 1T4GA 4RQ0A 1S10A 1U45A 2Y0SC 7ICMA 4I2JA 5TZVA 1L3SA 4I2DA 2VA8A 3SV4A 2F8LA 3GU3A 5ALYA 1NJXA 1BVSA 1OW5A 5KFTA 2BCUA 2R18A 2W11A 8ICFA 5F9NA 3TI0A 1JN3A 2F76X 2KJ9A 1UEUA 4IQUA 5AK5A 5ALQA 3AL0B 1ZQQA 4I2EA 4F8RA 4ED7A 2K4IA 3GV7B 3MR5A 2F77X 1L8LA 4UD5A 4KTQA 3NVVA 5KT2A 3H0LB 2PBEA 2NRVA 4DSEA 1FEZA 2Y1JA 5KFXA 3C2MA 3KFUF 3PSIA 3KHHA 5L1MA 2XY6A 4K99A 2YTUA 1ZD3A 5KG0A 3KBBA 4FE3A 5DBBA 1PX5A 3WKAA 4X0BA 3OGUA 4C8OA 4GIBA 1S9FA 4QZEA 1D8YA 4O3RA 3AU6A 5ALSA 2KFZA 4K97A 3LYSA 2JH1A 4DS5A 3WK8A 1VJ5A 1WWUA 2H3QA 3TFSA 3RR8A 2EAPA 4NLGA 3T5HA 3NWIA 2XC9A 1KNYA 1SKSA 5J8YC 9ICIA 3GIKA 3R9KA 2C2RA 5KFOA 5DG9A 3ISBA 1UA0A 4PHAA 4DFKA 4ACOA 1D9DA 3FDSA 2XICA 4GXKA 4FO6A 7ICQA 5AK6A 4JUZA 3F2DA 1Z1BA 3NVWA 4EZ9A 4WC6A 2W3SA 1VFGA 2OCEA 3WKCA 3Q8PB 2DF4B 2BHNA 2ZIVB 2KZZA 2KHVA 4RQ1A 1NOMA 5EWGA 2VANA 5F2VO 1B0XA 3N28A 5AI4A 2ZXHA 5J0WA 2C28A 2ZHBA 4FS2A 3KHRA 1DGSA 5J0RA 3MC1A 5B66U 4NM2A 5T14A 5ALXA 4BWJA 3TACB 4JMUA 4OO1J 4DOCA 3Q8RB 3M1YA 4DFDA 2W3RA 5AM5A 4UAUA 4LZGA 2ZH2A 1XSLA 3NRWA 3GDXA 4DLEA 3V7KA 2P35A 4EBEA 3PSFA 1SGGA 3RH5A 5AKGA 1L7MA 5BOLA 1F5AA 2GLEA 3NVYA 9ICQA 1NK5A 3NUQA 2LPEA 4M0AA 4C8LA 2G07A 4DSFA 3C23A 5ALGA 4EP7A 2M9NA 2ZUBA 2DR8A 4WBYA 4KLHA 2YB1A 4UAYA 4ZOHC 5D63A 4MEXA 2KICA 1XS9D 9ICBA 4GFJA 8ICAA 3KKAA 5J2EA 3JPSA 2ZXIA 4GC7A 5J0OA 3JCFA 1S5LU 2OH2A 3WKDA 3B9JA 1SL0A 1Q79A 1A6SA 4UAZA 4OJ5A 2LMRA 4DL7A 4O3MA 3RRHA 1SWVA 4RQ8A 9ICSA 2ATLA 1SXEA 4F50A 2ZH9A 1T94A 4IQVA 5DGAA 3UM9A 3RJKA 1S0VA 2JR5A 3HJEA 5CHGA 2FLPA 2EWRA 3AMZA 3M9OB 4WC1A 5BOMA 1NKEA 1TK0A 2KJ8A 3OJUA 2V4QA 2A19A 2JRZA 4ATBA 2DFLA 3GIJA 3PX0A 1N2XA 1MIWA 3PO5A 1AROP 1HUOA 2F2AB 5ALJA 1XNSA 1BNPA 1A76A 2C22A 2PKEA 3EW9A 4JLZA 4EEBA 3SAGA 4QIWC 2ZUCA 3GV5B 5G5HA 1ZRMA 4KLIA 4Z6CA 2DVIA 1QSYA 3C5FA 4FHYA 1COOA 1ZQZA 2PFPA 1X9MA 2W03A 2IBKA 3HILA 1FA0A 3WFSC 2RDIA 4Y2QA 2PFNA 4RNOA 2WB1F 4J9KA 4QJFB 4RNNA 4AYBF 2EH9A 1SV0C 4RNMA 2IA6A 1R89A 4ZH4A 1RPLA 5AKHA 8ICOA 2M0NA 4F91B 1ZQNA 5D62A 3AQFA 1X40A 4JB3A 4NLZA 3UXPA 1N5WA 4EZ6A 2CXYA 3MR6A 3WK7A 2O6KA 4X4SA 1O03A 5KT5A 2JGAA 2IMWP 2ZIXA 4ECRA 4O5CA 2NRWA 1X9SA 4O3PA 3UQ2A 2YY6A 3J81j 3RJIA 4WH5A 2BQ3A 2NO5A 2XGQA 3MFIA 1Q3VA 3OVBA 4JWNA 1X66A 1Z00B 2XVTA 5EE3A 5AM0A 2FPMA 2ZH4A 3M8SA 4RT2A 2DR7A 3E58A 2VA2A 3AUOA 8ICMA 4TUSA 3TFRA 2HOIA 3NS1A 4IQTA 4C4TA 2FMQA 5ALWA 4FH5A 4K9AA 1ZQGA 2I5HA 5EE0A 4Q43A 4NWIA 1D8BA 2JZBB 3OVAA 2FCLA 5F9LA 4ECYA 2HHTA 3H8WA 4KN4A 4US9A 1RM6C 2OM6A 4DQPA 5J2AA 2RP5A 1KSPA 2JEFA 3OVSA 3KOOA 5D4BA 2XCAA 3K75D 2JMGA 2HSZA 4RPXA 5A0LA 1U49A 2OHFA 8ICWA 1BGXT 2Y9TA 4OAIZ 1Z1VA 4Q44A 1VJ7A 3RAXA 5J0QA 3AN1A 4YVZA 4B9LA 4UAVA 9ICAA 5C5JA 2K8CB 3IHQB 2HVHA 5ALMA 5KFCA 2B51A 5HC9A 3UQ0A 2KZ3A 4YP3A 5CFSA 1ZQPA 2R8GA 4ECSA 1L3TA 5J2FA 2Q0ZX 4TQRA 4DQSA 5ALPA 2UVUA 4UQGA 2YMPA 3ICXA 9ICMA 2DRBA 2FPKA 2HHXA 2D6FC 3ERCC 1X2IA 1ZJNA 3C18A 2G0AA 3HP6A 1LKYA 4TUQA 4QZGA 2JH7A 4FS1A 4J9PA 2NRZA 5J2IA 3F5EA 3PX6A 1NNLA 3SYZA 2UVWA 1VDVA 4DF4A 4IG8A 3Q8KA 8ICUA 4F5OA 2BCRA 5KG1A 2LHTA 4AT7A 2WAQC 5DB8A 1BPEA 3PW4A 3ER9B 1ZQYA 2YMMA 4WC3A 5ALHA 5HRGA 5DQGA 3C5GA 3OSNA 3QUCA 9ICKA 1NJYA 4ECUA 2PXIA 5KFQA 5CFTA 1NK6A 4R63A 4XUSA 4GC6A 3FM9A 2KFNA 1FIQA 1WG8A 2LBOA 1JQRA 2AQ4A 4XQ8A 3ZD8A 1S76D 3EF2A 2GWSA 1KN5A 1RG6A 4O5EA 5KFNA 4AT8B 4ED2A 4AT9A 3MGIA 1KBUA 2HW3A 2I9GA 3D2QA 5DECA 2WHEA 4MHVA 1CI4A 3PSTA 4G9BA 2R8KA 1RYSA 1JX4A 3E2EA 3H3AA 1PVPA 3RRGA 4RQMA 5HHIA 4F93B 1T8EA 5KFVA 8ICJA 1DXSA 4C7ZA 5J2CA 2KHQA 3V6KA 5JTGA 2EDUA 1SKWA 2YMLA 3BS5A 4QZIA 5FP0A 4I27A 5ALZA 1QQ5A 3D2NA 2XI9A 5KG5A 4I28A 2R8IA 2HHWA 5J2KA 1QTMA 2AQ0A 1V38A 2WF5A 1J2NA 2K4EA 4RQ7A 3B0YA 1LVHA 4UB8U 1X6IA 2BQUA 4EBCA 8ICTA 3AQKA 3FAHA 3I76A 1L8OA 4O6AA 4Y2YA 8ICSA 1JROA 4F2SA 4Z6FA 3M6KA 2F1IA 2IHMA 2ZIWB 4K98A 3RFAA 4O3NA 4C4SA 2B21A 3SMVA 3N7PD 5CHEA 5J0XA 2DKZA 1ZD2P 4RQ2A 3SI8A 1B43A 1WYGA 4Y2PA 3JPOA 3SD7A 1ZQXA 2HDOA 2NRTA 3IDWA 7ICUA 3L3FX 2CRXA 9ICLA 4X4UA 4YXJA 4CF5A 4ECQA 7ICNA 4X4QA 4P0PA 9ICOA 3QE9Y 3FC4A 1R8AA 2R8JA 3KD3A 4KX5A 2KN7A 8ICXA 3AQEA 1S0MA 3PW2A 4OCZA 1YLQA 3G6XA 3TADA 3PSPA 5KT6A 4MFAA 5KL1B 2E5SA 2V4RA 4JV2A 3RJFA 1Q3UA 4F3OA 1Z19A 9ICHA 1N60A 3H39A 3I28A 4OAGA 3BQ7A 1HEKA 1ZQHA 2W9AA 2A1JB 2FMPA 4K4GA 2KP7A 7ICSA 3QXGA 5DQHA 8ICRA 1NK8A 1COKA 5HMMA 4S3NA 2AHOB 1NK4A 4UBBA 2H3VA 2BQRA 3TQ1A 1OU5A 2Q66A 2Y9UA 5KFEA 3WKEA 2F44A 2ZH1A 4EYHB 5J2HA 2KKVA 1EXNA 1RDFA 4QNLA 4I2FA 1LKYB 5AM3A 1N48A 1UHUA 2HI0A 4NKUA 5KL8B 5F3XB 3JZ0A 2ODGA 4E0DA 2G08A 4PL1A 1JXEA 5CB1A 4HYKA 4AT7B 1DOQA 2DUYA 1KFSA 4RU9A 3L4PA 4BXOA 5CRXA 1SV0A 2W55A 1HIWA 9ICRA 4YG2A 3A0BU 4QW9A 9ICGA 1TFRA 4NXVA 3JPRA 3OUYA 3NTUA 4N7RA 4LEWA 4B6JA 4UB2A 4UARA 3RTVA 7ICFA 3JYYA 2LKYA 3D6JA 2W7OA 4I2AA 3AQMA 2ZTCA 2LYHA 4TUPA 2IHNA 3ZDDA 3UMBA 4WBZA 4KLJA 3HT3A 3UMGA 5AI9A 3MR2A 3PR5B 1IM4A 1XSPA 1ZQCA 4FBTA 2ZH7A 3ZI4A 2EANA 5EOZA 2MUTB 3PR4A 1KFDA 4DO9A 3JPQA 3H37A 4M6WA 4AT9B 4OJPA 4O67A 1TKDA 3Q8QB 3OSPA 1ZOLA 1RYRA 2G06A 4YR2A 4KLDA 2NRKA 4YCXA 9ICXA 3MDCA 4WCWA 4B9VA 5JTIA 4JLXA 4KM5A 1C7YA 1SIJA 4KLQA 4QZBA 4O0IA 1MQ2A 3AU2A 4EBDA 3ISCA 2AGPA 4J9RA 1YT3A 4Q8EA 1JMSA 1R8CA 3PW7A 5HP4A 3BS5B 3LVWA 5D46A 1PK1A 5KFDA 4IR9A 5ALLA 2L5YA 3BQ2A 1ZRNA 3OTQA 4QZHA 5CEHA 1UT8A 3TKAA 5IILA 2JEJA 1Z00A 2AJQA 2E3TA 4ECZA 4ED1A 2MRLA 2QB1A 4R8UA 4BWMA 4RT3A 2QB0B 2W9BA 1ZQRA 1X6JA 9ICTA 1ZQEA 4TURA 2G09A 3G6YA 2KOBA 2ZH5A 4K8VA 3V7LA 2N1RA 3RJGA 4ICAA 1N5XA 5HRHA 4KLEA 2RDJA 2OXOA 2JXJA 1X42A 2JZBA 3CW2C 3HKZC 3QU9A 4I2BA 3BS7A 2KIVA 1TE2A 5DB7A 5IIOA 2ZIUB 4KLSA 4P0PB 2KD1A 4ELVA 1ZQMA 5KG3A 7ICIA 2ZJ8A 3WK9A 2RRDA 3VCBA 3WFPA 5JU5A 5HRLA 2ASDA 3MFHA 4NL9C 4Y2TA 1JXLA 3OPXA 4X4NA 3THVA 3MDAA 4U6PA 2PMZC 2DWQA 4KN7A 4LVSA 5EWEA 4YD1A 5HHHA 4JK1A 1NO5A 3M8RA 5AKXA 7ICTA 2ZG6A 1ZD4A 2FJ6A 4EELA 4JV1A 3QU5A 1XO1A 3TAQA 2H3ZA 2DR5A 1Z3EB 1CRXA 3N7RC 3H8MA 2BDPA 3MGVA 2W43A 3C66A 1ZQBA 4FHWA 4Q45A 4BX9C 4YR3A 5HR6A 4UAWA 2C2DA 5DB6A 4QWCA 3BQ1A 4KX3A 3HX0A 1VLBA 1F44A 2HHQA 2FPLA 2BPCA 2P6RA 4Y2SA 4NXZA 4K9BA 5IIJA 3F2BA 4BXOB 1V97A 4JWMA 3SZ2A 1XC9A 4MF2A 2YB4A 5TISU 1X9WA 1T3QA 4O3SA 3D2SA 3C2KA 1UCVA 3OUYB 4FH3A 4KMOB 1N63A 4FO1A 3ZDAA 1A77A 4CDGA 8ICKA 5DGBA 4GLXA 3E0FA 3RB4A 1MIYA 4EYIB 4X4TA 1FFUA 4CRXA 4IL6U 3CNHA 4EBJA 5ALTA 2KZMA 1MQ3A 4AT8A 3ER8C 3WU2U 1B4FA 4YQWA 2Q4TA 3BZCA 1SZPA 2JHDA 4P4MA 4M6WB 5E79U 3N4MB 1IXRA 3RR7A 3EWAA 5ALFA 3DV9A 4I2IA 1WCNA 4DOBA 4UATA 1NK0A 4F4ZA 8ICIA 4WQKA 2DPJA 4FZNA 2XY7A 7ICRA 2WAQF 1KW4A 2WF9A 3IRUA 2W8KA 3L5KA 4ED8A 3N97B 5HR9A 1M6YA 9ICJA 4DLGA 1PK1B 1PVQA 1ZQKA 2J6SA 4UBCA 1FFVA 4RQ5A 1BPDA 5IIMA 4XRHA 4R66A 3GIIA 2RFFA 4FZMA 2ZIWA 1WCLA 4RZRA 5HRFA 2O5AA 4JV0A 4R8UB 4UB1A 2W9BB 5KFYA 4HX0A 1S0NA 1ZQOA 3H8SA 4C8KA 2FLLA 5EE1A 4DSLA 1HJPA 3RB3A 5CP2A 4OAHA 1NKCA 4X4VA 2BR0A 2DGZA 5B5EU 5KFIA 4J9OA 4LJXA 4MFCA 4LZDA 1PVRA 4F71A 2JEGA 4I29A 4P2HA 4J9MA 5D49A 4X5VA 4M9JA 1F5SA 4C0ZA 4OJOA 4PZOA 4M5DA 4KLUA 5HRIA 2B4VA 3BJYA 4YFKA 3T79A 5KFGA 3HW8A 2ASLA 5DLGA 3QEBZ 4Z6EA 1ZYQA 4NXXA 5KFUA 2A1JA 3K4GA 1SL2A 3RBEA 4FBUA 7ICEA 3M9NB 9ICPA 3ZDEA 4PHDA 3M7DA 4RQNA 5KFSA 5J2GA 2BCSA 1SB3C 2QARA 5AM1A 5DKWA 2HN1A 5DQIA 5KFWA 3NYBA 2KJ5A 1SZHA 3H8JA 1T7PA 3PO4A 1U4BA 2A1AA 1KEJA 4IS7A 3H4DA 5DDMA 4PGQA 3TARA 3ORYA 3IP4B 3GV8B 1TK8A 5HREA 4NKTA 2H3IA 5HMLA 2BPGA 1K5OA 4R64A 3H7IA 3QU4A 5KFMA 4CCHA 3PW0A 4FFDA 3Q8MA 2W9MA 5L1KA 2BZFA 5IIIA 2ZH8A 2UVRA 5KFLA 4YN4A 3QUBA 5J8YA 4PPXA 2ZTEA 1MC8A 3IN5A 2LM1A 4OAFA 2QLTA 3OHAA 2LYAA 3G6VA 4YD2A 2ID1A 3M9MB 3UXNA 2P6UA 5KFRA 8ICEA 4NJ8A 3I1YA 5C0YA 1U47A 2PI5A 5J2BA 5K4LA 1BPZA 2MUTA 4IQWA 3KKAC 5IINA 1CEZA 1KRPA 4C4RA 3UPSA 4BJQA 2Y0SF 4WOYA 3GZFA 4DL6A 1UEVA 1SWWA 1URJA 2D8CA 3EYZA 4Z6DA 9ICEA 4F92B 3RAQA 1ZQJA 2KG5A 2E1FA 5CR0A 4F4YA 1X9XA 4DOAA 4DS4A 1B22A 5CWRA 3LK9A 1CUKA 1QSSA 4GXJA 4DL5A 2J6UA 2XGPA 4DFMA 3CRXA 2H5XA 2WF8A 