4NXXA

Crystal structure of the cytosolic domain of human mid51
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
325
structure length
325
Chain Sequence
MSLQEKLLTYYRNRAAIPAGEQARAKQAAVDICAELRSFLRAKLPDMPLRDMYLSGSLYDDLQVVTADHIQLIVPLVLEQNLWSCIPGEDTIMNVPGFFLVRRENRGSSYWDRCVVGGYLSPKTVADTFEKVVAGSINWPAIGSLLDYVIRPAPPPEALTLEVQYERDKHLFIDFLPSVTLGDTVLVAKPHRLAQYDNLWRLSLRPAETARLRALDQADSGCRSLCLKILKAICKSTPALGHLTASQLTNVILHLAQEEADWSPDMLADRFLQALRGLISYLEAGVLPSALNPKVNLFAELTPEEIDELGYTLYCSLSEPEVLLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mitochondrial dynamic protein MID51
publication title Structural and functional analysis of MiD51, a dynamin receptor required for mitochondrial fission.
pubmed doi rcsb
source organism Homo sapiens
total genus 107
structure length 325
sequence length 325
ec nomenclature
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03281 Mab-21 Mab-21 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.40 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain Poly(a)-polymerase, middle domain 4nxxA01
3.30.460.90 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 4nxxA02
4O69A 4OAIZ 4LEWA 4OAGA 4LEVA 4JLXA 4NXXA 4OAHA 4WOYA 4NXVA 4O67A 4AT7B 4K9BA 4AT9A 4ATBA 4K97A 4O68A 4OAFA 4AT7A 4K98A 4NXUA 4AT8B 4JLZA 4LEYA 4NXWA 4O6AA 4K9AA 4K99A 4AT8A 4KM5A 4LEZA 4K96A 4K8VA 4MKPA 4KB6A 4AT9B 4NXTA 4ATBB
chains in the Genus database with same CATH superfamily
3C66A 4OAGA 4UB5A 3RH6A 3JYYA 4WC1A 4IQVA 9ICWA 2BBJA 7ICIA 4O68A 5CR0A 1ZQNA 4M5DA 2BCRA 5IIJA 2RFFA 7ICEA 3RJEA 2PXIA 5CFUA 3JPRA 2DR7A 1KDHA 4RT2A 1R8AA 4I2FA 5J0SA 5J0OA 3HIYA 3HWTA 5IIMA 4K96A 4MFCA 2M2TA 5J0TA 3H3AA 3JPNA 1ZQQA 4KLDA 8ICGA 4EEDA 3AU2A 4WOYA 2DR5A 4M9GA 2BPFA 2ZH1A 4AT7B 3OVAA 4EGWA 1ZJNA 1VFGA 9ICOA 3ER9B 4WBZA 5J2GA 8ICUA 1TVAA 1RPLA 5B3QA 5HC9A 3ER8C 8ICYA 3PNCA 1V4AA 4PHAA 7ICPA 3C2LA 4RQ8A 4YCXA 9ICGA 4I2DA 4RPXA 5J2DA 4RPYA 2ZHAA 3JPSA 4QZ9A 2BCSA 4MKPA 4GXJA 2O1PA 1XSNA 1Q78A 5JTGA 5DB9A 4M2YA 4QZHA 4OAHA 4KLLA 3HJ4A 1BPDA 3RJGA 5J2AA 