4NXXA

Crystal structure of the cytosolic domain of human mid51
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
325
structure length
325
Chain Sequence
b'MSLQEKLLTYYRNRAAIPAGEQARAKQAAVDICAELRSFLRAKLPDMPLRDMYLSGSLYDDLQVVTADHIQLIVPLVLEQNLWSCIPGEDTIMNVPGFFLVRRENRGSSYWDRCVVGGYLSPKTVADTFEKVVAGSINWPAIGSLLDYVIRPAPPPEALTLEVQYERDKHLFIDFLPSVTLGDTVLVAKPHRLAQYDNLWRLSLRPAETARLRALDQADSGCRSLCLKILKAICKSTPALGHLTASQLTNVILHLAQEEADWSPDMLADRFLQALRGLISYLEAGVLPSALNPKVNLFAELTPEEIDELGYTLYCSLSEPEVLLQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondrial dynamic protein MID51
publication title Structural and functional analysis of MiD51, a dynamin receptor required for mitochondrial fission.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 107
structure length 325
sequence length 325
ec nomenclature
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03281 Mab-21 Mab-21 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.40 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain Poly(a)-polymerase, middle domain 4nxxA01
3.30.460.90 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 4nxxA02
4OAIZ 4NXTA 4AT9A 4O6AA 4K9BA 4NXWA 4AT8B 4NXVA 4WOYA 4NXUA 4MKPA 4AT7B 4JLXA 4NXXA 4LEVA 4O67A 4AT8A 4LEYA 4OAHA 4K99A 4AT7A 4K98A 4LEWA 4LEZA 4KM5A 4ATBB 4K8VA 4K96A 4K9AA 4K97A 4ATBA 4KB6A 4OAFA 4AT9B 4OAGA 4JLZA 4O68A 4O69A
chains in the Genus database with same CATH superfamily
4M2YA 5CA7A 4X4SA 5DB9A 3C5FA 4MF2A 5J2EA 8ICOA 8ICPA 3MGHA 4PH5A 4UBCA 2P66A 5IIJA 9ICTA 2B51A 4M0AA 2PFOA 3B0XA 8ICUA 2DR7A 5B3QA 4QZEA 2FMPA 3UQ2A 4M9LA 2GA9D 3JPSA 1XSPA 1VJ7A 2ZHAA 5DBBA 9ICAA 4R65A 5CR0A 4MFAA 3ISBA 4X4OA 4X0BA 2BBJA 8ICZA 4M04A 4O9MA 4MF8A 1ZQXA 4K98A 3B0YA 9ICEA 4RPXA 1MIWA 1MIYA 4K9AA 4EBJA 1UEVA 4PHDA 4PGXA 8ICMA 4RQ8A 4WC4A 1ZQTA 4X4UA 5DKWA 5J0UA 3UXNA 2RFFA 2DVIA 4KLTA 1Q78A 5J0OA 2BE3A 4O6AA 4TUPA 2ISOA 2BCSA 5J0YA 8ICWA 4JLXA 4NXXA 4WC7A 2BPGA 4PHEA 4EBKA 