5AKJA 2C2EA 4DQRA 5J0TA 1MSWD 3UPQA 4QWAA 2QB0A 2ZHAA 4IR1A 3C28A 2B6GA 4E8FA 3OHBA 3RBDA 3WKBA 4RQ4A 4YMNA 3SV3A 5IIKA 4IRKA 5AHXA 4MFFA 3PV8A 1Z4OA 4PGXA 2HMXA 1JAJA 4FHVA 4J9QA 4MF8A 1U48A 3DEEA 8ICCA 3K1ZA 3HIYA 2CN1A 2EAMA 2E8PA 4C8NA 3ZD9A 4FHXA 4F5NA 2ZIUA 2ZH6A 3CK6A 4PHEA 4UB3A 2FLNA 4EBKA 2HBJA 4KMUA 8ICLA 2FI1A 1TV9A 2VIXA 2ZUDA 2E8OA 2HBMA 2VA3A 1V9PA 4UASA 2RQ5A 5KFJA 1Q46A 2F3NA 1QQ6A 5AI8A 2EZZA 3RH6A 3GILA 4DL2A 4X4RA 3GIMA 4DQQA 3AQNA 1ZD5A 1TAMA 4CE6A 4C80A 5J29A 2EAOA 5DDYA 1NZBA 4BGDA 1YZ6A 1RXWA 2QARB 5GTHU 3V6JA 2BCVA 2JEIA 1ZQLA 2IOFA 4F4WA 7ICKA 2IHOA 7ICOA 2AU0A 2M2WA 2DR9A 1SV4A 4NM1A 5KT4A 4Y2JA 2GH1A 1R8BA 5DEDA 7ICLA 3TAPA 4DSKA 2Z7JA 8ICGA 2I1QA 3JPNA 3CYMA 4FZLA 1DGJA 4USAA 5KFFA 4QWBA 1RQLA 4KLMA 5AI6A 5AK4A 1S8OA 4EENA 2LYBA 1OUQA 1BNOA 2WF6A 4DFJA 2YMQA 3HRDD 1XSNA 4RWPA 2IUBA 3H0MB 3TANA 2KE7A 3KTQA 2KMDA 2HN2A 3SAFA 2NV3A 2PI4A 2XCPA 5EE9A 4KB6A 4O68A 3QZ8A 3LWMA 2HBLA 2KVSA 1D8LA 4O9MA 2V9WA 1GPJA 3MCRA 4MKPA 1JI7A 2PMZF 3IM1A 2DL0A 3QU7A 3K1RB 2KTQA 4WC7A 2BBHA 2ASJA 3KHGA 9ICCA 5DLFA 3T5LA 1AQ6A 2DRAA 5KG4A 3EZ5A 2GA9D 3ISDA 4M9LA 4I2GA 1LV5A 2KV2A 4RPYA 1KDHA 2BE3A 3KZIU 1TVAA 2K8BB 4UD4A 2W8LA 1NI3A 2E1EA 2OEHA 8ICNA 4EX6A 4J9NA 3AM9A 1JALA 1ZQUA 2AXTU 2W9CA 5KFBA 1UT5A 4WJ3B 5CA7A 4Y2UA 4QWEA 4LEZA 5DB9A 5J0YA 4IRDA 1J2MA 4K4HA 5H2FU 1MIVA 1V4AA 2RHFA 4KLGA 4DEZA 4F5RA 1ZQIA 4M2YA 4M04A 5CFUA 3B0XA 2XO7A 2HVIA 2E8NA 4RWOA 4DCCA 5GTIU 5KFPA 2K4PA 2F1JA 3JPPA 4CNQA 4CF4A 5J0PA 4NXUA 3SENA 5HNKA 4ED0A 3NVOA 4EV6A 5AM4A 1ECWA 4QIWF 2O1PA 3S6JA 4DSIA 4A8EA 2VJ5A 2YN4A 4DL3A 2B56A 3RB6A 3HPOA 1L7OA 1UA1A 3C2LA 2M2TA 8ICBA 3CP8A 1P7DA 1L3VA 1N62A 5JRTA 2WF7A 4X0AA 5HR7A 3O0FA 3HWTA 5EWFA 2LI6A 3ED5A 5J0UA 3GQCA 4NXWA 1BPYA 4OJ6A 5JUMA 4P0QB 4Y2XA 3N7SC 4XA5A 3T5JA 4J9LA 2A3VA 4EEDA 5KNIA 4QZAA 5AIAA 1JRPA 5AKKA 1GO3F 2KSOA 3LWLA 4G3IA 1QCKA 3T3FA 1NJWA 3VC8A 5CJ7A 3QZ7A 1MA7A 5J2DA 2YQEA 2VKQA 3IV6A 1Q78A 4EGWA 3UMCA 1SL1A 3SQIA 2WTFA 4K4IA 4LT6A 2E8MA 4PGYA 1BPBA 1NZPA 3HJ1A 4IRCA 4I2HA 7ICHA 5ALKA 1U9LA 3L9DA 3C21A 4ECWA 3C29A 1PUZA 5AM2A 2D3DA 4F4XA 1TK5A 3A0HU 4RQ6A 4Y2RA 2KK0A 5ALUA 3ZDCA 1TAUA 3PZPA 2KIWA 4F4KA 4PL2A 4E80A 2AGOA 4B9TA 3SEIA 3T5KA 1NJZA 1NK9A 4NY8A 3IG8A 3PX4A 2ZJAA 3HJ4A 1V85A 4AP9A 2BDUA 5DBAA 4O5KA 1L3UA 2NO4A 4EEYA 3RJHA 2CPRA 3TADC 4LEYA 1TAQA 1NK7A 2HHSA 2M2UA 2K4HA 1F0MA 1SXDA 4NLKA 1Y88A 1K1QA 4ECTA 1LB2B 4DQIA 4HAIA 4EX7A 2OYYA 2OWOA 2KNJA 2K89A 1KFTA 4NLCA 1Z4NA 2HOFA 1QSLA 2DKXA 1BPXA 4QZCA 2G5IB 3PNCA 3NVZA 2H3FA 4QZFA 4IC9A 4B9NA 3C1ZA 2F1HA 1ZQVA 5AI0A 3OWGA 1PZNA 1T3NA 7ICJA 2IOFK 3PMNA 2DBYA 2VJ4A 2W9CB 3H38A 3PHZA 3F2CA 2HHVA 1WUDA 2DQNB 1C20A 3H0RB 4RWQA 3V6HA 4WC2A 3DDHA 3SAHA 9ICNA 2PFOA 4YXMA 1ZQAA 8ICVA 2AH5A 1IG6A 5AKYA 4CF3A 4K96A 2XY5A 3FYHA 5L1LA 7ICGA 1K1SA 4M9GA 4Y2VA 3GFKB 4KLOA 1JUDA 2ZJ5A 4GXIA 1HUZA 3LQCB 4EEKA 7ICVA 1PK3A 2GO7A 2ISPA 5AKLA 4PJ0U 4R65A 3Q8SB 5AKEA 5ALNA 1SKRA 4QZ8A 3V72A 3EUB2 1L5UA 4E7XA 4KLTA 2BCQA 1QLNA 4XQ7A 3AQLA 2QKQA 1QH9A 5J2JA 3ETLA 2NYVA 3AEVA 1UETA 3RH4A 3MBYA 5L1JA 9ICWA 3QYPA 5AKZA 1ZQWA 3ONNA 5KT7A 2ZH3A 3KHLA 4WC0A 3WFRE 4O69A 2AGQA 4WC5A 5KT3A 2I6XA 4M9HA 4PH5A 3NGDA 5KG2A 1ZXIA 1KLNA 5ALOA 1TFYA 2KSOB 4M9NA 2Y1IA 3KZXA 5AIBA 1OXJA 3F53A 2P66A 2HCFA 1S77D 4OD0A 5KG6A 4UB4A 1ZQDA 4RWNA 2BPFA 4F5QA 3MABA 3LVVA 3QEAZ 8ICHA 1KL9A 2ALZA 1S0OA 1MN8A 2ES6A 4DSJA 5ALDA 4O3OA 5KFHA 2K8AA 1IV8A 4DFPA 1DK3A 7ICPA 4RPZA 1ZETA 3QUTA 5DG8A 3ETRA 3EPIA 1D9FA 1DRGA 3UXOA 1RQNA 8ICZA 1O08A 3IG5A 3WK6A 2BKEA 1KTQA 4F2RA 3MR3A 2WB1C 1KQQA 4RUCA 8ICYA 4AYBC 1XU4A 2EQYA 2KEYA 4KLFA 5ALIA 3PVXA 5ALVA 8ICPA 2W7PA 3V7JA 5B3PA 3WFQE 5KFZA 4WQLA 3NRZA 1KKXA 3PMLA 1XO0A 4RUAA 3QX7A 4ECVA 9ICUA 5KFKA 5J0SA 3NKUA 1N56A 3OJSA 4ED3A 4ATBB 4Q8FA 1UQVA 4CGZA 2MSNA 4UB6U 5BPCA 2FMSA 1N61A 2RLTA 2WFAA 1FO4A 5B3QA 1ZQTA 1S97A 2W04A 5AKIA 3WK4A 1ZQFA 4NLNA 2PFQA 4B9UA 3H40A 2MAXA 5AK3A 3RB0A 3NASA 3WK5A 2IOHA 5ALEA 4P4PA 1H38A 5AICA 4NLBA 4UW9A 5KG7A 3C1YA 2KKPA 2R8HA 3QNMA 4M47A 5HRBA 1JIHA 2XIDA 3PW5A 2M2VA 4J03A 2EZYA 1ZQSA 1RXVA 5HRKA 4P4OA 2HBKA 2ISOA 1IIPA 2ESEA 4OJLA 5HRDA 4ELUA 1ED1A 4F72A 4TQSA 4KITB 1XWLA 2K60A 4NV0A 3RJEA 4U7CA 2BBJA 1TFWA 4NL9A 3BQTA 4C7YA 5DG7A 3MGHA 4F5PA 2NRXA 2G5HB 5KAIU 3RF9A 4J9SA 1Q8KA 2FE9A 4FHPA 2EZXA 2ZIXB 4ED6A 2ZIVA 1L7PA 3EPGA 3SR6A 4ECXA 3Q8LA 3QU2A 8ICQA 1L7NA 4US8A 3M6ZA 4UB5A 4QZ9A 9ICFA 5KTQA 1NKBA 3QUQA 4YMMA 2HOQA 2ZTDA 5G5GA 4P0QA 3BDPA 2MU2A 4ELTA 2BGWA 2HHPA 5D61A 2JV3A 1RZTA 3BZKA 5KAFU 2GAFD 1L6NA 2GOLA 3JPTA 4C8MA 1A0PA 5ALRA 2W54A 1QQ7A 3WFOA 1UPHA 3RJJA 3ALRA 4I0UA 4QZDA 1ZQ1C 2B0CA 1ZJMA 2KVCA 4BDPA 5DBCA 4PZNA 4X4PA 4DWIA 4LEVA 4DF8A 5AI5A 4PHPA 2J6TA 5L9XA 3U26A 4XJEA 3F5AA 3LDAA 1RYUA 4B9MA 3PY8A 4RQ3A 5KFAA 4O3QA 1WOTA 4BUGA 1YZ7A 2F8KA 4KLLA 3OV7A 3K7DA 3ZDBA 1DK2A 4DL4A 2DPIA 3H4BA 1WWVA 2YX8A 4QWDA 4QW8A 4MEYA 2FDRA
chains in the Genus database with same CATH topology
2HHUA 5L1IA 2W8KA 1NK6A 5JUMA 4R63A 4XUSA 4GC6A 4ED8A 3N97B 2UVVA 5HR9A 4YR0A 4XA5A 4X4OA 4B9SA 3BQ0A 2KFNA 9ICJA 9ICVA 4DLGA 4I2CA 4YMOA 3T5JA 4WC4A 4J9LA 1T4GA 1JQRA 2AQ4A 4XQ8A 3ZD8A 4QZAA 1ZQKA 4RQ0A 1S76D 2GWSA 2J6SA 4UBCA 1S10A 1U45A 4O5EA 4RQ5A 5KFNA 1BPDA 5IIMA 7ICMA 4AT8B 4XRHA 4R66A 3LWLA 3GIIA 4ED2A 4G3IA 3T3FA 2RFFA 1NJWA 4AT9A 1WCLA 4I2JA 5CJ7A 5TZVA 4RZRA 4I2DA 3QZ7A 5J2DA 1L3SA 5HRFA 4JV0A 4R8UB 4UB1A 2VA8A 3MGIA 3SV4A 2W9BB 1Q78A 2HW3A 1SL1A 1NJXA 2I9GA 5KFYA 2WTFA 1BVSA 1BPYA 4K4IA 5DECA 5KFTA 1S0NA 4LT6A 1ZQOA 2BCUA 3H8SA 2R8KA 4PGYA 1RYSA 1BPBA 1JX4A 4C8KA 5F9NA 3TI0A 2FLLA 8ICFA 1JN3A 1NZPA 4IRCA 3HJ1A 4DSLA 1UEUA 3E2EA 4IQUA 3H3AA 1ZQQA 4I2EA 4I2HA 4F8RA 1HJPA 3RRGA 4ED7A 7ICHA 3GV7B 5HHIA 3MR5A 1U9LA 4F93B 3RB3A 5KFVA 1T8EA 8ICJA 3L9DA 4UD5A 5CP2A 3C21A 4KTQA 5J2CA 5KT2A 1NKCA 4ECWA 4X4VA 2BR0A 3V6KA 5KFIA 4J9OA 4F4XA 2PBEA 1TK5A 1SKWA 2NRVA 4QZIA 4DSEA 4MFCA 4LZDA 4I27A 2Y1JA 5KFXA 3C2MA 5KG5A 4I28A 4RQ6A 2R8IA 5J2KA 2JEGA 4I29A 2HHWA 4P2HA 4J9MA 5D49A 3KHHA 2AQ0A 2PXIA 4X5VA 1QTMA 4M9JA 4M5DA 3ZDCA 2XY6A 1TAUA 4KLUA 4F4KA 5HRIA 5KG0A 3B0YA 4RQ7A 3BJYA 4E80A 4YFKA 2AGOA 4B9TA 5KFGA 5DBBA 3HW8A 4EBCA 2BQUA 8ICTA 1PX5A 3AQKA 2ASLA 5DLGA 3T5KA 4Z6EA 3QEBZ 1NJZA 1NK9A 4NY8A 3PX4A 8ICSA 4X0BA 2ZJAA 4F2SA 3OGUA 4Z6FA 4C8OA 3HJ4A 2F1IA 1S9FA 1ZYQA 4QZEA 5KFUA 2IHMA 5DBAA 4O5KA 1L3UA 1D8YA 4O3RA 2A1JA 4O3NA 4EEYA 3AU6A 2KFZA 2B21A 3K4GA 4DS5A 5J0XA 1SL2A 3RJHA 3SI8A 4RQ2A 3RBEA 3TFSA 3RR8A 4FBUA 1B43A 1TAQA 3M9NB 4NLGA 7ICEA 9ICPA 3ZDEA 4PHDA 1NK7A 5KFSA 5J2GA 3JPOA 2HHSA 2BCSA 1ZQXA 3T5HA 2M2UA 5DKWA 4NLKA 1Y88A 2XC9A 1KNYA 2NRTA 5DQIA 1K1QA 1SKSA 9ICIA 4ECTA 5KFWA 1LB2B 4DQIA 3NYBA 3GIKA 7ICUA 2C2RA 5KFOA 9ICLA 5DG9A 3ISBA 4YXJA 4X4UA 2OWOA 3H8JA 1T7PA 1UA0A 3PO4A 4PHAA 4ECQA 4DFKA 1D9DA 3FDSA 1U4BA 7ICNA 1KFTA 1KEJA 4GXKA 4X4QA 4FO6A 7ICQA 3H4DA 5DDMA 4PGQA 4JUZA 3TARA 1BPXA 3ORYA 4QZCA 1QSLA 3GV8B 9ICOA 1TK8A 4EZ9A 4WC6A 5HREA 3QE9Y 3PNCA 1VFGA 4NKTA 4QZFA 2R8JA 4B9NA 5HMLA 3C1ZA 4R64A 2BPGA 1R8AA 2F1HA 3H7IA 3Q8PB 2KN7A 1ZQVA 8ICXA 5KFMA 1S0MA 1PZNA 3PW2A 1T3NA 4CCHA 3PW0A 1YLQA 2BHNA 3G6XA 3Q8MA 2W9MA 5L1KA 7ICJA 5KT6A 4MFAA 2KZZA 3PMNA 4RQ1A 2W9CB 3H38A 1NOMA 5IIIA 2V4RA 4JV2A 5EWGA 2ZH8A 2UVRA 3RJFA 2HHVA 2VANA 5F2VO 5KFLA 4F3OA 4YN4A 9ICHA 4PPXA 3H39A 5J0WA 2C28A 1ZQHA 2ZHBA 2W9AA 2ZTEA 2A1JB 4FS2A 3KHRA 2FMPA 3V6HA 1MC8A 1DGSA 4K4GA 4RWQA 5J0RA 2KP7A 4WC2A 7ICSA 9ICNA 5DQHA 4NM2A 1NK8A 2PFOA 5HMMA 8ICRA 4S3NA 1NK4A 3OHAA 4YXMA 4UBBA 4BWJA 1ZQAA 2BQRA 3TQ1A 8ICVA 3G6VA 1OU5A 4YD2A 2ID1A 2Q66A 3M9MB 3UXNA 2P6UA 5KFEA 5KFRA 4DOCA 2XY5A 8ICEA 3FYHA 5L1LA 7ICGA 1K1SA 3Q8RB 1U47A 2PI5A 4M9GA 4EYHB 2ZH1A 5J2BA 5J2HA 3GFKB 4KLOA 2ZJ5A 4GXIA 1EXNA 1HUZA 3LQCB 7ICVA 4I2FA 4LZGA 1N48A 2ISPA 1BPZA 2MUTA 4IQWA 2ZH2A 4NKUA 1XSLA 4R65A 3GDXA 4DLEA 3JZ0A 3Q8SB 3V7KA 4E0DA 1SKRA 4QZ8A 