4RWNA 4FHYA 9ICRA 2DR9A 2VANA 3B0XA 4K98A 4I2JA 5J0WA 4NXUA 1ZQMA 4WC7A 4M9NA 4X4TA 4YMOA 3MBYA 5J2FA 4KLFA 5CP2A 2B56A 5J2EA 9ICCA 4FH5A 1UEUA 1F5AA 3H37A 3ISCA 4XJEA 4NXXA 5HHHA 4QZDA 4UB2A 1ZQUA 2PFPA 9ICKA 3RH5A 4NXVA 5J29A 4R66A 4XA5A 8ICWA 7ICSA 3JPPA 3UXNA 5HHIA 9ICMA 4M0AA 8ICAA 2PBEA 1BPEA 3MCRA 1ZQCA 4NXWA 5J2JA 2ZH3A 4WC6A 9ICFA 3OUYA 3C2MA 1ZQRA 4O5EA 5HRBA 1MIWA 5D46A 4I29A 9ICNA 4X4RA 2BCVA 4IQWA 1BPBA 4R65A 4K4IA 4OAFA 3V7JA 4NM2A 4NKTA 4XQ8A 3AUOA 1NOMA 5D63A 4UD5A 4LZDA 4RQ0A 4DOBA 4LT6A 4RT3A 4PHDA 1BPXA 1ZQKA 5J0XA 3AU6A 2IHMA 8ICKA 9ICVA 3RJFA 4XUSA 4WC2A 4EEBA 3PMLA 1ZQFA 8ICCA 1ZQIA 5J0QA 7ICMA 4WBYA 7ICKA 4JWNA 2ZH8A 3OUYB 4FHVA 2BCQA 3WFSC 4X0AA 5HREA 4JWMA 2I9GA 4UAZA 4NY8A 3NWIA 1VJ7A 5D49A 5HRDA 3WFPA 2Q66A 1R89A 4X4NA 4R63A 5TZVA 4LZGA 4PH5A 3NKUA 3MDAA 7ICQA 1JMSA 1BPYA 5J2HA 8ICZA 3H38A 4LEWA 7ICRA 5DB8A 7ICLA 2FMSA 4AT9A 4MF8A 5CWRA 3LK9A 1HUOA 4LVSA 8ICJA 4RQ3A 4UAWA 5IILA 5DKWA 5J2IA 4KLMA 4O5CA 4QZAA 4XQ7A 4UAYA 4KLHA 3AQNA 3JZ0A 4RPZA 1ZQGA 4KLEA 1ZQDA 4KB6A 4FO6A 3RJKA 5J0UA 4KLUA 2DVIA 4I2BA 9ICBA 5CJ7A 1UETA 5DB7A 4I2EA 4EBJA 4Z6FA 3HX0A 3WFRE 2DRBA 7ICNA 4E80A 5IINA 4X4PA 4X4VA 9ICEA 5HR9A 7ICOA 4I0UA 3B0YA 1Q79A 4KLJA 4X4QA 1TV9A 1RZTA 4TUPA 4WC4A 3ISDA 2GAFD 4E8FA 4R64A 3PHZA 1ZQSA 1OU5A 3UQ0A 3OVBA 3WFOA 1ZQJA 4TURA 3OVSA 2ZH4A 2BBHA 4I2CA 4AT9B 5HRLA 4N7RA 4JLXA 5CFTA 4Z6CA 7ICGA 2PFNA 1KNYA 4O5KA 5DBBA 4K97A 1UEVA 2FMPA 5J2CA 4KLSA 1ZQXA 4RQ7A 2GWSA 2GA9D 5CB1A 1ZQAA 5DB6A 3ERCC 4LEYA 4I28A 3C5FA 5BOMA 4UB4A 2M2UA 3UQ2A 8ICMA 4IQTA 2ISPA 3JPOA 2ZH9A 4QZEA 5J2BA 3JPTA 3K7DA 8ICFA 9ICQA 4YN4A 2BCUA 1WOTA 5D61A 4GXIA 2IUBA 2ID1A 1R8BA 5D4BA 8ICOA 5IIKA 8ICSA 5F2VO 4UB3A 4RQ5A 2FMQA 3V7LA 4M9LA 1ZQYA 1BPZA 4NLZA 8ICRA 4TUSA 4DO9A 4EV6A 9ICLA 4WC0A 1ZJMA 9ICAA 4FHPA 1KEJA 4PHPA 4K99A 4F5QA 2FCLA 5DEDA 5B3PA 5HRKA 4Z6EA 3PMNA 1JQRA 4K4GA 4MF2A 2HN2A 2W9MA 5HRGA 2ISOA 4PGXA 4O69A 4I2HA 4YMMA 4MFAA 5IIOA 4I27A 4RWQA 8ICTA 4K9BA 2B51A 4P4OA 2EWRA 4KLGA 1YLQA 4WC3A 8ICXA 3ISBA 8ICNA 2HN1A 