4UD4A 3WFPA 5CHEA 7ICNA 4M9NA 2B4VA 1PX5A 7ICEA 1BPYA 3WFSC 1UEUA 3NYBA 4KB6A 5JTGA 4OAGA 4O68A 4I2AA 4KLMA 5HRIA 5DB7A 1ZQQA 5D46A 3AQMA 2M2WA 8ICXA 4KLSA 3C66A 1ZJMA 2O1PA 7ICRA 4UB3A 4FO1A 2IHOA 4UB5A 5J2FA 3PHZA 4P2HA 1YLQA 5J2DA 4XRHA 9ICBA 5DECA 3PMLA 3CK6A 4K99A 4UAZA 4YCXA 4R64A 4M47A 4Z6CA 8ICFA 4R63A 3JPNA 5B3PA 1TV9A 9ICFA 7ICOA 3UQ0A 2BCVA 1HUOA 4IQWA 4HX0A 5J29A 9ICVA 4F5QA 9ICOA 4X0AA 4NXVA 4YMNA 5DB6A 4WQKA 2ZH7A 4GXIA 5HRHA 3LK9A 1NOMA 2FMSA 9ICIA 2HHPA 4F5RA 2M2VA 2HN2A 3HJ4A 4PHPA 1JN3A 4QZ9A 3V7KA 1TFYA 3NWIA 3MCRA 1R8BA 4LEWA 4K8VA 4IQTA 5CFTA 4QZBA 4X4QA 1TFWA 2FMQA 1ZQWA 2W9MA 4AT9B 3C5GA 3OVSA 1V4AA 2PBEA 3V7JA 5D4BA 1JMSA 7ICKA 4NXTA 5J0XA 1ZQEA 4WBZA 3TFSA 3OV7A 4EEDA 2Q66A 5CHGA 4FH3A 8ICBA 4QZHA 4I2BA 5D49A 5HHIA 3H37A 4FHYA 4PPXA 3ER8C 2ZH1A 4RQ4A 4FO6A 2PFQA 1KDHA 4AT7A 4RQ7A 4DOAA 3JYYA 2BCQA 4KLOA 7ICTA 3OUYB 4ATBB 4GXJA 4TUQA 4WC6A 3C18A 4M5DA 5J2HA 2DR8A 4Z6FA 4QZCA 5HRDA 4KLLA 9ICSA 4I2EA 4Z6EA 9ICGA 4OAFA 1BPBA 1UETA 1MIVA 4O69A 4LVSA 4WC3A 7ICGA 4NLZA 3V72A 5CFUA 3RJIA 1ZQOA 4X4RA 4LEVA 4F5PA 3OVAA 4LEYA 5IILA 4MFFA 4JWMA 5J2KA 3AQLA 5J0WA 9ICMA 5HRKA 4YMMA 5J2GA 4K4IA 4UAWA 5HC9A 1ZJNA 8ICAA 5BPCA 2ZHBA 4XQ7A 4NY8A 2BPFA 1JAJA 4I2HA 4JLZA 3MGIA 5J2IA 3NKUA 1ZQMA 4RQ6A 3AQKA 2PXIA 2PFPA 4WOYA 4UB2A 8ICTA 4DOCA 5J0TA 5J0PA 3UPQA 5CFSA 3JCFA 5J0RA 4I2GA 7ICMA 4E80A 4KLIA 1RZTA 3PMNA 1ZQGA 4DOBA 5EOZA 4RPYA 4EGWA 5J2JA 7ICLA 4IQVA 2DR5A 5CJ7A 2ZH3A 8ICJA 4KLJA 1ZQHA 4WCWA 2IUBA 5CP2A 8ICNA 3H39A 3TFRA 4K9BA 7ICVA 4NLNA 3AU6A 2PFNA 4XUSA 1ZQKA 4QZAA 4FHPA 4MKPA 4S3NA 1GPJA 1ZQRA 1ZQAA 5BOMA 4OAHA 1ZQBA 2ZH6A 2ZH8A 4KM5A 4X4NA 4WC2A 1BPXA 1ZQUA 9ICRA 1TVAA 8ICGA 3OVBA 7ICHA 2ZH9A 3LQCB 3RH4A 1BPEA 4NXZA 5J0QA 4AT8B 4X4TA 9ICHA 3C2KA 1MQ3A 8ICYA 5HRGA 4I2CA 4UAYA 8ICKA 3RH5A 2IHMA 4N7RA 4MFCA 4XA5A 4RWQA 5HRBA 8ICEA 4TURA 4DO9A 4K96A 4WC1A 9ICWA 5BOLA 4I27A 3HW8A 3ERCC 5D62A 3GDXA 4IQUA 1ZQNA 5HRLA 4IG8A 1FA0A 3UXPA 