5IINA 3V72A 1CEZA 4EBEA 1KRPA 1L5UA 3RH5A 1JXEA 5CB1A 3UPSA 4E7XA 5BOLA 4KLTA 4HYKA 1F5AA 4AT7B 2BCQA 9ICQA 1QLNA 4DL6A 1NK5A 4XQ7A 3AQLA 1DOQA 1UEVA 1KFSA 4RU9A 5J2JA 4BXOA 3ETLA 4M0AA 3EYZA 4Z6DA 4C8LA 9ICRA 1UETA 9ICEA 4DSFA 3C23A 4YG2A 4F92B 3RAQA 4EP7A 1ZQJA 2M9NA 2ZUBA 4QW9A 3RH4A 2DR8A 4WBYA 3MBYA 1TFRA 9ICGA 5CR0A 5L1JA 4F4YA 4UAYA 4KLHA 9ICWA 3JPRA 3OUYA 4MEXA 1ZQWA 3NTUA 1XS9D 5KT7A 9ICBA 4DOAA 4DS4A 2ZH3A 1B22A 3KHLA 4WC0A 3WFRE 5CWRA 8ICAA 3LK9A 5J2EA 4UB2A 3JPSA 3RTVA 7ICFA 2AGQA 3JYYA 4WC5A 4GC7A 4I2AA 2ZTCA 5J0OA 3AQMA 2LYHA 1CUKA 5KT3A 4TUPA 1QSSA 2IHNA 3ZDDA 4WBZA 4M9HA 4PH5A 4GXJA 4KLJA 3NGDA 3HT3A 4DL5A 5KG2A 2J6UA 1SL0A 1KLNA 2XGPA 3MR2A 4DFMA 1Q79A 3PR5B 1IM4A 2H5XA 1XSPA 2C2EA 1ZQCA 4UAZA 4FBTA 2ZH7A 4DL7A 3RRHA 1TFYA 4M9NA 5EOZA 4DQRA 4RQ8A 2Y1IA 5J0TA 1MSWD 2ATLA 9ICSA 2MUTB 3PR4A 3UPQA 4QWAA 1KFDA 4F50A 4DO9A 2ZHAA 3JPQA 3H37A 4M6WA 2P66A 4IR1A 4AT9B 2ZH9A 4IQVA 5DGAA 3Q8QB 3OSPA 1TKDA 1S77D 4E8FA 3OHBA 3RBDA 4RQ4A 3RJKA 1S0VA 1RYRA 5KG6A 4YMNA 4YR2A 4UB4A 3SV3A 1ZQDA 4KLDA 4RWNA 2NRKA 4YCXA 5CHGA 5IIKA 2BPFA 2FLPA 4IRKA 9ICXA 3MDCA 3M9OB 4F5QA 3MABA 4MFFA 3PV8A 4WC1A 5BOMA 4PGXA 1NKEA 4WCWA 1TK0A 4B9VA 1JAJA 3OJUA 4FHVA 2V4QA 4MF8A 4J9QA 3QEAZ 1C7YA 4KLQA 8ICHA 2ALZA 1U48A 2DFLA 1S0OA 4QZBA 3GIJA 4ATBA 4O0IA 8ICCA 1MQ2A 3AU2A 3HIYA 3PX0A 4EBDA 3ISCA 1MIWA 4C8NA 2AGPA 3ZD9A 3PO5A 4J9RA 1AROP 4FHXA 4F5NA 1HUOA 4DSJA 4Q8EA 1JMSA 1R8CA 4O3OA 2ZH6A 3PW7A 1BNPA 5KFHA 5HP4A 1A76A 4DFPA 4PHEA 3EW9A 2C22A 7ICPA 1DK3A 4RPZA 4UB3A 1ZETA 2FLNA 5DG8A 4EBKA 5D46A 2ZUCA 3GV5B 3EPIA 1D9FA 3UXOA 5KFDA 4KMUA 8ICZA 8ICLA 4KLIA 4Z6CA 4IR9A 2DVIA 3BQ2A 1TV9A 2BKEA 4QZHA 1QSYA 1UT8A 1KTQA 4F2RA 2ZUDA 3C5FA 3MR3A 5IILA 2JEJA 2VA3A 1Z00A 4FHYA 1V9PA 4RUCA 2AJQA 4ECZA 4ED1A 8ICYA 1COOA 1XU4A 4R8UA 1ZQZA 4BWMA 5KFJA 2PFPA 4RT3A 1X9MA 2W9BA 3RH6A 2IBKA 3GILA 1ZQRA 4KLFA 9ICTA 4DL2A 4X4RA 3GIMA 3PVXA 1ZQEA 4DQQA 1FA0A 8ICPA 4TURA 3WFSC 3AQNA 2RDIA 3V7JA 2PFNA 4RNOA 3G6YA 3WFQE 5KFZA 4J9KA 2ZH5A 3V7LA 5J29A 5DDYA 4RNNA 3RJGA 4BGDA 4RNMA 3PMLA 5HRHA 1RXWA 4RUAA 3V6JA 2IA6A 1R89A 4ZH4A 2RDJA 4KLEA 1RPLA 4ECVA 2BCVA 5KFKA 5J0SA 1ZQLA 2JZBA 2JEIA 9ICUA 4F4WA 1N56A 8ICOA 4F91B 3OJSA 4ED3A 1ZQNA 4Q8FA 7ICKA 7ICOA 4ATBB 2AU0A 4I2BA 2M2WA 2DR9A 4NLZA 3UXPA 4NM1A 5KT4A 5BPCA 2FMSA 5DB7A 4EZ6A 1R8BA 5IIOA 5DEDA 7ICLA 3TAPA 3MR6A 1ZQTA 1S97A 4DSKA 4KLSA 8ICGA 1ZQFA 4NLNA 2I1QA 2PFQA 4ELVA 4X4SA 3JPNA 1ZQMA 4KLMA 5KFFA 5KT5A 4QWBA 5KG3A 7ICIA 2IMWP 4B9UA 4ECRA 2ZJ8A 3H40A 4O5CA 2NRWA 1X9SA 3WFPA 4O3PA 3UQ2A 2MAXA 5HRLA 3RB0A 4P4PA 3RJIA 2ASDA 1H38A 3MFHA 2BQ3A 1BNOA 2XGQA 3MFIA 4DFJA 1JXLA 1XSNA 5KG7A 4RWPA 3C1YA 3OVBA 4JWNA 4X4NA 3THVA 1Z00B 3MDAA 3TANA 2R8HA 3KTQA 2FPMA 2ZH4A 3M8SA 4RT2A 2DR7A 2PI4A 4KN7A 4M47A 5HRBA 2XCPA 1JIHA 2VA2A 4LVSA 3AUOA 8ICMA 4TUSA 3PW5A 5EWEA 4YD1A 5HHHA 4JK1A 3TFRA 2M2VA 4IQTA 1NO5A 3QZ8A 3LWMA 1D8LA 1ZQSA 4O9MA 2FMQA 2V9WA 3M8RA 4FH5A 3IM1A 1RXVA 1ZQGA 5HRKA 7ICTA 4P4OA 2KTQA 4Q43A 4WC7A 2ASJA 2ISOA 4JV1A 1XO1A 3KHGA 9ICCA 5DLFA 3T5LA 2JZBB 4ELUA 5HRDA 3OVAA 2DRAA 4TQSA 5KG4A 4KITB 5F9LA 4ECYA 3TAQA 2DR5A 1XWLA 1Z3EB 3EZ5A 2HHTA 3H8WA 4KN4A 4DQPA 2BDPA 3RJEA 5J2AA 3ISDA 4M9LA 4I2GA 3C66A 1TFWA 1LV5A 1KSPA 1ZQBA 4FHWA 4Q45A 2JEFA 3BQTA 4RPYA 5DG7A 1KDHA 2BE3A 3OVSA 5D4BA 3MGHA 4F5PA 1TVAA 2NRXA 2XCAA 4UD4A 2W8LA 3K75D 4YR3A 4UAWA 2C2DA 4RPXA 5DB6A 4QWCA 4J9SA 1U49A 8ICNA 3BQ1A 8ICWA 1BGXT 4FHPA 3HX0A 4J9NA 4Q44A 4ED6A 1VJ7A 3RAXA 5J0QA 3EPGA 4YVZA 1ZQUA 2W9CA 5KFBA 4ECXA 2FPLA 1UT5A 2BPCA 3Q8LA 2P6RA 4B9LA 9ICAA 2HHQA 4NXZA 5CA7A 4QWEA 8ICQA 5IIJA 4JWMA 4BXOB 5C5JA 3SZ2A 1XC9A 3IHQB 5DB9A 5J0YA 4IRDA 4MF2A 4K4HA 2HVHA 4UB5A 4QZ9A 9ICFA 5KFCA 5KTQA 1X9WA 1NKBA 5HC9A 4O3SA 4YMMA 3UQ0A 3C2KA 1MIVA 2KZ3A 4YP3A 1V4AA 2ZTDA 3OUYB 1ZQPA 2R8GA 4KLGA 3BDPA 4ECSA 4FH3A 4DEZA 1L3TA 4F5RA 5J2FA 2Q0ZX 4TQRA 3ZDAA 1A77A 4DQSA 1ZQIA 2UVUA 4M2YA 3B0XA 5DGBA 4UQGA 2XO7A 4GLXA 3RB4A 8ICKA 1MIYA 2HVIA 4ELTA 2BGWA 9ICMA 4EYIB 2HHPA 4RWOA 2DRBA 5KFPA 1RZTA 2FPKA 2F1JA 3JPPA 2HHXA 4X4TA 1X2IA 1ZJNA 3C18A 5J0PA 3JPTA 4ED0A 5HNKA 3HP6A 2KZMA 4EBJA 4C8MA 1MQ3A 4AT8A 4TUQA 4QZGA 4FS1A 2O1PA 3WFOA 4J9PA 2NRZA 5J2IA 4YQWA 3PX6A 4M04A 3SYZA 3RJJA 4DSIA 2UVWA 4QZDA 1SZPA 4P4MA 4DL3A 4M6WB 4DF4A 4IG8A 1ZJMA 3N4MB 4BDPA 5DBCA 3Q8KA 3RB6A 4X4PA 1IXRA 3HPOA 3RR7A 4F5OA 4DWIA 8ICUA 4DF8A 2BCRA 5KG1A 4PHPA 1UA1A 3C2LA 4AT7A 2M2TA 2J6TA 5L9XA 5DB8A 1BPEA 3PW4A 3EWAA 3LDAA 8ICBA 4B9MA 1L3VA 1ZQYA 1WCNA 4I2IA 4DOBA 3PY8A 4RQ3A 4WC3A 5KFAA 4O3QA 1NK0A 1WOTA 4F4ZA 4KLLA 8ICIA 5HRGA 5DQGA 2DPJA 3C5GA 4X0AA 3OV7A 3HWTA 5EWFA 3OSNA 2XY7A 3ZDBA 2O5AA 1DK2A 9ICKA 5J0UA 4DL4A 2DPIA 7ICRA 3H4BA 4QWDA 3GQCA 1NJYA 4ECUA 4QW8A 4MEYA 5KFQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HHU A;  5L1I A;  2W8K A;  1NK6 A;  5JUM A;  4R63 A;  4XUS A;  4GC6 A;  4ED8 A;  3N97 B;  2UVV A;  5HR9 A;  4YR0 A;  4XA5 A;  4X4O A;  4B9S A;  3BQ0 A;  2KFN A;  9ICJ A;  9ICV A;  4DLG A;  4I2C A;  4YMO A;  3T5J A;  4WC4 A;  4J9L A;  1T4G A;  1JQR A;  2AQ4 A;  4XQ8 A;  3ZD8 A;  4QZA A;  1ZQK A;  4RQ0 A;  1S76 D;  2GWS A;  2J6S A;  4UBC A;  1S10 A;  1U45 A;  4O5E A;  4RQ5 A;  5KFN A;  1BPD A;  5IIM A;  7ICM A;  4AT8 B;  4XRH A;  4R66 A;  3LWL A;  3GII A;  4ED2 A;  4G3I A;  3T3F A;  2RFF A;  1NJW A;  4AT9 A;  1WCL A;  4I2J A;  5CJ7 A;  5TZV A;  4RZR A;  4I2D A;  3QZ7 A;  5J2D A;  1L3S A;  5HRF A;  4JV0 A;  4R8U B;  4UB1 A;  2VA8 A;  3MGI A;  3SV4 A;  2W9B B;  1Q78 A;  2HW3 A;  1SL1 A;  1NJX A;  2I9G A;  5KFY A;  2WTF A;  1BVS A;  1BPY A;  4K4I A;  5DEC A;  5KFT A;  1S0N A;  4LT6 A;  1ZQO A;  2BCU A;  3H8S A;  2R8K A;  4PGY A;  1RYS A;  1BPB A;  1JX4 A;  4C8K A;  5F9N A;  3TI0 A;  2FLL A;  8ICF A;  1JN3 A;  1NZP A;  4IRC A;  3HJ1 A;  4DSL A;  1UEU A;  3E2E A;  4IQU A;  3H3A A;  1ZQQ A;  4I2E A;  4I2H A;  4F8R A;  1HJP A;  3RRG A;  4ED7 A;  7ICH A;  3GV7 B;  5HHI A;  3MR5 A;  1U9L A;  4F93 B;  3RB3 A;  5KFV A;  1T8E A;  8ICJ A;  3L9D A;  4UD5 A;  5CP2 A;  3C21 A;  4KTQ A;  5J2C A;  5KT2 A;  1NKC A;  4ECW A;  4X4V A;  2BR0 A;  3V6K A;  5KFI A;  4J9O A;  4F4X A;  2PBE A;  1TK5 A;  1SKW A;  2NRV A;  4QZI A;  4DSE A;  4MFC A;  4LZD A;  4I27 A;  2Y1J A;  5KFX A;  3C2M A;  5KG5 A;  4I28 A;  4RQ6 A;  2R8I A;  5J2K A;  2JEG A;  4I29 A;  2HHW A;  4P2H A;  4J9M A;  5D49 A;  3KHH A;  2AQ0 A;  2PXI A;  4X5V A;  1QTM A;  4M9J A;  4M5D A;  3ZDC A;  2XY6 A;  1TAU A;  4KLU A;  4F4K A;  5HRI A;  5KG0 A;  3B0Y A;  4RQ7 A;  3BJY A;  4E80 A;  4YFK A;  2AGO A;  4B9T A;  5KFG A;  5DBB A;  3HW8 A;  4EBC A;  2BQU A;  8ICT A;  1PX5 A;  3AQK A;  2ASL A;  5DLG A;  3T5K A;  4Z6E A;  3QEB Z;  1NJZ A;  1NK9 A;  4NY8 A;  3PX4 A;  8ICS A;  4X0B A;  2ZJA A;  4F2S A;  3OGU A;  4Z6F A;  4C8O A;  3HJ4 A;  2F1I A;  1S9F A;  1ZYQ A;  4QZE A;  5KFU A;  2IHM A;  5DBA A;  4O5K A;  1L3U A;  1D8Y A;  4O3R A;  2A1J A;  4O3N A;  4EEY A;  3AU6 A;  2KFZ A;  2B21 A;  3K4G A;  4DS5 A;  5J0X A;  1SL2 A;  3RJH A;  3SI8 A;  4RQ2 A;  3RBE A;  3TFS A;  3RR8 A;  4FBU A;  1B43 A;  1TAQ A;  3M9N B;  4NLG A;  7ICE A;  9ICP A;  3ZDE A;  4PHD A;  1NK7 A;  5KFS A;  5J2G A;  3JPO A;  2HHS A;  2BCS A;  1ZQX A;  3T5H A;  2M2U A;  5DKW A;  4NLK A;  1Y88 A;  2XC9 A;  1KNY A;  2NRT A;  5DQI A;  1K1Q A;  1SKS A;  9ICI A;  4ECT A;  5KFW A;  1LB2 B;  4DQI A;  3NYB A;  3GIK A;  7ICU A;  2C2R A;  5KFO A;  9ICL A;  5DG9 A;  3ISB A;  4YXJ A;  4X4U A;  2OWO A;  3H8J A;  1T7P A;  1UA0 A;  3PO4 A;  4PHA A;  4ECQ A;  4DFK A;  1D9D A;  3FDS A;  1U4B A;  7ICN A;  1KFT A;  1KEJ A;  4GXK A;  4X4Q A;  4FO6 A;  7ICQ A;  3H4D A;  5DDM A;  4PGQ A;  4JUZ A;  3TAR A;  1BPX A;  3ORY A;  4QZC A;  1QSL A;  3GV8 B;  9ICO A;  1TK8 A;  4EZ9 A;  4WC6 A;  5HRE A;  3QE9 Y;  3PNC A;  1VFG A;  4NKT A;  4QZF A;  2R8J A;  4B9N A;  5HML A;  3C1Z A;  4R64 A;  