2DRAA 3MDCA 1GPJA 1JN3A 5J2KA 4I2AA 4KM5A 5HRHA 5CA7A 1ZQLA 7ICVA 3MGHA 1MQ3A 1MIYA 7ICHA 3LQCB 4PHEA 4P2HA 3TFSA 3EF2A 3UXOA 1ZQPA 1HUZA 4UBCA 4F5NA 4X4UA 5BPCA 4WC5A 8ICVA 1TFWA 4RWOA 1ZQHA 2ZH5A 9ICXA 4FO1A 2M2WA 9ICIA 3JCFA 2ZHBA 2NRKA 4EP7A 1ZQZA 8ICPA 5CHEA 4YD2A 8ICHA 4RQ4A 4KLIA 4EBKA 7ICTA 3GDXA 4Z6DA 5J0RA 5DECA 3TFRA 4QZGA 4F5OA 2ZH6A 1XSLA 1JAJA 4YMNA 4UB1A 4QZIA 4P4PA 7ICFA 4S3NA 4GXKA 7ICJA 4O67A 2DR8A 2HHPA 3K75D 3NVOA 4F5RA 2M2VA 2O5AA 1ZQEA 3RH4A 4F5PA 2B4VA 3C18A 4JLZA 4UBBA 4TUQA 1MQ2A 8ICEA 3RJHA 4RWPA 4AT8A 4IQUA 5J0PA 1ZQOA 3RJJA 5HRFA 3MGIA 5DBAA 4NXTA 3AQLA 3V7KA 4O9MA 4WQKA 4KLOA 3L9DA 1PX5A 4FHXA 9ICTA 3OGUA 4X4SA 3UPSA 4WH5A 1XSPA 4I2GA 3WFQE 4KLTA 3HJ1A 4X0BA 3CK6A 4E7XA 5DDYA 5J0YA 4M04A 1NO5A 8ICQA 8ICIA 4QZ8A 4PGYA 5BOLA 4NM1A 4K9AA 3AQMA 4WQLA 3H39A 1MIVA 2ZH7A 4M47A 4NLKA 4QZBA 8ICLA 4K8VA 1TFYA 4NXZA 4K4HA 9ICUA 4LEZA 4OAIZ 9ICSA 2PFQA 4NLNA 2ZH2A 4P4MA 4ATBA 4YD1A 4RQ2A 4IG8A 2BPGA 5CFSA 4AT8B 4QZFA 2BPCA 4FH3A 4O6AA 3V72A 3RJIA 2IHOA 3OWGA 4XRHA 5CHGA 1ZQBA 9ICPA 5EOZA 4NKUA 4X4OA 5DBCA 3UPQA 5D62A 4QZCA 3C5GA 4RQ6A 4LEVA 4WCWA 4PGQA 2P66A 8ICBA 1R8CA 3UXPA 5IIIA 3AQKA 4M9JA 1FA0A 4RQ1A 4PPXA 3C2KA 4MFFA 4KLQA 4M9HA 5DDMA 1ZQVA 4AT7A 4HX0A 4DOAA 4X5VA 3HW8A 3NYBA 2BE3A 7ICUA 4FHWA 4I2IA 9ICHA 2PFOA 1ZQTA 4DOCA 4UD4A 9ICJA 5HRIA 3OV7A 1ZQWA 3JPQA 4ATBB
chains in the Genus database with same CATH topology
3C66A 4OAGA 4N7RA 4JLXA 5CFTA 4O67A 2DR8A 4X4RA 1UEVA 2HHPA 4K97A 4O68A 4OAFA 4M5DA 2B4VA 2GA9D 4NKTA 3ERCC 4JLZA 4LEYA 5D63A 5CFUA 4UD5A 2DR7A 1R8AA 4LT6A 4AT8A 3HIYA 2ZH9A 4K96A 3K7DA 4NXTA 4WQKA 5D61A 1R8BA 4FHXA 4WOYA 2DR5A 4X4SA 2ZH1A 4AT7B 3OVAA 4WH5A 3ER9B 3HJ1A 5B3QA 4E7XA 2ZH8A 3ER8C 3OUYB 4FHVA 4FHPA 4K9AA 4K99A 2FCLA 4WQLA 5B3PA 2Q66A 2ZHAA 1R89A 2ZH7A 4X4NA 4K8VA 4MKPA 1TFYA 2O1PA 3NKUA 1Q78A 4LEZA 4O69A 4OAIZ 4LEWA 4OAHA 2ZH2A 3HJ4A 4K9BA 4AT9A 2B51A 4ATBA 2EWRA 4FHYA 2DR9A 5CFSA 4K98A 4NXUA 4AT8B 4X4TA 4FH3A 4O6AA 2DRAA 2IHOA 3OWGA 1GPJA 4KM5A 2B56A 4NKUA 2ZH6A 4X4OA 4FH5A 5D62A 4KB6A 