2BPCA 4I28A 2ZH2A 3MDCA 2HN1A 3V7LA 4AT7B 2DR9A 4P4OA 4YN4A 1HUZA 1KEJA 3RJHA 3RJFA 8ICRA 4I2DA 3MDAA 3EF2A 1ZQIA 1ZQDA 1XSLA 4FHVA 5IIIA 4P4PA 3JPRA 4F5NA 7ICQA 4E7XA 3NVOA 4E8FA 4AT9A 4M9GA 4F5OA 2GAFD 5DBAA 4RWPA 2I9GA 2M2UA 3H38A 4I2IA 4RQ3A 4O5KA 4KLUA 3AUOA 4LZDA 1ZQPA 4NM1A 8ICVA 4NKTA 2ISPA 9ICNA 3OWGA 2DRAA 3RJKA 2FCLA 4NM2A 2BCRA 3JPPA 5DBCA 9ICJA 5J2BA 7ICIA 1R89A 4NLKA 4JWNA 5J2CA 4K97A 5IIMA 4KLDA 3OUYA 4ATBA 2M2TA 1NO5A 8ICCA 1ZQYA 3HIYA 8ICSA 5HHHA 4I0UA 1BPDA 2VANA 4WC5A 7ICSA 4UB1A 4PGQA 2DRBA 4RPZA 1BPZA 9ICLA 4QZGA 8ICHA 4WQLA 4O67A 4M9JA 7ICPA 9ICXA 5IINA 2BBHA 3K75D 5IIKA 4Z6DA 2EWRA 4WBYA 9ICUA 5HR9A 3HWTA 3L9DA 3PNCA 3UPSA 3H3AA 4LT6A 5HRFA 4GXKA 3RJGA 3AU2A 1OU5A 1XSNA 4QZ8A 1R8AA 4X4VA 4P4MA 4YD2A 5DB8A 2B56A 9ICQA 4PHAA 4I2FA 4NXUA 3RH6A 7ICJA 3HJ1A 5CB1A 5J0SA 4R66A 4FH5A 2ID1A 5J2AA 4EV6A 4QZDA 3HX0A 4FHXA 4UB4A 2ZH4A 3AQNA 4LEZA 2O5AA 3K7DA 1ZQZA 1VFGA 3JPQA 4KLQA 4X5VA 4YD1A 3RJEA 8ICQA 4UBBA 3C2MA 1MQ2A 4WH5A 1ZQVA 3ISDA 3JZ0A 4EP7A 1ZQCA 4RT3A 4KLEA 3WFOA 5D61A 5F2VO 5D63A 4QZFA 4PGYA 4XQ8A 4KLGA 2ZH5A 4KLHA 7ICUA 3ISCA 4X4PA 1JQRA 4O5CA 4RQ1A 4RWOA 4I2JA 2BCUA 4RT2A 4K4GA 5DEDA 4RQ5A 8ICLA 7ICFA 4RWNA 4XJEA 1KNYA 4M9HA 4UD5A 9ICCA 4OAIZ 2NRKA 4FHWA 3UXOA 4NXWA 3WFRE 8ICIA 2GWSA 1RPLA 9ICPA 4QZIA 1Q79A 4WC0A 4RQ2A 3MBYA 4K4HA 3JPOA 1ZQSA 5TZVA 3RJJA 4AT8A 4TUSA 4YMOA 4O5EA 1ZQLA 3ER9B 1ZQFA 5IIOA 1R8CA 3C2LA 5CWRA 5HREA 1ZQJA 4NKUA 4KLFA 1F5AA 3JPTA 4RQ0A 1WOTA 3OGUA 9ICKA 3WFQE 5DDMA 4EEBA 4I29A 4LZGA 5DDYA
chains in the Genus database with same CATH topology
4HX0A 4K9BA 4X4SA 4NXVA 4FHPA 4MKPA 2ZH7A 2DRBA 1GPJA 4WQKA 4WQLA 4O67A 2HHPA 4OAHA 3HJ4A 2ZH6A 2ZH8A 2EWRA 1TFYA 3MCRA 2B51A 1R8BA 4LEWA 4KM5A 4K8VA 4LT6A 4X4NA 5CFTA 2DR7A 4X4QA 5B3QA 1TFWA 3OVBA 4AT9B 3OVSA 1R8AA 2ZH9A 2GA9D 4X4VA 2B56A 4NXTA 2ZHAA 4AT8B 4X4TA 3OV7A 4NXUA 2Q66A 4FH3A 3HJ1A 4X4OA 4FHYA 3ER8C 2ZH1A 4FH5A 4N7RA 4FHXA 4AT7A 4K98A 2ZH4A 4LEZA 