2BPG A;  1R8A A;  2F1H A;  3H7I A;  3Q8P B;  2KN7 A;  1ZQV A;  8ICX A;  5KFM A;  1S0M A;  1PZN A;  3PW2 A;  1T3N A;  4CCH A;  3PW0 A;  1YLQ A;  2BHN A;  3G6X A;  3Q8M A;  2W9M A;  5L1K A;  7ICJ A;  5KT6 A;  4MFA A;  2KZZ A;  3PMN A;  4RQ1 A;  2W9C B;  3H38 A;  1NOM A;  5III A;  2V4R A;  4JV2 A;  5EWG A;  2ZH8 A;  2UVR A;  3RJF A;  2HHV A;  2VAN A;  5F2V O;  5KFL A;  4F3O A;  4YN4 A;  9ICH A;  4PPX A;  3H39 A;  5J0W A;  2C28 A;  1ZQH A;  2ZHB A;  2W9A A;  2ZTE A;  2A1J B;  4FS2 A;  3KHR A;  2FMP A;  3V6H A;  1MC8 A;  1DGS A;  4K4G A;  4RWQ A;  5J0R A;  2KP7 A;  4WC2 A;  7ICS A;  9ICN A;  5DQH A;  4NM2 A;  1NK8 A;  2PFO A;  5HMM A;  8ICR A;  4S3N A;  1NK4 A;  3OHA A;  4YXM A;  4UBB A;  4BWJ A;  1ZQA A;  2BQR A;  3TQ1 A;  8ICV A;  3G6V A;  1OU5 A;  4YD2 A;  2ID1 A;  2Q66 A;  3M9M B;  3UXN A;  2P6U A;  5KFE A;  5KFR A;  4DOC A;  2XY5 A;  8ICE A;  3FYH A;  5L1L A;  7ICG A;  1K1S A;  3Q8R B;  1U47 A;  2PI5 A;  4M9G A;  4EYH B;  2ZH1 A;  5J2B A;  5J2H A;  3GFK B;  4KLO A;  2ZJ5 A;  4GXI A;  1EXN A;  1HUZ A;  3LQC B;  7ICV A;  4I2F A;  4LZG A;  1N48 A;  2ISP A;  1BPZ A;  2MUT A;  4IQW A;  2ZH2 A;  4NKU A;  1XSL A;  4R65 A;  3GDX A;  4DLE A;  3JZ0 A;  3Q8S B;  3V7K A;  4E0D A;  1SKR A;  4QZ8 A;  5IIN A;  3V72 A;  1CEZ A;  4EBE A;  1KRP A;  1L5U A;  3RH5 A;  1JXE A;  5CB1 A;  3UPS A;  4E7X A;  5BOL A;  4KLT A;  4HYK A;  1F5A A;  4AT7 B;  2BCQ A;  9ICQ A;  1QLN A;  4DL6 A;  1NK5 A;  4XQ7 A;  3AQL A;  1DOQ A;  1UEV A;  1KFS A;  4RU9 A;  5J2J A;  4BXO A;  3ETL A;  4M0A A;  3EYZ A;  4Z6D A;  4C8L A;  9ICR A;  1UET A;  9ICE A;  4DSF A;  3C23 A;  4YG2 A;  4F92 B;  3RAQ A;  4EP7 A;  1ZQJ A;  2M9N A;  2ZUB A;  4QW9 A;  3RH4 A;  2DR8 A;  4WBY A;  3MBY A;  1TFR A;  9ICG A;  5CR0 A;  5L1J A;  4F4Y A;  4UAY A;  4KLH A;  9ICW A;  3JPR A;  3OUY A;  4MEX A;  1ZQW A;  3NTU A;  1XS9 D;  5KT7 A;  9ICB A;  4DOA A;  4DS4 A;  2ZH3 A;  1B22 A;  3KHL A;  4WC0 A;  3WFR E;  5CWR A;  8ICA A;  3LK9 A;  5J2E A;  4UB2 A;  3JPS A;  3RTV A;  7ICF A;  2AGQ A;  3JYY A;  4WC5 A;  4GC7 A;  4I2A A;  2ZTC A;  5J0O A;  3AQM A;  2LYH A;  1CUK A;  5KT3 A;  4TUP A;  1QSS A;  2IHN A;  3ZDD A;  4WBZ A;  4M9H A;  4PH5 A;  4GXJ A;  4KLJ A;  3NGD A;  3HT3 A;  4DL5 A;  5KG2 A;  2J6U A;  1SL0 A;  1KLN A;  2XGP A;  3MR2 A;  4DFM A;  1Q79 A;  3PR5 B;  1IM4 A;  2H5X A;  1XSP A;  2C2E A;  1ZQC A;  4UAZ A;  4FBT A;  2ZH7 A;  4DL7 A;  3RRH A;  1TFY A;  4M9N A;  5EOZ A;  4DQR A;  4RQ8 A;  2Y1I A;  5J0T A;  1MSW D;  2ATL A;  9ICS A;  2MUT B;  3PR4 A;  3UPQ A;  4QWA A;  1KFD A;  4F50 A;  4DO9 A;  2ZHA A;  3JPQ A;  3H37 A;  4M6W A;  2P66 A;  4IR1 A;  4AT9 B;  2ZH9 A;  4IQV A;  5DGA A;  3Q8Q B;  3OSP A;  1TKD A;  1S77 D;  4E8F A;  3OHB A;  3RBD A;  4RQ4 A;  3RJK A;  1S0V A;  1RYR A;  5KG6 A;  4YMN A;  4YR2 A;  4UB4 A;  3SV3 A;  1ZQD A;  4KLD A;  4RWN A;  2NRK A;  4YCX A;  5CHG A;  5IIK A;  2BPF A;  2FLP A;  4IRK A;  9ICX A;  3MDC A;  3M9O B;  4F5Q A;  3MAB A;  4MFF A;  3PV8 A;  4WC1 A;  5BOM A;  4PGX A;  1NKE A;  4WCW A;  1TK0 A;  4B9V A;  1JAJ A;  3OJU A;  4FHV A;  2V4Q A;  4MF8 A;  4J9Q A;  3QEA Z;  1C7Y A;  4KLQ A;  8ICH A;  2ALZ A;  1U48 A;  2DFL A;  1S0O A;  4QZB A;  3GIJ A;  4ATB A;  4O0I A;  8ICC A;  1MQ2 A;  3AU2 A;  3HIY A;  3PX0 A;  4EBD A;  3ISC A;  1MIW A;  4C8N A;  2AGP A;  3ZD9 A;  3PO5 A;  4J9R A;  1ARO P;  4FHX A;  4F5N A;  1HUO A;  4DSJ A;  4Q8E A;  1JMS A;  1R8C A;  4O3O A;  2ZH6 A;  3PW7 A;  1BNP A;  5KFH A;  5HP4 A;  1A76 A;  4DFP A;  4PHE A;  3EW9 A;  2C22 A;  7ICP A;  1DK3 A;  4RPZ A;  4UB3 A;  1ZET A;  2FLN A;  5DG8 A;  4EBK A;  5D46 A;  2ZUC A;  3GV5 B;  3EPI A;  1D9F A;  3UXO A;  5KFD A;  4KMU A;  8ICZ A;  8ICL A;  4KLI A;  4Z6C A;  4IR9 A;  2DVI A;  3BQ2 A;  1TV9 A;  2BKE A;  4QZH A;  1QSY A;  1UT8 A;  1KTQ A;  4F2R A;  2ZUD A;  3C5F A;  3MR3 A;  5IIL A;  2JEJ A;  2VA3 A;  1Z00 A;  4FHY A;  1V9P A;  4RUC A;  2AJQ A;  4ECZ A;  4ED1 A;  8ICY A;  1COO A;  1XU4 A;  4R8U A;  1ZQZ A;  4BWM A;  5KFJ A;  2PFP A;  4RT3 A;  1X9M A;  2W9B A;  3RH6 A;  2IBK A;  3GIL A;  1ZQR A;  4KLF A;  9ICT A;  4DL2 A;  4X4R A;  3GIM A;  3PVX A;  1ZQE A;  4DQQ A;  1FA0 A;  8ICP A;  4TUR A;  3WFS C;  3AQN A;  2RDI A;  3V7J A;  2PFN A;  4RNO A;  3G6Y A;  3WFQ E;  5KFZ A;  4J9K A;  2ZH5 A;  3V7L A;  5J29 A;  5DDY A;  4RNN A;  3RJG A;  4BGD A;  4RNM A;  3PML A;  5HRH A;  1RXW A;  4RUA A;  3V6J A;  2IA6 A;  1R89 A;  4ZH4 A;  2RDJ A;  4KLE A;  1RPL A;  4ECV A;  2BCV A;  5KFK A;  5J0S A;  1ZQL A;  2JZB A;  2JEI A;  9ICU A;  4F4W A;  1N56 A;  8ICO A;  4F91 B;  3OJS A;  4ED3 A;  1ZQN A;  4Q8F A;  7ICK A;  7ICO A;  4ATB B;  2AU0 A;  4I2B A;  2M2W A;  2DR9 A;  4NLZ A;  3UXP A;  4NM1 A;  5KT4 A;  5BPC A;  2FMS A;  5DB7 A;  4EZ6 A;  1R8B A;  5IIO A;  5DED A;  7ICL A;  3TAP A;  3MR6 A;  1ZQT A;  1S97 A;  4DSK A;  4KLS A;  8ICG A;  1ZQF A;  4NLN A;  2I1Q A;  2PFQ A;  4ELV A;  4X4S A;  3JPN A;  1ZQM A;  4KLM A;  5KFF A;  5KT5 A;  4QWB A;  5KG3 A;  7ICI A;  2IMW P;  4B9U A;  4ECR A;  2ZJ8 A;  3H40 A;  4O5C A;  2NRW A;  1X9S A;  3WFP A;  4O3P A;  3UQ2 A;  2MAX A;  5HRL A;  3RB0 A;  4P4P A;  3RJI A;  2ASD A;  1H38 A;  3MFH A;  2BQ3 A;  1BNO A;  2XGQ A;  3MFI A;  4DFJ A;  1JXL A;  1XSN A;  5KG7 A;  4RWP A;  3C1Y A;  3OVB A;  4JWN A;  4X4N A;  3THV A;  1Z00 B;  3MDA A;  3TAN A;  2R8H A;  3KTQ A;  2FPM A;  2ZH4 A;  3M8S A;  4RT2 A;  2DR7 A;  2PI4 A;  4KN7 A;  4M47 A;  5HRB A;  2XCP A;  1JIH A;  2VA2 A;  4LVS A;  3AUO A;  8ICM A;  4TUS A;  3PW5 A;  5EWE A;  4YD1 A;  5HHH A;  4JK1 A;  3TFR A;  2M2V A;  4IQT A;  1NO5 A;  3QZ8 A;  3LWM A;  1D8L A;  1ZQS A;  4O9M A;  2FMQ A;  2V9W A;  3M8R A;  4FH5 A;  3IM1 A;  1RXV A;  1ZQG A;  5HRK A;  7ICT A;  4P4O A;  2KTQ A;  4Q43 A;  4WC7 A;  2ASJ A;  2ISO A;  4JV1 A;  1XO1 A;  3KHG A;  9ICC A;  5DLF A;  3T5L A;  2JZB B;  4ELU A;  5HRD A;  3OVA A;  2DRA A;  4TQS A;  5KG4 A;  4KIT B;  5F9L A;  4ECY A;  3TAQ A;  2DR5 A;  1XWL A;  1Z3E B;  3EZ5 A;  2HHT A;  3H8W A;  4KN4 A;  4DQP A;  2BDP A;  3RJE A;  5J2A A;  3ISD A;  4M9L A;  4I2G A;  3C66 A;  1TFW A;  1LV5 A;  1KSP A;  1ZQB A;  4FHW A;  4Q45 A;  2JEF A;  3BQT A;  4RPY A;  5DG7 A;  1KDH A;  2BE3 A;  3OVS A;  5D4B A;  3MGH A;  4F5P A;  1TVA A;  2NRX A;  2XCA A;  4UD4 A;  2W8L A;  3K75 D;  4YR3 A;  4UAW A;  2C2D A;  4RPX A;  5DB6 A;  4QWC A;  4J9S A;  1U49 A;  8ICN A;  3BQ1 A;  8ICW A;  1BGX T;  4FHP A;  3HX0 A;  4J9N A;  4Q44 A;  4ED6 A;  1VJ7 A;  3RAX A;  5J0Q A;  3EPG A;  4YVZ A;  1ZQU A;  2W9C A;  5KFB A;  4ECX A;  2FPL A;  1UT5 A;  2BPC A;  3Q8L A;  2P6R A;  4B9L A;  9ICA A;  2HHQ A;  4NXZ A;  5CA7 A;  4QWE A;  8ICQ A;  5IIJ A;  4JWM A;  4BXO B;  5C5J A;  3SZ2 A;  1XC9 A;  3IHQ B;  5DB9 A;  5J0Y A;  4IRD A;  4MF2 A;  4K4H A;  2HVH A;  4UB5 A;  4QZ9 A;  9ICF A;  5KFC A;  5KTQ A;  1X9W A;  1NKB A;  5HC9 A;  4O3S A;  4YMM A;  3UQ0 A;  3C2K A;  1MIV A;  2KZ3 A;  4YP3 A;  1V4A A;  2ZTD A;  3OUY B;  1ZQP A;  2R8G A;  4KLG A;  3BDP A;  4ECS A;  4FH3 A;  4DEZ A;  1L3T A;  4F5R A;  5J2F A;  2Q0Z X;  4TQR A;  3ZDA A;  1A77 A;  4DQS A;  1ZQI A;  2UVU A;  4M2Y A;  3B0X A;  5DGB A;  4UQG A;  2XO7 A;  4GLX A;  3RB4 A;  8ICK A;  1MIY A;  2HVI A;  4ELT A;  2BGW A;  9ICM A;  4EYI B;  2HHP A;  4RWO A;  2DRB A;  5KFP A;  1RZT A;  2FPK A;  2F1J A;  3JPP A;  2HHX A;  4X4T A;  1X2I A;  1ZJN A;  3C18 A;  5J0P A;  3JPT A;  4ED0 A;  5HNK A;  3HP6 A;  2KZM A;  4EBJ A;  4C8M A;  1MQ3 A;  4AT8 A;  4TUQ A;  4QZG A;  4FS1 A;  2O1P A;  3WFO A;  4J9P A;  2NRZ A;  5J2I A;  4YQW A;  3PX6 A;  4M04 A;  3SYZ A;  3RJJ A;  4DSI A;  2UVW A;  4QZD A;  1SZP A;  4P4M A;  4DL3 A;  4M6W B;  4DF4 A;  4IG8 A;  1ZJM A;  3N4M B;  4BDP A;  5DBC A;  3Q8K A;  3RB6 A;  4X4P A;  1IXR A;  3HPO A;  3RR7 A;  4F5O A;  4DWI A;  8ICU A;  4DF8 A;  2BCR A;  5KG1 A;  4PHP A;  1UA1 A;  3C2L A;  4AT7 A;  2M2T A;  2J6T A;  5L9X A;  5DB8 A;  1BPE A;  3PW4 A;  3EWA A;  3LDA A;  8ICB A;  4B9M A;  1L3V A;  1ZQY A;  1WCN A;  4I2I A;  4DOB A;  3PY8 A;  4RQ3 A;  4WC3 A;  5KFA A;  4O3Q A;  1NK0 A;  1WOT A;  4F4Z A;  4KLL A;  8ICI A;  5HRG A;  5DQG A;  2DPJ A;  3C5G A;  4X0A A;  3OV7 A;  3HWT A;  5EWF A;  3OSN A;  2XY7 A;  3ZDB A;  2O5A A;  1DK2 A;  9ICK A;  5J0U A;  4DL4 A;  2DPI A;  7ICR A;  3H4B A;  4QWD A;  3GQC A;  1NJY A;  4ECU A;  4QW8 A;  4MEY A;  5KFQ A; 