1UEUA 1F5AA 2DVIA 3EF2A 1UETA 4LEVA 4XJEA 4NXXA 1R8CA 4X4UA 2DRBA 4E80A 4NXVA 4X4PA 1TFWA 4X4VA 1FA0A 2ZH5A 4FO1A 4AT7A 4HX0A 2ZHBA 3MCRA 1Q79A 3NYBA 4EP7A 4X4QA 5CHEA 4NXWA 4FHWA 2GAFD 4E8FA 2ZH3A 3PHZA 3OUYA 3OVBA 4UD4A 3OV7A 3OVSA 2ZH4A 4AT9B 4ATBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O69 A;  4OAI Z;  4LEW A;  4OAG A;  4LEV A;  4JLX A;  4NXX A;  4OAH A;  4WOY A;  4NXV A;  4O67 A;  4AT7 B;  4K9B A;  4AT9 A;  4ATB A;  4K97 A;  4O68 A;  4OAF A;  4AT7 A;  4K98 A;  4NXU A;  4AT8 B;  4JLZ A;  4LEY A;  4NXW A;  4O6A A;  4K9A A;  4K99 A;  4AT8 A;  4KM5 A;  4LEZ A;  4K96 A;  4K8V A;  4MKP A;  4KB6 A;  4AT9 B;  4NXT A;  4ATB B; 
#chains in the Genus database with same CATH topology
 3C66 A;  4OAG A;  4UB5 A;  3RH6 A;  3JYY A;  4WC1 A;  4IQV A;  9ICW A;  2BBJ A;  7ICI A;  4O68 A;  5CR0 A;  1ZQN A;  4M5D A;  2BCR A;  5IIJ A;  2RFF A;  7ICE A;  3RJE A;  2PXI A;  5CFU A;  3JPR A;  2DR7 A;  1KDH A;  4RT2 A;  1R8A A;  4I2F A;  5J0S A;  5J0O A;  3HIY A;  3HWT A;  5IIM A;  4K96 A;  4MFC A;  2M2T A;  5J0T A;  3H3A A;  3JPN A;  1ZQQ A;  4KLD A;  8ICG A;  4EED A;  3AU2 A;  4WOY A;  2DR5 A;  4M9G A;  2BPF A;  2ZH1 A;  4AT7 B;  3OVA A;  4EGW A;  1ZJN A;  1VFG A;  9ICO A;  3ER9 B;  4WBZ A;  5J2G A;  8ICU A;  1TVA A;  1RPL A;  5B3Q A;  5HC9 A;  3ER8 C;  8ICY A;  3PNC A;  1V4A A;  4PHA A;  7ICP A;  3C2L A;  4RQ8 A;  4YCX A;  9ICG A;  4I2D A;  4RPX A;  5J2D A;  4RPY A;  2ZHA A;  3JPS A;  4QZ9 A;  2BCS A;  4MKP A;  4GXJ A;  2O1P A;  1XSN A;  1Q78 A;  5JTG A;  5DB9 A;  4M2Y A;  4QZH A;  4OAH A;  4KLL A;  3HJ4 A;  1BPD A;  3RJG A;  5J2A A;  4RWN A;  4FHY A;  9ICR A;  2DR9 A;  2VAN A;  3B0X A;  4K98 A;  4I2J A;  5J0W A;  4NXU A;  1ZQM A;  4WC7 A;  4M9N A;  4X4T A;  4YMO A;  3MBY A;  5J2F A;  4KLF A;  5CP2 A;  2B56 A;  5J2E A;  9ICC A;  4FH5 A;  1UEU A;  1F5A A;  3H37 A;  3ISC A;  4XJE A;  4NXX A;  5HHH A;  4QZD A;  4UB2 A;  1ZQU A;  2PFP A;  9ICK A;  3RH5 A;  4NXV A;  5J29 A;  4R66 A;  4XA5 A;  8ICW A;  7ICS A;  3JPP A;  3UXN A;  5HHI A;  