3OUYB 4ATBB 4K96A 3K7DA 4K9AA 4M5DA 1UEVA 2DR8A 3ERCC 5D62A 4X4UA 4OAFA 2DVIA 1FA0A 1UETA 4O69A 1Q78A 4WH5A 2ZH2A 4O6AA 5CFUA 4EP7A 4AT7B 4X4RA 4JLXA 2DR9A 4NXXA 4LEVA 3OVAA 4LEYA 5D61A 5D63A 2ZH5A 4X4PA 4UD4A 5CHEA 3EF2A 2B4VA 4FHVA 2ZHBA 1UEUA 3NYBA 4KB6A 4E7XA 4OAGA 4JLZA 4O68A 3NKUA 4E8FA 4XJEA 4UD5A 4OAIZ 4FHWA 4AT9A 4NXWA 2GAFD 3C66A 2O1PA 4WOYA 4FO1A 2IHOA 1Q79A 3PHZA 4AT8A 4NKTA 5CFSA 4K99A 3OWGA 2DRAA 4E80A 3ER9B 1R8CA 2FCLA 4NKUA 1R89A 1F5AA 5B3PA 4K97A 2DR5A 3OUYA 4ATBA 2ZH3A 3HIYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OAI Z;  4NXT A;  4AT9 A;  4O6A A;  4K9B A;  4NXW A;  4AT8 B;  4NXV A;  4WOY A;  4NXU A;  4MKP A;  4AT7 B;  4JLX A;  4NXX A;  4LEV A;  4O67 A;  4AT8 A;  4LEY A;  4OAH A;  4K99 A;  4AT7 A;  4K98 A;  4LEW A;  4LEZ A;  4KM5 A;  4ATB B;  4K8V A;  4K96 A;  4K9A A;  4K97 A;  4ATB A;  4KB6 A;  4OAF A;  4AT9 B;  4OAG A;  4JLZ A;  4O68 A;  4O69 A; 
#chains in the Genus database with same CATH topology
 4M2Y A;  5CA7 A;  4X4S A;  5DB9 A;  3C5F A;  4MF2 A;  5J2E A;  8ICO A;  8ICP A;  3MGH A;  4PH5 A;  4UBC A;  2P66 A;  5IIJ A;  9ICT A;  2B51 A;  4M0A A;  2PFO A;  3B0X A;  8ICU A;  2DR7 A;  5B3Q A;  4QZE A;  2FMP A;  3UQ2 A;  4M9L A;  2GA9 D;  3JPS A;  1XSP A;  1VJ7 A;  2ZHA A;  5DBB A;  9ICA A;  4R65 A;  5CR0 A;  4MFA A;  3ISB A;  4X4O A;  4X0B A;  2BBJ A;  8ICZ A;  4M04 A;  4O9M A;  4MF8 A;  1ZQX A;  4K98 A;  3B0Y A;  9ICE A;  4RPX A;  1MIW A;  1MIY A;  4K9A A;  4EBJ A;  1UEV A;  4PHD A;  4PGX A;  8ICM A;  4RQ8 A;  4WC4 A;  1ZQT A;  4X4U A;  5DKW A;  5J0U A;  3UXN A;  2RFF A;  2DVI A;  4KLT A;  1Q78 A;  5J0O A;  2BE3 A;  4O6A A;  4TUP A;  2ISO A;  2BCS A;  5J0Y A;  8ICW A;  4JLX A;  4NXX A;  4WC7 A;  2BPG A;  4PHE A;  4EBK A;  4UD4 A;  3WFP A;  5CHE A;  7ICN A;  4M9N A;  2B4V A;  1PX5 A;  7ICE A;  1BPY A;  3WFS C;  1UEU A;  3NYB A;  4KB6 A;  5JTG A;  4OAG A;  4O68 A;  4I2A A;  4KLM A;  5HRI A;  5DB7 A;  1ZQQ A;  5D46 A;  