#chains in the Genus database with same CATH topology
 2MA1 A;  2HHU A;  5L1I A;  2LM4 A;  1J97 A;  2UVV A;  4YR0 A;  4X4O A;  4B9S A;  4NXT A;  3BQ0 A;  3HKZ F;  4I2C A;  9ICV A;  4YMO A;  4WC4 A;  1T4G A;  4RQ0 A;  1S10 A;  1U45 A;  2Y0S C;  7ICM A;  4I2J A;  5TZV A;  1L3S A;  4I2D A;  2VA8 A;  3SV4 A;  2F8L A;  3GU3 A;  5ALY A;  1NJX A;  1BVS A;  1OW5 A;  5KFT A;  2BCU A;  2R18 A;  2W11 A;  8ICF A;  5F9N A;  3TI0 A;  1JN3 A;  2F76 X;  2KJ9 A;  1UEU A;  4IQU A;  5AK5 A;  5ALQ A;  3AL0 B;  1ZQQ A;  4I2E A;  4F8R A;  4ED7 A;  2K4I A;  3GV7 B;  3MR5 A;  2F77 X;  1L8L A;  4UD5 A;  4KTQ A;  3NVV A;  5KT2 A;  3H0L B;  2PBE A;  2NRV A;  4DSE A;  1FEZ A;  2Y1J A;  5KFX A;  3C2M A;  3KFU F;  3PSI A;  3KHH A;  5L1M A;  2XY6 A;  4K99 A;  2YTU A;  1ZD3 A;  5KG0 A;  3KBB A;  4FE3 A;  5DBB A;  1PX5 A;  3WKA A;  4X0B A;  3OGU A;  4C8O A;  4GIB A;  1S9F A;  4QZE A;  1D8Y A;  4O3R A;  3AU6 A;  5ALS A;  2KFZ A;  4K97 A;  3LYS A;  2JH1 A;  4DS5 A;  3WK8 A;  1VJ5 A;  1WWU A;  2H3Q A;  3TFS A;  3RR8 A;  2EAP A;  4NLG A;  3T5H A;  3NWI A;  2XC9 A;  1KNY A;  1SKS A;  5J8Y C;  9ICI A;  3GIK A;  3R9K A;  2C2R A;  5KFO A;  5DG9 A;  3ISB A;  1UA0 A;  4PHA A;  4DFK A;  4ACO A;  1D9D A;  3FDS A;  2XIC A;  4GXK A;  4FO6 A;  7ICQ A;  5AK6 A;  4JUZ A;  3F2D A;  1Z1B A;  3NVW A;  4EZ9 A;  4WC6 A;  2W3S A;  1VFG A;  2OCE A;  3WKC A;  3Q8P B;  2DF4 B;  2BHN A;  2ZIV B;  2KZZ A;  2KHV A;  4RQ1 A;  1NOM A;  5EWG A;  2VAN A;  5F2V O;  1B0X A;  3N28 A;  5AI4 A;  2ZXH A;  5J0W A;  2C28 A;  2ZHB A;  4FS2 A;  3KHR A;  1DGS A;  5J0R A;  3MC1 A;  5B66 U;  4NM2 A;  5T14 A;  5ALX A;  4BWJ A;  3TAC B;  4JMU A;  4OO1 J;  4DOC A;  3Q8R B;  3M1Y A;  4DFD A;  2W3R A;  5AM5 A;  4UAU A;  4LZG A;  2ZH2 A;  1XSL A;  3NRW A;  3GDX A;  4DLE A;  3V7K A;  2P35 A;  4EBE A;  3PSF A;  1SGG A;  3RH5 A;  5AKG A;  1L7M A;  5BOL A;  1F5A A;  2GLE A;  3NVY A;  9ICQ A;  1NK5 A;  3NUQ A;  2LPE A;  4M0A A;  4C8L A;  2G07 A;  4DSF A;  3C23 A;  5ALG A;  4EP7 A;  2M9N A;  2ZUB A;  2DR8 A;  4WBY A;  4KLH A;  2YB1 A;  4UAY A;  4ZOH C;  5D63 A;  4MEX A;  2KIC A;  1XS9 D;  9ICB A;  4GFJ A;  8ICA A;  3KKA A;  5J2E A;  3JPS A;  2ZXI A;  4GC7 A;  5J0O A;  3JCF A;  1S5L U;  2OH2 A;  3WKD A;  3B9J A;  1SL0 A;  1Q79 A;  1A6S A;  4UAZ A;  4OJ5 A;  2LMR A;  4DL7 A;  4O3M A;  3RRH A;  1SWV A;  4RQ8 A;  9ICS A;  2ATL A;  1SXE A;  4F50 A;  2ZH9 A;  1T94 A;  4IQV A;  5DGA A;  3UM9 A;  3RJK A;  1S0V A;  2JR5 A;  3HJE A;  5CHG A;  2FLP A;  2EWR A;  3AMZ A;  3M9O B;  4WC1 A;  5BOM A;  1NKE A;  1TK0 A;  2KJ8 A;  3OJU A;  2V4Q A;  2A19 A;  2JRZ A;  4ATB A;  2DFL A;  3GIJ A;  3PX0 A;  1N2X A;  1MIW A;  3PO5 A;  1ARO P;  1HUO A;  2F2A B;  5ALJ A;  1XNS A;  1BNP A;  1A76 A;  2C22 A;  2PKE A;  3EW9 A;  4JLZ A;  4EEB A;  3SAG A;  4QIW C;  2ZUC A;  3GV5 B;  5G5H A;  1ZRM A;  4KLI A;  4Z6C A;  2DVI A;  1QSY A;  3C5F A;  4FHY A;  1COO A;  1ZQZ A;  2PFP A;  1X9M A;  2W03 A;  2IBK A;  3HIL A;  1FA0 A;  3WFS C;  2RDI A;  4Y2Q A;  2PFN A;  4RNO A;  2WB1 F;  4J9K A;  4QJF B;  4RNN A;  4AYB F;  2EH9 A;  1SV0 C;  4RNM A;  2IA6 A;  1R89 A;  4ZH4 A;  1RPL A;  5AKH A;  8ICO A;  2M0N A;  4F91 B;  1ZQN A;  5D62 A;  3AQF A;  1X40 A;  4JB3 A;  4NLZ A;  3UXP A;  1N5W A;  4EZ6 A;  2CXY A;  3MR6 A;  3WK7 A;  2O6K A;  4X4S A;  1O03 A;  5KT5 A;  2JGA A;  2IMW P;  2ZIX A;  4ECR A;  4O5C A;  2NRW A;  1X9S A;  4O3P A;  3UQ2 A;  2YY6 A;  3J81 j;  3RJI A;  4WH5 A;  2BQ3 A;  2NO5 A;  2XGQ A;  3MFI A;  1Q3V A;  3OVB A;  4JWN A;  1X66 A;  1Z00 B;  2XVT A;  5EE3 A;  5AM0 A;  2FPM A;  2ZH4 A;  3M8S A;  4RT2 A;  2DR7 A;  3E58 A;  2VA2 A;  3AUO A;  8ICM A;  4TUS A;  3TFR A;  2HOI A;  3NS1 A;  4IQT A;  4C4T A;  2FMQ A;  5ALW A;  4FH5 A;  4K9A A;  1ZQG A;  2I5H A;  5EE0 A;  4Q43 A;  4NWI A;  1D8B A;  2JZB B;  3OVA A;  2FCL A;  5F9L A;  4ECY A;  2HHT A;  3H8W A;  4KN4 A;  4US9 A;  1RM6 C;  2OM6 A;  4DQP A;  5J2A A;  2RP5 A;  1KSP A;  2JEF A;  3OVS A;  3KOO A;  5D4B A;  2XCA A;  3K75 D;  2JMG A;  2HSZ A;  4RPX A;  5A0L A;  1U49 A;  2OHF A;  8ICW A;  1BGX T;  2Y9T A;  4OAI Z;  1Z1V A;  4Q44 A;  1VJ7 A;  3RAX A;  5J0Q A;  3AN1 A;  4YVZ A;  4B9L A;  4UAV A;  9ICA A;  5C5J A;  2K8C B;  3IHQ B;  2HVH A;  5ALM A;  5KFC A;  2B51 A;  5HC9 A;  3UQ0 A;  2KZ3 A;  4YP3 A;  5CFS A;  1ZQP A;  2R8G A;  4ECS A;  1L3T A;  5J2F A;  2Q0Z X;  4TQR A;  4DQS A;  5ALP A;  2UVU A;  4UQG A;  2YMP A;  3ICX A;  9ICM A;  2DRB A;  2FPK A;  2HHX A;  2D6F C;  3ERC C;  1X2I A;  1ZJN A;  3C18 A;  2G0A A;  3HP6 A;  1LKY A;  4TUQ A;  4QZG A;  2JH7 A;  4FS1 A;  4J9P A;  2NRZ A;  5J2I A;  3F5E A;  3PX6 A;  1NNL A;  3SYZ A;  2UVW A;  1VDV A;  4DF4 A;  4IG8 A;  3Q8K A;  8ICU A;  4F5O A;  2BCR A;  5KG1 A;  2LHT A;  4AT7 A;  2WAQ C;  5DB8 A;  1BPE A;  3PW4 A;  3ER9 B;  1ZQY A;  2YMM A;  4WC3 A;  5ALH A;  5HRG A;  5DQG A;  3C5G A;  3OSN A;  3QUC A;  9ICK A;  1NJY A;  4ECU A;  2PXI A;  5KFQ A;  5CFT A;  1NK6 A;  4R63 A;  4XUS A;  4GC6 A;  3FM9 A;  2KFN A;  1FIQ A;  1WG8 A;  2LBO A;  1JQR A;  2AQ4 A;  4XQ8 A;  3ZD8 A;  1S76 D;  3EF2 A;  2GWS A;  1KN5 A;  1RG6 A;  4O5E A;  5KFN A;  4AT8 B;  4ED2 A;  4AT9 A;  3MGI A;  1KBU A;  2HW3 A;  2I9G A;  3D2Q A;  5DEC A;  2WHE A;  4MHV A;  1CI4 A;  3PST A;  4G9B A;  2R8K A;  1RYS A;  1JX4 A;  3E2E A;  3H3A A;  1PVP A;  3RRG A;  4RQM A;  5HHI A;  4F93 B;  1T8E A;  5KFV A;  8ICJ A;  1DXS A;  4C7Z A;  5J2C A;  2KHQ A;  3V6K A;  5JTG A;  2EDU A;  1SKW A;  2YML A;  3BS5 A;  4QZI A;  5FP0 A;  4I27 A;  5ALZ A;  1QQ5 A;  3D2N A;  2XI9 A;  5KG5 A;  4I28 A;  2R8I A;  2HHW A;  5J2K A;  1QTM A;  2AQ0 A;  1V38 A;  2WF5 A;  1J2N A;  2K4E A;  4RQ7 A;  3B0Y A;  1LVH A;  4UB8 U;  1X6I A;  2BQU A;  4EBC A;  8ICT A;  3AQK A;  3FAH A;  3I76 A;  1L8O A;  4O6A A;  4Y2Y A;  8ICS A;  1JRO A;  4F2S A;  4Z6F A;  3M6K A;  2F1I A;  2IHM A;  2ZIW B;  4K98 A;  3RFA A;  4O3N A;  4C4S A;  2B21 A;  3SMV A;  3N7P D;  5CHE A;  5J0X A;  2DKZ A;  1ZD2 P;  4RQ2 A;  3SI8 A;  1B43 A;  1WYG A;  4Y2P A;  3JPO A;  3SD7 A;  1ZQX A;  2HDO A;  2NRT A;  3IDW A;  7ICU A;  3L3F X;  2CRX A;  9ICL A;  4X4U A;  4YXJ A;  4CF5 A;  4ECQ A;  7ICN A;  4X4Q A;  4P0P A;  9ICO A;  3QE9 Y;  3FC4 A;  1R8A A;  2R8J A;  3KD3 A;  4KX5 A;  2KN7 A;  8ICX A;  3AQE A;  1S0M A;  3PW2 A;  4OCZ A;  1YLQ A;  3G6X A;  3TAD A;  3PSP A;  5KT6 A;  4MFA A;  5KL1 B;  2E5S A;  2V4R A;  4JV2 A;  3RJF A;  1Q3U A;  4F3O A;  1Z19 A;  9ICH A;  1N60 A;  3H39 A;  3I28 A;  4OAG A;  3BQ7 A;  1HEK A;  1ZQH A;  2W9A A;  2A1J B;  2FMP A;  4K4G A;  2KP7 A;  7ICS A;  3QXG A;  5DQH A;  8ICR A;  1NK8 A;  1COK A;  5HMM A;  4S3N A;  2AHO B;  1NK4 A;  4UBB A;  2H3V A;  2BQR A;  3TQ1 A;  1OU5 A;  2Q66 A;  2Y9U A;  5KFE A;  3WKE A;  2F44 A;  2ZH1 A;  4EYH B;  5J2H A;  2KKV A;  1EXN A;  1RDF A;  4QNL A;  4I2F A;  1LKY B;  5AM3 A;  1N48 A;  1UHU A;  2HI0 A;  4NKU A;  5KL8 B;  5F3X B;  3JZ0 A;  2ODG A;  4E0D A;  2G08 A;  4PL1 A;  1JXE A;  5CB1 A;  4HYK A;  4AT7 B;  1DOQ A;  2DUY A;  1KFS A;  4RU9 A;  3L4P A;  4BXO A;  5CRX A;  1SV0 A;  2W55 A;  1HIW A;  9ICR A;  4YG2 A;  3A0B U;  4QW9 A;  9ICG A;  1TFR A;  4NXV A;  3JPR A;  3OUY A;  3NTU A;  4N7R A;  4LEW A;  4B6J A;  4UB2 A;  4UAR A;  3RTV A;  7ICF A;  3JYY A;  2LKY A;  3D6J A;  2W7O A;  4I2A A;  3AQM A;  2ZTC