9ICM A;  4M0A A;  8ICA A;  2PBE A;  1BPE A;  3MCR A;  1ZQC A;  4NXW A;  5J2J A;  2ZH3 A;  4WC6 A;  9ICF A;  3OUY A;  3C2M A;  1ZQR A;  4O5E A;  5HRB A;  1MIW A;  5D46 A;  4I29 A;  9ICN A;  4X4R A;  2BCV A;  4IQW A;  1BPB A;  4R65 A;  4K4I A;  4OAF A;  3V7J A;  4NM2 A;  4NKT A;  4XQ8 A;  3AUO A;  1NOM A;  5D63 A;  4UD5 A;  4LZD A;  4RQ0 A;  4DOB A;  4LT6 A;  4RT3 A;  4PHD A;  1BPX A;  1ZQK A;  5J0X A;  3AU6 A;  2IHM A;  8ICK A;  9ICV A;  3RJF A;  4XUS A;  4WC2 A;  4EEB A;  3PML A;  1ZQF A;  8ICC A;  1ZQI A;  5J0Q A;  7ICM A;  4WBY A;  7ICK A;  4JWN A;  2ZH8 A;  3OUY B;  4FHV A;  2BCQ A;  3WFS C;  4X0A A;  5HRE A;  4JWM A;  2I9G A;  4UAZ A;  4NY8 A;  3NWI A;  1VJ7 A;  5D49 A;  5HRD A;  3WFP A;  2Q66 A;  1R89 A;  4X4N A;  4R63 A;  5TZV A;  4LZG A;  4PH5 A;  3NKU A;  3MDA A;  7ICQ A;  1JMS A;  1BPY A;  5J2H A;  8ICZ A;  3H38 A;  4LEW A;  7ICR A;  5DB8 A;  7ICL A;  2FMS A;  4AT9 A;  4MF8 A;  5CWR A;  3LK9 A;  1HUO A;  4LVS A;  8ICJ A;  4RQ3 A;  4UAW A;  5IIL A;  5DKW A;  5J2I A;  4KLM A;  4O5C A;  4QZA A;  4XQ7 A;  4UAY A;  4KLH A;  3AQN A;  3JZ0 A;  4RPZ A;  1ZQG A;  4KLE A;  1ZQD A;  4KB6 A;  4FO6 A;  3RJK A;  5J0U A;  4KLU A;  2DVI A;  4I2B A;  9ICB A;  5CJ7 A;  1UET A;  5DB7 A;  4I2E A;  4EBJ A;  4Z6F A;  3HX0 A;  3WFR E;  2DRB A;  7ICN A;  4E80 A;  5IIN A;  4X4P A;  4X4V A;  9ICE A;  5HR9 A;  7ICO A;  4I0U A;  3B0Y A;  1Q79 A;  4KLJ A;  4X4Q A;  1TV9 A;  1RZT A;  4TUP A;  4WC4 A;  3ISD A;  2GAF D;  4E8F A;  4R64 A;  3PHZ A;  1ZQS A;  1OU5 A;  3UQ0 A;  3OVB A;  3WFO A;  1ZQJ A;  4TUR A;  3OVS A;  2ZH4 A;  2BBH A;  4I2C A;  4AT9 B;  5HRL A;  4N7R A;  4JLX A;  5CFT A;  4Z6C A;  7ICG A;  2PFN A;  1KNY A;  4O5K A;  5DBB A;  4K97 A;  1UEV A;  2FMP A;  5J2C A;  4KLS A;  1ZQX A;  4RQ7 A;  2GWS A;  2GA9 D;  5CB1 A;  1ZQA A;  5DB6 A;  3ERC C;  4LEY A;  4I28 A;  3C5F A;  5BOM A;  4UB4 A;  2M2U A;  3UQ2 A;  8ICM A;  4IQT A;  2ISP A;  3JPO A;  2ZH9 A;  4QZE A;  5J2B A;  3JPT A;  3K7D A;  8ICF A;  9ICQ A;  4YN4 A;  2BCU A;  1WOT A;  5D61 A;  