3AQM A;  2M2W A;  8ICX A;  4KLS A;  3C66 A;  1ZJM A;  2O1P A;  7ICR A;  4UB3 A;  4FO1 A;  2IHO A;  4UB5 A;  5J2F A;  3PHZ A;  4P2H A;  1YLQ A;  5J2D A;  4XRH A;  9ICB A;  5DEC A;  3PML A;  3CK6 A;  4K99 A;  4UAZ A;  4YCX A;  4R64 A;  4M47 A;  4Z6C A;  8ICF A;  4R63 A;  3JPN A;  5B3P A;  1TV9 A;  9ICF A;  7ICO A;  3UQ0 A;  2BCV A;  1HUO A;  4IQW A;  4HX0 A;  5J29 A;  9ICV A;  4F5Q A;  9ICO A;  4X0A A;  4NXV A;  4YMN A;  5DB6 A;  4WQK A;  2ZH7 A;  4GXI A;  5HRH A;  3LK9 A;  1NOM A;  2FMS A;  9ICI A;  2HHP A;  4F5R A;  2M2V A;  2HN2 A;  3HJ4 A;  4PHP A;  1JN3 A;  4QZ9 A;  3V7K A;  1TFY A;  3NWI A;  3MCR A;  1R8B A;  4LEW A;  4K8V A;  4IQT A;  5CFT A;  4QZB A;  4X4Q A;  1TFW A;  2FMQ A;  1ZQW A;  2W9M A;  4AT9 B;  3C5G A;  3OVS A;  1V4A A;  2PBE A;  3V7J A;  5D4B A;  1JMS A;  7ICK A;  4NXT A;  5J0X A;  1ZQE A;  4WBZ A;  3TFS A;  3OV7 A;  4EED A;  2Q66 A;  5CHG A;  4FH3 A;  8ICB A;  4QZH A;  4I2B A;  5D49 A;  5HHI A;  3H37 A;  4FHY A;  4PPX A;  3ER8 C;  2ZH1 A;  4RQ4 A;  4FO6 A;  2PFQ A;  1KDH A;  4AT7 A;  4RQ7 A;  4DOA A;  3JYY A;  2BCQ A;  4KLO A;  7ICT A;  3OUY B;  4ATB B;  4GXJ A;  4TUQ A;  4WC6 A;  3C18 A;  4M5D A;  5J2H A;  2DR8 A;  4Z6F A;  4QZC A;  5HRD A;  4KLL A;  9ICS A;  4I2E A;  4Z6E A;  9ICG A;  4OAF A;  1BPB A;  1UET A;  1MIV A;  4O69 A;  4LVS A;  4WC3 A;  7ICG A;  4NLZ A;  3V72 A;  5CFU A;  3RJI A;  1ZQO A;  4X4R A;  4LEV A;  4F5P A;  3OVA A;  4LEY A;  5IIL A;  4MFF A;  4JWM A;  5J2K A;  3AQL A;  5J0W A;  9ICM A;  5HRK A;  4YMM A;  5J2G A;  4K4I A;  4UAW A;  5HC9 A;  1ZJN A;  8ICA A;  5BPC A;  2ZHB A;  4XQ7 A;  4NY8 A;  2BPF A;  1JAJ A;  4I2H A;  4JLZ A;  3MGI A;  5J2I A;  3NKU A;  1ZQM A;  4RQ6 A;  3AQK A;  2PXI A;  2PFP A;  4WOY A;  4UB2 A;  8ICT A;  4DOC A;  5J0T A;  5J0P A;  3UPQ A;  5CFS A;  3JCF A;  5J0R A;  4I2G A;  7ICM A;  4E80 A;  4KLI A;  1RZT A;  3PMN A;  1ZQG A;  4DOB A;  5EOZ A;  4RPY A;  4EGW A;  5J2J A;  7ICL A;  4IQV