A;  2LYH A;  4TUP A;  2IHN A;  3ZDD A;  3UMB A;  4WBZ A;  4KLJ A;  3HT3 A;  3UMG A;  5AI9 A;  3MR2 A;  3PR5 B;  1IM4 A;  1XSP A;  1ZQC A;  4FBT A;  2ZH7 A;  3ZI4 A;  2EAN A;  5EOZ A;  2MUT B;  3PR4 A;  1KFD A;  4DO9 A;  3JPQ A;  3H37 A;  4M6W A;  4AT9 B;  4OJP A;  4O67 A;  1TKD A;  3Q8Q B;  3OSP A;  1ZOL A;  1RYR A;  2G06 A;  4YR2 A;  4KLD A;  2NRK A;  4YCX A;  9ICX A;  3MDC A;  4WCW A;  4B9V A;  5JTI A;  4JLX A;  4KM5 A;  1C7Y A;  1SIJ A;  4KLQ A;  4QZB A;  4O0I A;  1MQ2 A;  3AU2 A;  4EBD A;  3ISC A;  2AGP A;  4J9R A;  1YT3 A;  4Q8E A;  1JMS A;  1R8C A;  3PW7 A;  5HP4 A;  3BS5 B;  3LVW A;  5D46 A;  1PK1 A;  5KFD A;  4IR9 A;  5ALL A;  2L5Y A;  3BQ2 A;  1ZRN A;  3OTQ A;  4QZH A;  5CEH A;  1UT8 A;  3TKA A;  5IIL A;  2JEJ A;  1Z00 A;  2AJQ A;  2E3T A;  4ECZ A;  4ED1 A;  2MRL A;  2QB1 A;  4R8U A;  4BWM A;  4RT3 A;  2QB0 B;  2W9B A;  1ZQR A;  1X6J A;  9ICT A;  1ZQE A;  4TUR A;  2G09 A;  3G6Y A;  2KOB A;  2ZH5 A;  4K8V A;  3V7L A;  2N1R A;  3RJG A;  4ICA A;  1N5X A;  5HRH A;  4KLE A;  2RDJ A;  2OXO A;  2JXJ A;  1X42 A;  2JZB A;  3CW2 C;  3HKZ C;  3QU9 A;  4I2B A;  3BS7 A;  2KIV A;  1TE2 A;  5DB7 A;  5IIO A;  2ZIU B;  4KLS A;  4P0P B;  2KD1 A;  4ELV A;  1ZQM A;  5KG3 A;  7ICI A;  2ZJ8 A;  3WK9 A;  2RRD A;  3VCB A;  3WFP A;  5JU5 A;  5HRL A;  2ASD A;  3MFH A;  4NL9 C;  4Y2T A;  1JXL A;  3OPX A;  4X4N A;  3THV A;  3MDA A;  4U6P A;  2PMZ C;  2DWQ A;  4KN7 A;  4LVS A;  5EWE A;  4YD1 A;  5HHH A;  4JK1 A;  1NO5 A;  3M8R A;  5AKX A;  7ICT A;  2ZG6 A;  1ZD4 A;  2FJ6 A;  4EEL A;  4JV1 A;  3QU5 A;  1XO1 A;  3TAQ A;  2H3Z A;  2DR5 A;  1Z3E B;  1CRX A;  3N7R C;  3H8M A;  2BDP A;  3MGV A;  2W43 A;  3C66 A;  1ZQB A;  4FHW A;  4Q45 A;  4BX9 C;  4YR3 A;  5HR6 A;  4UAW A;  2C2D A;  5DB6 A;  4QWC A;  3BQ1 A;  4KX3 A;  3HX0 A;  1VLB A;  1F44 A;  2HHQ A;  2FPL A;  2BPC A;  2P6R A;  4Y2S A;  4NXZ A;  4K9B A;  5IIJ A;  3F2B A;  4BXO B;  1V97 A;  4JWM A;  3SZ2 A;  1XC9 A;  4MF2 A;  2YB4 A;  5TIS U;  1X9W A;  1T3Q A;  4O3S A;  3D2S A;  3C2K A;  1UCV A;  3OUY B;  4FH3 A;  4KMO B;  1N63 A;  4FO1 A;  3ZDA A;  1A77 A;  4CDG A;  8ICK A;  5DGB A;  4GLX A;  3E0F A;  3RB4 A;  1MIY A;  4EYI B;  4X4T A;  1FFU A;  4CRX A;  4IL6 U;  3CNH A;  4EBJ A;  5ALT A;  2KZM A;  1MQ3 A;  4AT8 A;  3ER8 C;  3WU2 U;  1B4F A;  4YQW A;  2Q4T A;  3BZC A;  1SZP A;  2JHD A;  4P4M A;  4M6W B;  5E79 U;  3N4M B;  1IXR A;  3RR7 A;  3EWA A;  5ALF A;  3DV9 A;  4I2I A;  1WCN A;  4DOB A;  4UAT A;  1NK0 A;  4F4Z A;  8ICI A;  4WQK A;  2DPJ A;  4FZN A;  2XY7 A;  7ICR A;  2WAQ F;  1KW4 A;  2WF9 A;  3IRU A;  2W8K A;  3L5K A;  4ED8 A;  3N97 B;  5HR9 A;  1M6Y A;  9ICJ A;  4DLG A;  1PK1 B;  1PVQ A;  1ZQK A;  2J6S A;  4UBC A;  1FFV A;  4RQ5 A;  1BPD A;  5IIM A;  4XRH A;  4R66 A;  3GII A;  2RFF A;  4FZM A;  2ZIW A;  1WCL A;  4RZR A;  5HRF A;  2O5A A;  4JV0 A;  4R8U B;  4UB1 A;  2W9B B;  5KFY A;  4HX0 A;  1S0N A;  1ZQO A;  3H8S A;  4C8K A;  2FLL A;  5EE1 A;  4DSL A;  1HJP A;  3RB3 A;  5CP2 A;  4OAH A;  1NKC A;  4X4V A;  2BR0 A;  2DGZ A;  5B5E U;  5KFI A;  4J9O A;  4LJX A;  4MFC A;  4LZD A;  1PVR A;  4F71 A;  2JEG A;  4I29 A;  4P2H A;  4J9M A;  5D49 A;  4X5V A;  4M9J A;  1F5S A;  4C0Z A;  4OJO A;  4PZO A;  4M5D A;  4KLU A;  5HRI A;  2B4V A;  3BJY A;  4YFK A;  3T79 A;  5KFG A;  3HW8 A;  2ASL A;  5DLG A;  3QEB Z;  4Z6E A;  1ZYQ A;  4NXX A;  5KFU A;  2A1J A;  3K4G A;  1SL2 A;  3RBE A;  4FBU A;  7ICE A;  3M9N B;  9ICP A;  3ZDE A;  4PHD A;  3M7D A;  4RQN A;  5KFS A;  5J2G A;  2BCS A;  1SB3 C;  2QAR A;  5AM1 A;  5DKW A;  2HN1 A;  5DQI A;  5KFW A;  3NYB A;  2KJ5 A;  1SZH A;  3H8J A;  1T7P A;  3PO4 A;  1U4B A;  2A1A A;  1KEJ A;  4IS7 A;  3H4D A;  5DDM A;  4PGQ A;  3TAR A;  3ORY A;  3IP4 B;  3GV8 B;  1TK8 A;  5HRE A;  4NKT A;  2H3I A;  5HML A;  2BPG A;  1K5O A;  4R64 A;  3H7I A;  3QU4 A;  5KFM A;  4CCH A;  3PW0 A;  4FFD A;  3Q8M A;  2W9M A;  5L1K A;  2BZF A;  5III A;  2ZH8 A;  2UVR A;  5KFL A;  4YN4 A;  3QUB A;  5J8Y A;  4PPX A;  2ZTE A;  1MC8 A;  3IN5 A;  2LM1 A;  4OAF A;  2QLT A;  3OHA A;  2LYA A;  3G6V A;  4YD2 A;  2ID1 A;  3M9M B;  3UXN A;  2P6U A;  5KFR A;  8ICE A;  4NJ8 A;  3I1Y A;  5C0Y A;  1U47 A;  2PI5 A;  5J2B A;  5K4L A;  1BPZ A;  2MUT A;  4IQW A;  3KKA C;  5IIN A;  1CEZ A;  1KRP A;  4C4R A;  3UPS A;  4BJQ A;  2Y0S F;  4WOY A;  3GZF A;  4DL6 A;  1UEV A;  1SWW A;  1URJ A;  2D8C A;  3EYZ A;  4Z6D A;  9ICE A;  4F92 B;  3RAQ A;  1ZQJ A;  2KG5 A;  2E1F A;  5CR0 A;  4F4Y A;  1X9X A;  4DOA A;  4DS4 A;  1B22 A;  5CWR A;  3LK9 A;  1CUK A;  1QSS A;  4GXJ A;  4DL5 A;  2J6U A;  2XGP A;  4DFM A;  3CRX A;  2H5X A;  2WF8 A;  5AKJ A;  2C2E A;  4DQR A;  5J0T A;  1MSW D;  3UPQ A;  4QWA A;  2QB0 A;  2ZHA A;  4IR1 A;  3C28 A;  2B6G A;  4E8F A;  3OHB A;  3RBD A;  3WKB A;  4RQ4 A;  4YMN A;  3SV3 A;  5IIK A;  4IRK A;  5AHX A;  4MFF A;  3PV8 A;  1Z4O A;  4PGX A;  2HMX A;  1JAJ A;  4FHV A;  4J9Q A;  4MF8 A;  1U48 A;  3DEE A;  8ICC A;  3K1Z A;  3HIY A;  2CN1 A;  2EAM A;  2E8P A;  4C8N A;  3ZD9 A;  4FHX A;  4F5N A;  2ZIU A;  2ZH6 A;  3CK6 A;  4PHE A;  4UB3 A;  2FLN A;  4EBK A;  2HBJ A;  4KMU A;  8ICL A;  2FI1 A;  1TV9 A;  2VIX A;  2ZUD A;  2E8O A;  2HBM A;  2VA3 A;  1V9P A;  4UAS A;  2RQ5 A;  5KFJ A;  1Q46 A;  2F3N A;  1QQ6 A;  5AI8 A;  2EZZ A;  3RH6 A;  3GIL A;  4DL2 A;  4X4R A;  3GIM A;  4DQQ A;  3AQN A;  1ZD5 A;  1TAM A;  4CE6 A;  4C80 A;  5J29 A;  2EAO A;  5DDY A;  1NZB A;  4BGD A;  1YZ6 A;  1RXW A;  2QAR B;  5GTH U;  3V6J A;  2BCV A;  2JEI A;  1ZQL A;  2IOF A;  4F4W A;  7ICK A;  2IHO A;  7ICO A;  2AU0 A;  2M2W A;  2DR9 A;  1SV4 A;  4NM1 A;  5KT4 A;  4Y2J A;  2GH1 A;  1R8B A;  5DED A;  7ICL A;  3TAP A;  4DSK A;  2Z7J A;  8ICG A;  2I1Q A;  3JPN A;  3CYM A;  4FZL A;  1DGJ A;  4USA A;  5KFF A;  4QWB A;  1RQL A;  4KLM A;  5AI6 A;  5AK4 A;  1S8O A;  4EEN A;  2LYB A;  1OUQ A;  1BNO A;  2WF6 A;  4DFJ A;  2YMQ A;  3HRD D;  1XSN A;  4RWP A;  2IUB A;  3H0M B;  3TAN A;  2KE7 A;  3KTQ A;  2KMD A;  2HN2 A;  3SAF A;  2NV3 A;  2PI4 A;  2XCP A;  5EE9 A;  4KB6 A;  4O68 A;  3QZ8 A;  3LWM A;  2HBL A;  2KVS A;  1D8L A;  4O9M A;  2V9W A;  1GPJ A;  3MCR A;  4MKP A;  1JI7 A;  2PMZ F;  3IM1 A;  2DL0 A;  3QU7 A;  3K1R B;  2KTQ A;  4WC7 A;  2BBH A;  2ASJ A;  3KHG A;  9ICC A;  5DLF A;  3T5L A;  1AQ6 A;  2DRA A;  5KG4 A;  3EZ5 A;  2GA9 D;  3ISD A;  4M9L A;  4I2G A;  1LV5 A;  2KV2 A;  4RPY A;  1KDH A;  2BE3 A;  3KZI U;  1TVA A;  2K8B B;  4UD4 A;  2W8L A;  1NI3 A;  2E1E A;  2OEH A;  8ICN A;  4EX6 A;  4J9N A;  3AM9 A;  1JAL A;  1ZQU A;  2AXT U;  2W9C A;  5KFB A;  1UT5 A;  4WJ3 B;  5CA7 A;  4Y2U A;  4QWE A;  4LEZ A;  5DB9 A;  5J0Y A;  4IRD A;  1J2M A;  4K4H A;  5H2F U;  1MIV A;  1V4A A;  2RHF A;  4KLG A;  4DEZ A;  4F5R A;  1ZQI A;  4M2Y A;  4M04 A;  5CFU A;  3B0X A;  2XO7 A;  2HVI A;  2E8N A;  4RWO A;  4DCC A;  5GTI U;  5KFP A;  2K4P A;  2F1J A;  3JPP A;  4CNQ A;  4CF4 A;  5J0P A;  4NXU A;  3SEN A;  5HNK A;  4ED0 A;  3NVO A;  4EV6 A;  5AM4 A;  1ECW A;  4QIW F;  2O1P A;  3S6J A;  4DSI A;  4A8E A;  2VJ5 A;  2YN4 A;  4DL3 A;  2B56 A;  3RB6 A;  3HPO A;  1L7O A;  1UA1 A;  3C2L A;  2M2T A;  8ICB A;  3CP8 A;  1P7D A;  1L3V A;  1N62 A;  5JRT A;  2WF7 A;  4X0A A;  5HR7 A;  3O0F A;  3HWT A;  5EWF A;  2LI6 A;  3ED5 A;  5J0U A;  3GQC A;  4NXW A;  1BPY A;  4OJ6 A;  5JUM A;  4P0Q B;  4Y2X A;  3N7S C;  4XA5 A;  3T5J A;  4J9L A;  2A3V A;  4EED A;  5KNI A;  4QZA A;  5AIA A;  1JRP A;  5AKK A;  1GO3 F;  2KSO A;  3LWL A;  4G3I A;  1QCK A;  3T3F A;  1NJW A;  3VC8 A;  5CJ7 A;  3QZ7 A;  1MA7 A;  5J2D A;  2YQE A;  2VKQ A;  3IV6 A;  1Q78 A;  4EGW A;  3UMC A;  1SL1 A;  3SQI A;  2WTF A;  4K4I A;  4LT6 A;  2E8M A;  4PGY A;  1BPB A;  1NZP A;  3HJ1 A;  4IRC A;  4I2H A;  7ICH A;  5ALK A;  1U9L A;  3L9D A;  3C21 A;  4ECW A;  3C29 A;  1PUZ A;  5AM2 A;  2D3D A;  4F4X A;  