4GXI A;  2IUB A;  2ID1 A;  1R8B A;  5D4B A;  8ICO A;  5IIK A;  8ICS A;  5F2V O;  4UB3 A;  4RQ5 A;  2FMQ A;  3V7L A;  4M9L A;  1ZQY A;  1BPZ A;  4NLZ A;  8ICR A;  4TUS A;  4DO9 A;  4EV6 A;  9ICL A;  4WC0 A;  1ZJM A;  9ICA A;  4FHP A;  1KEJ A;  4PHP A;  4K99 A;  4F5Q A;  2FCL A;  5DED A;  5B3P A;  5HRK A;  4Z6E A;  3PMN A;  1JQR A;  4K4G A;  4MF2 A;  2HN2 A;  2W9M A;  5HRG A;  2ISO A;  4PGX A;  4O69 A;  4I2H A;  4YMM A;  4MFA A;  5IIO A;  4I27 A;  4RWQ A;  8ICT A;  4K9B A;  2B51 A;  4P4O A;  2EWR A;  4KLG A;  1YLQ A;  4WC3 A;  8ICX A;  3ISB A;  8ICN A;  2HN1 A;  2DRA A;  3MDC A;  1GPJ A;  1JN3 A;  5J2K A;  4I2A A;  4KM5 A;  5HRH A;  5CA7 A;  1ZQL A;  7ICV A;  3MGH A;  1MQ3 A;  1MIY A;  7ICH A;  3LQC B;  4PHE A;  4P2H A;  3TFS A;  3EF2 A;  3UXO A;  1ZQP A;  1HUZ A;  4UBC A;  4F5N A;  4X4U A;  5BPC A;  4WC5 A;  8ICV A;  1TFW A;  4RWO A;  1ZQH A;  2ZH5 A;  9ICX A;  4FO1 A;  2M2W A;  9ICI A;  3JCF A;  2ZHB A;  2NRK A;  4EP7 A;  1ZQZ A;  8ICP A;  5CHE A;  4YD2 A;  8ICH A;  4RQ4 A;  4KLI A;  4EBK A;  7ICT A;  3GDX A;  4Z6D A;  5J0R A;  5DEC A;  3TFR A;  4QZG A;  4F5O A;  2ZH6 A;  1XSL A;  1JAJ A;  4YMN A;  4UB1 A;  4QZI A;  4P4P A;  7ICF A;  4S3N A;  4GXK A;  7ICJ A;  4O67 A;  2DR8 A;  2HHP A;  3K75 D;  3NVO A;  4F5R A;  2M2V A;  2O5A A;  1ZQE A;  3RH4 A;  4F5P A;  2B4V A;  3C18 A;  4JLZ A;  4UBB A;  4TUQ A;  1MQ2 A;  8ICE A;  3RJH A;  4RWP A;  4AT8 A;  4IQU A;  5J0P A;  1ZQO A;  3RJJ A;  5HRF A;  3MGI A;  5DBA A;  4NXT A;  3AQL A;  3V7K A;  4O9M A;  4WQK A;  4KLO A;  3L9D A;  1PX5 A;  4FHX A;  9ICT A;  3OGU A;  4X4S A;  3UPS A;  4WH5 A;  1XSP A;  4I2G A;  3WFQ E;  4KLT A;  3HJ1 A;  4X0B A;  3CK6 A;  4E7X A;  5DDY A;  5J0Y A;  4M04 A;  1NO5 A;  8ICQ A;  8ICI A;  4QZ8 A;  4PGY A;  5BOL A;  4NM1 A;  4K9A A;  3AQM A;  4WQL A;  3H39 A;  1MIV A;  2ZH7 A;  4M47 A;  4NLK A;  4QZB A;  8ICL A;  4K8V A;  1TFY A;  4NXZ A;  4K4H A;  9ICU A;  4LEZ A;  4OAI Z;  9ICS A;  2PFQ A;  4NLN A;  2ZH2 A;  4P4M A;  4ATB A;  4YD1 A;  4RQ2 A;  4IG8 A;  2BPG A;  5CFS A;  4AT8 B;  4QZF A;  2BPC A;  4FH3 A;  4O6A A;  3V72 A;  3RJI A;  2IHO A;  3OWG A;  4XRH A;  5CHG A;  1ZQB A;  9ICP A;  5EOZ A;  4NKU A;  4X4O A;  5DBC A;  3UPQ A;  5D62 A;  4QZC A;  3C5G A;  4RQ6 A;  4LEV A;  4WCW A;  4PGQ A;  2P66 A;  8ICB A;  1R8C A;  3UXP A;  5III A;  3AQK A;  4M9J A;  1FA0 A;  4RQ1 A;  4PPX A;  3C2K A;  4MFF A;  4KLQ A;  4M9H A;  5DDM A;  1ZQV A;  4AT7 A;  4HX0 A;  4DOA A;  4X5V A;  3HW8 A;  3NYB A;  2BE3 A;  7ICU A;  4FHW A;  4I2I A;  9ICH A;  2PFO A;  1ZQT A;  4DOC A;  4UD4 A;  9ICJ A;  5HRI A;  3OV7 A;  1ZQW A;  3JPQ A;  4ATB B; 
#chains in the Genus database with same CATH homology
 3C66 A;  4OAG A;  4N7R A;  4JLX A;  5CFT A;  4O67 A;  2DR8 A;  4X4R A;  1UEV A;  2HHP A;  4K97 A;  4O68 A;  4OAF A;  4M5D A;  2B4V A;  2GA9 D;  4NKT A;  3ERC C;  4JLZ A;  4LEY A;  5D63 A;  5CFU A;  4UD5 A;  2DR7 A;  1R8A A;  4LT6 A;  4AT8 A;  3HIY A;  2ZH9 A;  4K96 A;  3K7D A;  4NXT A;  4WQK A;  5D61 A;  1R8B A;  4FHX A;  4WOY A;  2DR5 A;  4X4S A;  2ZH1 A;  4AT7 B;  3OVA A;  4WH5 A;  3ER9 B;  3HJ1 A;  5B3Q A;  4E7X A;  2ZH8 A;  3ER8 C;  3OUY B;  4FHV A;  4FHP A;  4K9A A;  4K99 A;  2FCL A;  4WQL A;  5B3P A;  2Q66 A;  2ZHA A;  1R89 A;  2ZH7 A;  4X4N A;  4K8V A;  4MKP A;  1TFY A;  2O1P A;  3NKU A;  1Q78 A;  4LEZ A;  4O69 A;  4OAI Z;  4LEW A;  4OAH A;  2ZH2 A;  3HJ4 A;  4K9B A;  4AT9 A;  2B51 A;  4ATB A;  2EWR A;  4FHY A;  2DR9 A;  5CFS A;  4K98 A;  4NXU A;  4AT8 B;  4X4T A;  4FH3 A;  4O6A A;  2DRA A;  2IHO A;  3OWG A;  1GPJ A;  4KM5 A;  2B56 A;  4NKU A;  2ZH6 A;  4X4O A;  4FH5 A;  5D62 A;  4KB6 A;  1UEU A;  1F5A A;  2DVI A;  3EF2 A;  1UET A;  4LEV A;  4XJE A;  4NXX A;  1R8C A;  4X4U A;  2DRB A;  4E80 A;  4NXV A;  4X4P A;  1TFW A;  4X4V A;  1FA0 A;  2ZH5 A;  4FO1 A;  4AT7 A;  4HX0 A;  2ZHB A;  3MCR A;  1Q79 A;  3NYB A;  4EP7 A;  4X4Q A;  5CHE A;  4NXW A;  4FHW A;  2GAF D;  4E8F A;  2ZH3 A;  3PHZ A;  3OUY A;  3OVB A;  4UD4 A;  3OV7 A;  3OVS A;  2ZH4 A;  4AT9 B;  4ATB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...