A;  2DR5 A;  5CJ7 A;  2ZH3 A;  8ICJ A;  4KLJ A;  1ZQH A;  4WCW A;  2IUB A;  5CP2 A;  8ICN A;  3H39 A;  3TFR A;  4K9B A;  7ICV A;  4NLN A;  3AU6 A;  2PFN A;  4XUS A;  1ZQK A;  4QZA A;  4FHP A;  4MKP A;  4S3N A;  1GPJ A;  1ZQR A;  1ZQA A;  5BOM A;  4OAH A;  1ZQB A;  2ZH6 A;  2ZH8 A;  4KM5 A;  4X4N A;  4WC2 A;  1BPX A;  1ZQU A;  9ICR A;  1TVA A;  8ICG A;  3OVB A;  7ICH A;  2ZH9 A;  3LQC B;  3RH4 A;  1BPE A;  4NXZ A;  5J0Q A;  4AT8 B;  4X4T A;  9ICH A;  3C2K A;  1MQ3 A;  8ICY A;  5HRG A;  4I2C A;  4UAY A;  8ICK A;  3RH5 A;  2IHM A;  4N7R A;  4MFC A;  4XA5 A;  4RWQ A;  5HRB A;  8ICE A;  4TUR A;  4DO9 A;  4K96 A;  4WC1 A;  9ICW A;  5BOL A;  4I27 A;  3HW8 A;  3ERC C;  5D62 A;  3GDX A;  4IQU A;  1ZQN A;  5HRL A;  4IG8 A;  1FA0 A;  3UXP A;  2BPC A;  4I28 A;  2ZH2 A;  3MDC A;  2HN1 A;  3V7L A;  4AT7 B;  2DR9 A;  4P4O A;  4YN4 A;  1HUZ A;  1KEJ A;  3RJH A;  3RJF A;  8ICR A;  4I2D A;  3MDA A;  3EF2 A;  1ZQI A;  1ZQD A;  1XSL A;  4FHV A;  5III A;  4P4P A;  3JPR A;  4F5N A;  7ICQ A;  4E7X A;  3NVO A;  4E8F A;  4AT9 A;  4M9G A;  4F5O A;  2GAF D;  5DBA A;  4RWP A;  2I9G A;  2M2U A;  3H38 A;  4I2I A;  4RQ3 A;  4O5K A;  4KLU A;  3AUO A;  4LZD A;  1ZQP A;  4NM1 A;  8ICV A;  4NKT A;  2ISP A;  9ICN A;  3OWG A;  2DRA A;  3RJK A;  2FCL A;  4NM2 A;  2BCR A;  3JPP A;  5DBC A;  9ICJ A;  5J2B A;  7ICI A;  1R89 A;  4NLK A;  4JWN A;  5J2C A;  4K97 A;  5IIM A;  4KLD A;  3OUY A;  4ATB A;  2M2T A;  1NO5 A;  8ICC A;  1ZQY A;  3HIY A;  8ICS A;  5HHH A;  4I0U A;  1BPD A;  2VAN A;  4WC5 A;  7ICS A;  4UB1 A;  4PGQ A;  2DRB A;  4RPZ A;  1BPZ A;  9ICL A;  4QZG A;  8ICH A;  4WQL A;  4O67 A;  4M9J A;  7ICP A;  9ICX A;  5IIN A;  2BBH A;  3K75 D;  5IIK A;  4Z6D A;  2EWR A;  4WBY A;  9ICU A;  5HR9 A;  3HWT A;  3L9D A;  3PNC A;  3UPS A;  3H3A A;  4LT6 A;  5HRF A;  4GXK A;  3RJG A;  3AU2 A;  1OU5 A;  1XSN A;  4QZ8 A;  1R8A A;  4X4V A;  4P4M A;  4YD2 A;  5DB8 A;  2B56 A;  9ICQ A;  4PHA A;  4I2F