1TK5 A;  3A0H U;  4RQ6 A;  4Y2R A;  2KK0 A;  5ALU A;  3ZDC A;  1TAU A;  3PZP A;  2KIW A;  4F4K A;  4PL2 A;  4E80 A;  2AGO A;  4B9T A;  3SEI A;  3T5K A;  1NJZ A;  1NK9 A;  4NY8 A;  3IG8 A;  3PX4 A;  2ZJA A;  3HJ4 A;  1V85 A;  4AP9 A;  2BDU A;  5DBA A;  4O5K A;  1L3U A;  2NO4 A;  4EEY A;  3RJH A;  2CPR A;  3TAD C;  4LEY A;  1TAQ A;  1NK7 A;  2HHS A;  2M2U A;  2K4H A;  1F0M A;  1SXD A;  4NLK A;  1Y88 A;  1K1Q A;  4ECT A;  1LB2 B;  4DQI A;  4HAI A;  4EX7 A;  2OYY A;  2OWO A;  2KNJ A;  2K89 A;  1KFT A;  4NLC A;  1Z4N A;  2HOF A;  1QSL A;  2DKX A;  1BPX A;  4QZC A;  2G5I B;  3PNC A;  3NVZ A;  2H3F A;  4QZF A;  4IC9 A;  4B9N A;  3C1Z A;  2F1H A;  1ZQV A;  5AI0 A;  3OWG A;  1PZN A;  1T3N A;  7ICJ A;  2IOF K;  3PMN A;  2DBY A;  2VJ4 A;  2W9C B;  3H38 A;  3PHZ A;  3F2C A;  2HHV A;  1WUD A;  2DQN B;  1C20 A;  3H0R B;  4RWQ A;  3V6H A;  4WC2 A;  3DDH A;  3SAH A;  9ICN A;  2PFO A;  4YXM A;  1ZQA A;  8ICV A;  2AH5 A;  1IG6 A;  5AKY A;  4CF3 A;  4K96 A;  2XY5 A;  3FYH A;  5L1L A;  7ICG A;  1K1S A;  4M9G A;  4Y2V A;  3GFK B;  4KLO A;  1JUD A;  2ZJ5 A;  4GXI A;  1HUZ A;  3LQC B;  4EEK A;  7ICV A;  1PK3 A;  2GO7 A;  2ISP A;  5AKL A;  4PJ0 U;  4R65 A;  3Q8S B;  5AKE A;  5ALN A;  1SKR A;  4QZ8 A;  3V72 A;  3EUB 2;  1L5U A;  4E7X A;  4KLT A;  2BCQ A;  1QLN A;  4XQ7 A;  3AQL A;  2QKQ A;  1QH9 A;  5J2J A;  3ETL A;  2NYV A;  3AEV A;  1UET A;  3RH4 A;  3MBY A;  5L1J A;  9ICW A;  3QYP A;  5AKZ A;  1ZQW A;  3ONN A;  5KT7 A;  2ZH3 A;  3KHL A;  4WC0 A;  3WFR E;  4O69 A;  2AGQ A;  4WC5 A;  5KT3 A;  2I6X A;  4M9H A;  4PH5 A;  3NGD A;  5KG2 A;  1ZXI A;  1KLN A;  5ALO A;  1TFY A;  2KSO B;  4M9N A;  2Y1I A;  3KZX A;  5AIB A;  1OXJ A;  3F53 A;  2P66 A;  2HCF A;  1S77 D;  4OD0 A;  5KG6 A;  4UB4 A;  1ZQD A;  4RWN A;  2BPF A;  4F5Q A;  3MAB A;  3LVV A;  3QEA Z;  8ICH A;  1KL9 A;  2ALZ A;  1S0O A;  1MN8 A;  2ES6 A;  4DSJ A;  5ALD A;  4O3O A;  5KFH A;  2K8A A;  1IV8 A;  4DFP A;  1DK3 A;  7ICP A;  4RPZ A;  1ZET A;  3QUT A;  5DG8 A;  3ETR A;  3EPI A;  1D9F A;  1DRG A;  3UXO A;  1RQN A;  8ICZ A;  1O08 A;  3IG5 A;  3WK6 A;  2BKE A;  1KTQ A;  4F2R A;  3MR3 A;  2WB1 C;  1KQQ A;  4RUC A;  8ICY A;  4AYB C;  1XU4 A;  2EQY A;  2KEY A;  4KLF A;  5ALI A;  3PVX A;  5ALV A;  8ICP A;  2W7P A;  3V7J A;  5B3P A;  3WFQ E;  5KFZ A;  4WQL A;  3NRZ A;  1KKX A;  3PML A;  1XO0 A;  4RUA A;  3QX7 A;  4ECV A;  9ICU A;  5KFK A;  5J0S A;  3NKU A;  1N56 A;  3OJS A;  4ED3 A;  4ATB B;  4Q8F A;  1UQV A;  4CGZ A;  2MSN A;  4UB6 U;  5BPC A;  2FMS A;  1N61 A;  2RLT A;  2WFA A;  1FO4 A;  5B3Q A;  1ZQT A;  1S97 A;  2W04 A;  5AKI A;  3WK4 A;  1ZQF A;  4NLN A;  2PFQ A;  4B9U A;  3H40 A;  2MAX A;  5AK3 A;  3RB0 A;  3NAS A;  3WK5 A;  2IOH A;  5ALE A;  4P4P A;  1H38 A;  5AIC A;  4NLB A;  4UW9 A;  5KG7 A;  3C1Y A;  2KKP A;  2R8H A;  3QNM A;  4M47 A;  5HRB A;  1JIH A;  2XID A;  3PW5 A;  2M2V A;  4J03 A;  2EZY A;  1ZQS A;  1RXV A;  5HRK A;  4P4O A;  2HBK A;  2ISO A;  1IIP A;  2ESE A;  4OJL A;  5HRD A;  4ELU A;  1ED1 A;  4F72 A;  4TQS A;  4KIT B;  1XWL A;  2K60 A;  4NV0 A;  3RJE A;  4U7C A;  2BBJ A;  1TFW A;  4NL9 A;  3BQT A;  4C7Y A;  5DG7 A;  3MGH A;  4F5P A;  2NRX A;  2G5H B;  5KAI U;  3RF9 A;  4J9S A;  1Q8K A;  2FE9 A;  4FHP A;  2EZX A;  2ZIX B;  4ED6 A;  2ZIV A;  1L7P A;  3EPG A;  3SR6 A;  4ECX A;  3Q8L A;  3QU2 A;  8ICQ A;  1L7N A;  4US8 A;  3M6Z A;  4UB5 A;  4QZ9 A;  9ICF A;  5KTQ A;  1NKB A;  3QUQ A;  4YMM A;  2HOQ A;  2ZTD A;  5G5G A;  4P0Q A;  3BDP A;  2MU2 A;  4ELT A;  2BGW A;  2HHP A;  5D61 A;  2JV3 A;  1RZT A;  3BZK A;  5KAF U;  2GAF D;  1L6N A;  2GOL A;  3JPT A;  4C8M A;  1A0P A;  5ALR A;  2W54 A;  1QQ7 A;  3WFO A;  1UPH A;  3RJJ A;  3ALR A;  4I0U A;  4QZD A;  1ZQ1 C;  2B0C A;  1ZJM A;  2KVC A;  4BDP A;  5DBC A;  4PZN A;  4X4P A;  4DWI A;  4LEV A;  4DF8 A;  5AI5 A;  4PHP A;  2J6T A;  5L9X A;  3U26 A;  4XJE A;  3F5A A;  3LDA A;  1RYU A;  4B9M A;  3PY8 A;  4RQ3 A;  5KFA A;  4O3Q A;  1WOT A;  4BUG A;  1YZ7 A;  2F8K A;  4KLL A;  3OV7 A;  3K7D A;  3ZDB A;  1DK2 A;  4DL4 A;  2DPI A;  3H4B A;  1WWV A;  2YX8 A;  4QWD A;  4QW8 A;  4MEY A;  2FDR A; 
#chains in the Genus database with same CATH homology
 2HHU A;  5L1I A;  2W8K A;  1NK6 A;  5JUM A;  4R63 A;  4XUS A;  4GC6 A;  4ED8 A;  3N97 B;  2UVV A;  5HR9 A;  4YR0 A;  4XA5 A;  4X4O A;  4B9S A;  3BQ0 A;  2KFN A;  9ICJ A;  9ICV A;  4DLG A;  4I2C A;  4YMO A;  3T5J A;  4WC4 A;  4J9L A;  1T4G A;  1JQR A;  2AQ4 A;  4XQ8 A;  3ZD8 A;  4QZA A;  1ZQK A;  4RQ0 A;  1S76 D;  2GWS A;  2J6S A;  4UBC A;  1S10 A;  1U45 A;  4O5E A;  4RQ5 A;  5KFN A;  1BPD A;  5IIM A;  7ICM A;  4AT8 B;  4XRH A;  4R66 A;  3LWL A;  3GII A;  4ED2 A;  4G3I A;  3T3F A;  2RFF A;  1NJW A;  4AT9 A;  1WCL A;  4I2J A;  5CJ7 A;  5TZV A;  4RZR A;  4I2D A;  3QZ7 A;  5J2D A;  1L3S A;  5HRF A;  4JV0 A;  4R8U B;  4UB1 A;  2VA8 A;  3MGI A;  3SV4 A;  2W9B B;  1Q78 A;  2HW3 A;  1SL1 A;  1NJX A;  2I9G A;  5KFY A;  2WTF A;  1BVS A;  1BPY A;  4K4I A;  5DEC A;  5KFT A;  1S0N A;  4LT6 A;  1ZQO A;  2BCU A;  3H8S A;  2R8K A;  4PGY A;  1RYS A;  1BPB A;  1JX4 A;  4C8K A;  5F9N A;  3TI0 A;  2FLL A;  8ICF A;  1JN3 A;  1NZP A;  4IRC A;  3HJ1 A;  4DSL A;  1UEU A;  3E2E A;  4IQU A;  3H3A A;  1ZQQ A;  4I2E A;  4I2H A;  4F8R A;  1HJP A;  3RRG A;  4ED7 A;  7ICH A;  3GV7 B;  5HHI A;  3MR5 A;  1U9L A;  4F93 B;  3RB3 A;  5KFV A;  1T8E A;  8ICJ A;  3L9D A;  4UD5 A;  5CP2 A;  3C21 A;  4KTQ A;  5J2C A;  5KT2 A;  1NKC A;  4ECW A;  4X4V A;  2BR0 A;  3V6K A;  5KFI A;  4J9O A;  4F4X A;  2PBE A;  1TK5 A;  1SKW A;  2NRV A;  4QZI A;  4DSE A;  4MFC A;  4LZD A;  4I27 A;  2Y1J A;  5KFX A;  3C2M A;  5KG5 A;  4I28 A;  4RQ6 A;  2R8I A;  5J2K A;  2JEG A;  4I29 A;  2HHW A;  4P2H A;  4J9M A;  5D49 A;  3KHH A;  2AQ0 A;  2PXI A;  4X5V A;  1QTM A;  4M9J A;  4M5D A;  3ZDC A;  2XY6 A;  1TAU A;  4KLU A;  4F4K A;  5HRI A;  5KG0 A;  3B0Y A;  4RQ7 A;  3BJY A;  4E80 A;  4YFK A;  2AGO A;  4B9T A;  5KFG A;  5DBB A;  3HW8 A;  4EBC A;  2BQU A;  8ICT A;  1PX5 A;  3AQK A;  2ASL A;  5DLG A;  3T5K A;  4Z6E A;  3QEB Z;  1NJZ A;  1NK9 A;  4NY8 A;  3PX4 A;  8ICS A;  4X0B A;  2ZJA A;  4F2S A;  3OGU A;  4Z6F A;  4C8O A;  3HJ4 A;  2F1I A;  1S9F A;  1ZYQ A;  4QZE A;  5KFU A;  2IHM A;  5DBA A;  4O5K A;  1L3U A;  1D8Y A;  4O3R A;  2A1J A;  4O3N A;  4EEY A;  3AU6 A;  2KFZ A;  2B21 A;  3K4G A;  4DS5 A;  5J0X A;  1SL2 A;  3RJH A;  3SI8 A;  4RQ2 A;  3RBE A;  3TFS A;  3RR8 A;  4FBU A;  1B43 A;  1TAQ A;  3M9N B;  4NLG A;  7ICE A;  9ICP A;  3ZDE A;  4PHD A;  1NK7 A;  5KFS A;  5J2G A;  3JPO A;  2HHS A;  2BCS A;  1ZQX A;  3T5H A;  2M2U A;  5DKW A;  4NLK A;  1Y88 A;  2XC9 A;  1KNY A;  2NRT A;  5DQI A;  1K1Q A;  1SKS A;  9ICI A;  4ECT A;  5KFW A;  1LB2 B;  4DQI A;  3NYB A;  3GIK A;  7ICU A;  2C2R A;  5KFO A;  9ICL A;  5DG9 A;  3ISB A;  4YXJ A;  4X4U A;  2OWO A;  3H8J A;  1T7P A;  1UA0 A;  3PO4 A;  4PHA A;  4ECQ A;  4DFK A;  1D9D A;  3FDS A;  1U4B A;  7ICN A;  1KFT A;  1KEJ A;  4GXK A;  4X4Q A;  4FO6 A;  7ICQ A;  3H4D A;  5DDM A;  4PGQ A;  4JUZ A;  3TAR A;  1BPX A;  3ORY A;  4QZC A;  1QSL A;  3GV8 B;  9ICO A;  1TK8 A;  4EZ9 A;  4WC6 A;  5HRE A;  3QE9 Y;  3PNC A;  1VFG A;  4NKT A;  4QZF A;  2R8J A;  4B9N A;  5HML A;  3C1Z A;  4R64 A;  2BPG A;  1R8A A;  2F1H A;  3H7I A;  3Q8P B;  2KN7 A;  1ZQV A;  8ICX A;  5KFM A;  1S0M A;  1PZN A;  3PW2 A;  1T3N A;  4CCH A;  3PW0 A;  1YLQ A;  2BHN A;  3G6X A;  3Q8M A;  2W9M A;  5L1K A;  7ICJ A;  5KT6 A;  4MFA A;  2KZZ A;  3PMN A;  4RQ1 A;  2W9C B;  3H38 A;  1NOM A;  5III A;  2V4R A;  4JV2 A;  5EWG A;  2ZH8 A;  2UVR A;  3RJF A;  2HHV A;  2VAN A;  5F2V O;  5KFL A;  4F3O A;  4YN4 A;  9ICH A;  4PPX A;  3H39 A;  5J0W A;  2C28 A;  1ZQH A;  2ZHB A;  2W9A A;  2ZTE A;  2A1J B;  4FS2 A;  3KHR A;  2FMP A;  3V6H A;  1MC8 A;  1DGS A;  4K4G A;  4RWQ A;  5J0R A;  2KP7 A;  4WC2 A;  7ICS A;  9ICN A;  5DQH A;  4NM2 A;  1NK8 A;  2PFO A;  5HMM A;  8ICR A;  4S3N A;  1NK4 A;  3OHA A;  4YXM A;  4UBB A;  4BWJ A;  1ZQA A;  2BQR A;  3TQ1 A;  8ICV A;  3G6V A;  1OU5 A;  4YD2 A;  2ID1 A;  2Q66 A;  3M9M B;  3UXN A;  2P6U A;  5KFE A;  5KFR A;  4DOC A;  2XY5 A;  8ICE A;  3FYH A;  5L1L A;  7ICG A;  1K1S A;  3Q8R B;  1U47 A;  2PI5 A;  4M9G A;  4EYH B;  2ZH1 A;  5J2B A;  5J2H A;  3GFK B;  4KLO A;  2ZJ5 A;  4GXI A;  1EXN A;  1HUZ A;  3LQC B;  7ICV A;  4I2F A;  4LZG A;  1N48 A;  2ISP A;  1BPZ A;  2MUT A;  4IQW A;  2ZH2 A;  4NKU A;  1XSL A;  4R65 A;  3GDX A;  4DLE A;  3JZ0 A;  3Q8S B;  3V7K A;  4E0D A;  1SKR A;  4QZ8 A;  5IIN A;  3V72 A;  1CEZ A;  4EBE A;  1KRP A;  1L5U A;  3RH5 A;  1JXE A;  5CB1 A;  3UPS A;  4E7X A;  5BOL A;  4KLT A;  4HYK A;  1F5A A;  4AT7 B;  2BCQ A;  9ICQ A;  1QLN A;  4DL6 A;  1NK5 A;  4XQ7 A;  3AQL A;  1DOQ A;  1UEV A;  1KFS A;  4RU9 A;  5J2J A;  4BXO A;  3ETL A;  4M0A A;  3EYZ A;  4Z6D A;  4C8L A;  9ICR A;  1UET A;  9ICE A;  4DSF A;  3C23 A;  4YG2 A;  4F92 B;  3RAQ A;  4EP7 A;  1ZQJ A;  2M9N A;  2ZUB A;  4QW9 A;  3RH4 A;  2DR8 A;  4WBY A;  3MBY A;  1TFR A;  9ICG A;  5CR0 A;  5L1J A;  4F4Y A;  4UAY A;  4KLH A;  9ICW A;  3JPR A;  3OUY A;  4MEX A;  1ZQW A;  3NTU A;  1XS9 D;  5KT7 A;  9ICB A;  4DOA A;  4DS4 A;  2ZH3 A;  1B22 A;  3KHL A;  4WC0 A;  3WFR E;  5CWR A;  8ICA A;  3LK9 A;  5J2E A;  4UB2 A;  3JPS A;  3RTV A;  7ICF A;  2AGQ A;  3JYY A;  4WC5 A;  4GC7 A;  4I2A A;  2ZTC A;  5J0O A;  3AQM A;  2LYH A;  1CUK A;  5KT3 A;  4TUP A;  1QSS A;  2IHN A;  3ZDD A;  4WBZ A;  4M9H A;  4PH5 A;  4GXJ A;  4KLJ A;  3NGD A;  3HT3 A;  4DL5 A;  5KG2 A;  2J6U A;  1SL0 A;  1KLN A;  2XGP A;  3MR2 A;  4DFM A;  1Q79 A;  3PR5 B;  1IM4 A;  2H5X A;  1XSP A;  2C2E A;  1ZQC A;  4UAZ A;  4FBT A;  2ZH7 A;  4DL7 A;  3RRH A;  1TFY A;  4M9N A;  5EOZ A;  4DQR A;  4RQ8 A;  2Y1I A;  5J0T A;  1MSW D;  2ATL A;  9ICS A;  2MUT B;  3PR4 A;  3UPQ A;  4QWA A;  1KFD A;  4F50 A;  4DO9 A;  2ZHA A;  3JPQ A;  3H37 A;  4M6W A;  2P66 A;  4IR1 A;  4AT9 B;  2ZH9 A;  4IQV A;  5DGA A;  3Q8Q B;  3OSP A;  1TKD A;  1S77 D;  4E8F A;  3OHB A;  3RBD A;  4RQ4 A;  3RJK A;  1S0V A;  1RYR A;  5KG6 A;  4YMN A;  4YR2 A;  4UB4 A;  3SV3 A;  1ZQD A;  4KLD A;  4RWN A;  2NRK A;  4YCX A;  5CHG A;  5IIK A;  2BPF A;  2FLP A;  4IRK A;  9ICX A;  3MDC A;  3M9O B;  4F5Q A;  3MAB A;  4MFF A;  3PV8 A;  4WC1 A;  5BOM A;  4PGX A;  1NKE A;  4WCW A;  1TK0 A;  4B9V A;  1JAJ A;  3OJU A;  4FHV A;  2V4Q A;  4MF8 A;  4J9Q A;  3QEA Z;  1C7Y A;  4KLQ A;  8ICH A;  2ALZ A;  1U48 A;  2DFL A;  1S0O A;  4QZB A;  3GIJ A;  4ATB A;  4O0I A;  8ICC A;  1MQ2 A;  3AU2 A;  3HIY A;  3PX0 A;  4EBD A;  3ISC A;  1MIW A;  4C8N A;  2AGP A;  3ZD9 A;  3PO5 A;  4J9R A;  1ARO P;  4FHX A;  4F5N A;  1HUO A;  4DSJ A;  4Q8E A;  1JMS A;  1R8C A;  4O3O A;  2ZH6 A;  3PW7 A;  1BNP A;  5KFH A;  5HP4 A;  1A76 A;  4DFP A;  4PHE A;  3EW9 A;  2C22 A;  7ICP A;  1DK3 A;  4RPZ A;  4UB3 A;  1ZET A;  2FLN A;  5DG8 A;  4EBK A;  5D46 A;  2ZUC A;  3GV5 B;  3EPI A;  1D9F A;  3UXO A;  5KFD A;  4KMU A;  8ICZ A;  8ICL A;  4KLI A;  4Z6C A;  4IR9 A;  2DVI A;  3BQ2 A;  1TV9 A;  2BKE A;  4QZH A;  1QSY A;  1UT8 A;  1KTQ A;  4F2R A;  2ZUD A;  3C5F A;  3MR3 A;  5IIL A;  2JEJ A;  2VA3 A;  1Z00 A;  4FHY A;  1V9P A;  4RUC A;  2AJQ A;  4ECZ A;  4ED1 A;  8ICY A;  1COO A;  1XU4 A;  4R8U A;  1ZQZ A;  4BWM A;  5KFJ A;  2PFP A;  4RT3 A;  1X9M A;  2W9B A;  3RH6 A;  2IBK A;  3GIL A;  1ZQR A;  4KLF A;  9ICT A;  4DL2 A;  4X4R A;  3GIM A;  3PVX A;  1ZQE A;  4DQQ A;  1FA0 A;  8ICP A;  4TUR A;  3WFS C;  3AQN A;  2RDI A;  3V7J A;  2PFN A;  4RNO A;  3G6Y A;  3WFQ E;  5KFZ A;  4J9K A;  2ZH5 A;  3V7L A;  5J29 A;  5DDY A;  4RNN A;  3RJG A;  4BGD A;  4RNM A;  3PML A;  5HRH A;  1RXW A;  4RUA A;  3V6J A;  2IA6 A;  1R89 A;  4ZH4 A;  2RDJ A;  4KLE A;  1RPL A;  4ECV A;  2BCV A;  5KFK A;  5J0S A;  1ZQL A;  2JZB A;  2JEI A;  9ICU A;  4F4W A;  1N56 A;  8ICO A;  4F91 B;  3OJS A;  4ED3 A;  1ZQN A;  4Q8F A;  7ICK A;  7ICO A;  4ATB B;  2AU0 A;  4I2B A;  2M2W A;  2DR9 A;  4NLZ A;  3UXP A;  4NM1 A;  5KT4 A;  5BPC A;  2FMS A;  5DB7 A;  4EZ6 A;  1R8B A;  5IIO A;  5DED A;  7ICL A;  3TAP A;  3MR6 A;  1ZQT A;  1S97 A;  4DSK A;  4KLS A;  8ICG A;  1ZQF A;  4NLN A;  2I1Q A;  2PFQ A;  4ELV A;  4X4S A;  3JPN A;  1ZQM A;  4KLM A;  5KFF A;  5KT5 A;  4QWB A;  5KG3 A;  7ICI A;  2IMW P;  4B9U A;  4ECR A;  2ZJ8 A;  3H40 A;  4O5C A;  2NRW A;  1X9S A;  3WFP A;  4O3P A;  3UQ2 A;  2MAX A;  5HRL A;  3RB0 A;  4P4P A;  3RJI A;  2ASD A;  1H38 A;  3MFH A;  2BQ3 A;  1BNO A;  2XGQ A;  3MFI A;  4DFJ A;  1JXL A;  1XSN A;  5KG7 A;  4RWP A;  3C1Y A;  3OVB A;  4JWN A;  4X4N A;  3THV A;  1Z00 B;  3MDA A;  3TAN A;  2R8H A;  3KTQ A;  2FPM A;  2ZH4 A;  3M8S A;  4RT2 A;  2DR7 A;  2PI4 A;  4KN7 A;  4M47 A;  5HRB A;  2XCP A;  1JIH A;  2VA2 A;  4LVS A;  3AUO A;  8ICM A;  4TUS A;  3PW5 A;  5EWE A;  4YD1 A;  5HHH A;  4JK1 A;  3TFR A;  2M2V A;  4IQT A;  1NO5 A;  3QZ8 A;  3LWM A;  1D8L A;  1ZQS A;  4O9M A;  2FMQ A;  2V9W A;  3M8R A;  4FH5 A;  3IM1 A;  1RXV A;  1ZQG A;  5HRK A;  7ICT A;  4P4O A;  2KTQ A;  4Q43 A;  4WC7 A;  2ASJ A;  2ISO A;  4JV1 A;  1XO1 A;  3KHG A;  9ICC A;  5DLF A;  3T5L A;  2JZB B;  4ELU A;  5HRD A;  3OVA A;  2DRA A;  4TQS A;  5KG4 A;  4KIT B;  5F9L A;  4ECY A;  3TAQ A;  2DR5 A;  1XWL A;  1Z3E B;  3EZ5 A;  2HHT A;  3H8W A;  4KN4 A;  4DQP A;  2BDP A;  3RJE A;  5J2A A;  3ISD A;  4M9L A;  4I2G A;  3C66 A;  1TFW A;  1LV5 A;  1KSP A;  1ZQB A;  4FHW A;  4Q45 A;  2JEF A;  3BQT A;  4RPY A;  5DG7 A;  1KDH A;  2BE3 A;  3OVS A;  5D4B A;  3MGH A;  4F5P A;  1TVA A;  2NRX A;  2XCA A;  4UD4 A;  2W8L A;  3K75 D;  4YR3 A;  4UAW A;  2C2D A;  4RPX A;  5DB6 A;  4QWC A;  4J9S A;  1U49 A;  8ICN A;  3BQ1 A;  8ICW A;  1BGX T;  4FHP A;  3HX0 A;  4J9N A;  4Q44 A;  4ED6 A;  1VJ7 A;  3RAX A;  5J0Q A;  3EPG A;  4YVZ A;  1ZQU A;  2W9C A;  5KFB A;  4ECX A;  2FPL A;  1UT5 A;  2BPC A;  3Q8L A;  2P6R A;  4B9L A;  9ICA A;  2HHQ A;  4NXZ A;  5CA7 A;  4QWE A;  8ICQ A;  5IIJ A;  4JWM A;  4BXO B;  5C5J A;  3SZ2 A;  1XC9 A;  3IHQ B;  5DB9 A;  5J0Y A;  4IRD A;  4MF2 A;  4K4H A;  2HVH A;  4UB5 A;  4QZ9 A;  9ICF A;  5KFC A;  5KTQ A;  1X9W A;  1NKB A;  5HC9 A;  4O3S A;  4YMM A;  3UQ0 A;  3C2K A;  1MIV A;  2KZ3 A;  4YP3 A;  1V4A A;  2ZTD A;  3OUY B;  1ZQP A;  2R8G A;  4KLG A;  3BDP A;  4ECS A;  4FH3 A;  4DEZ A;  1L3T A;  4F5R A;  5J2F A;  2Q0Z X;  4TQR A;  3ZDA A;  1A77 A;  4DQS A;  1ZQI A;  2UVU A;  4M2Y A;  3B0X A;  5DGB A;  4UQG A;  2XO7 A;  4GLX A;  3RB4 A;  8ICK A;  1MIY A;  2HVI A;  4ELT A;  2BGW A;  9ICM A;  4EYI B;  2HHP A;  4RWO A;  2DRB A;  5KFP A;  1RZT A;  2FPK A;  2F1J A;  3JPP A;  2HHX A;  4X4T A;  1X2I A;  1ZJN A;  3C18 A;  5J0P A;  3JPT A;  4ED0 A;  5HNK A;  3HP6 A;  2KZM A;  4EBJ A;  4C8M A;  1MQ3 A;  4AT8 A;  4TUQ A;  4QZG A;  4FS1 A;  2O1P A;  3WFO A;  4J9P A;  2NRZ A;  5J2I A;  4YQW A;  3PX6 A;  4M04 A;  3SYZ A;  3RJJ A;  4DSI A;  2UVW A;  4QZD A;  1SZP A;  4P4M A;  4DL3 A;  4M6W B;  4DF4 A;  4IG8 A;  1ZJM A;  3N4M B;  4BDP A;  5DBC A;  3Q8K A;  3RB6 A;  4X4P A;  1IXR A;  3HPO A;  3RR7 A;  4F5O A;  4DWI A;  8ICU A;  4DF8 A;  2BCR A;  5KG1 A;  4PHP A;  1UA1 A;  3C2L A;  4AT7 A;  2M2T A;  2J6T A;  5L9X A;  5DB8 A;  1BPE A;  3PW4 A;  3EWA A;  3LDA A;  8ICB A;  4B9M A;  1L3V A;  1ZQY A;  1WCN A;  4I2I A;  4DOB A;  3PY8 A;  4RQ3 A;  4WC3 A;  5KFA A;  4O3Q A;  1NK0 A;  1WOT A;  4F4Z A;  4KLL A;  8ICI A;  5HRG A;  5DQG A;  2DPJ A;  3C5G A;  4X0A A;  3OV7 A;  3HWT A;  5EWF A;  3OSN A;  2XY7 A;  3ZDB A;  2O5A A;  1DK2 A;  9ICK A;  5J0U A;  4DL4 A;  2DPI A;  7ICR A;  3H4B A;  4QWD A;  3GQC A;  1NJY A;  4ECU A;  4QW8 A;  4MEY A;  5KFQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...