A;  4NXU A;  3RH6 A;  7ICJ A;  3HJ1 A;  5CB1 A;  5J0S A;  4R66 A;  4FH5 A;  2ID1 A;  5J2A A;  4EV6 A;  4QZD A;  3HX0 A;  4FHX A;  4UB4 A;  2ZH4 A;  3AQN A;  4LEZ A;  2O5A A;  3K7D A;  1ZQZ A;  1VFG A;  3JPQ A;  4KLQ A;  4X5V A;  4YD1 A;  3RJE A;  8ICQ A;  4UBB A;  3C2M A;  1MQ2 A;  4WH5 A;  1ZQV A;  3ISD A;  3JZ0 A;  4EP7 A;  1ZQC A;  4RT3 A;  4KLE A;  3WFO A;  5D61 A;  5F2V O;  5D63 A;  4QZF A;  4PGY A;  4XQ8 A;  4KLG A;  2ZH5 A;  4KLH A;  7ICU A;  3ISC A;  4X4P A;  1JQR A;  4O5C A;  4RQ1 A;  4RWO A;  4I2J A;  2BCU A;  4RT2 A;  4K4G A;  5DED A;  4RQ5 A;  8ICL A;  7ICF A;  4RWN A;  4XJE A;  1KNY A;  4M9H A;  4UD5 A;  9ICC A;  4OAI Z;  2NRK A;  4FHW A;  3UXO A;  4NXW A;  3WFR E;  8ICI A;  2GWS A;  1RPL A;  9ICP A;  4QZI A;  1Q79 A;  4WC0 A;  4RQ2 A;  3MBY A;  4K4H A;  3JPO A;  1ZQS A;  5TZV A;  3RJJ A;  4AT8 A;  4TUS A;  4YMO A;  4O5E A;  1ZQL A;  3ER9 B;  1ZQF A;  5IIO A;  1R8C A;  3C2L A;  5CWR A;  5HRE A;  1ZQJ A;  4NKU A;  4KLF A;  1F5A A;  3JPT A;  4RQ0 A;  1WOT A;  3OGU A;  9ICK A;  3WFQ E;  5DDM A;  4EEB A;  4I29 A;  4LZG A;  5DDY A; 
#chains in the Genus database with same CATH homology
 4HX0 A;  4K9B A;  4X4S A;  4NXV A;  4FHP A;  4MKP A;  2ZH7 A;  2DRB A;  1GPJ A;  4WQK A;  4WQL A;  4O67 A;  2HHP A;  4OAH A;  3HJ4 A;  2ZH6 A;  2ZH8 A;  2EWR A;  1TFY A;  3MCR A;  2B51 A;  1R8B A;  4LEW A;  4KM5 A;  4K8V A;  4LT6 A;  4X4N A;  5CFT A;  2DR7 A;  4X4Q A;  5B3Q A;  1TFW A;  3OVB A;  4AT9 B;  3OVS A;  1R8A A;  2ZH9 A;  2GA9 D;  4X4V A;  2B56 A;  4NXT A;  2ZHA A;  4AT8 B;  4X4T A;  3OV7 A;  4NXU A;  2Q66 A;  4FH3 A;  3HJ1 A;  4X4O A;  4FHY A;  3ER8 C;  2ZH1 A;  4FH5 A;  4N7R A;  4FHX A;  4AT7 A;  4K98 A;  2ZH4 A;  4LEZ A;  3OUY B;  4ATB B;  4K96 A;  3K7D A;  4K9A A;  4M5D A;  1UEV A;  2DR8 A;  3ERC C;  5D62 A;  4X4U A;  4OAF A;  2DVI A;  1FA0 A;  1UET A;  4O69 A;  1Q78 A;  4WH5 A;  2ZH2 A;  4O6A A;  5CFU A;  4EP7 A;  4AT7 B;  4X4R A;  4JLX A;  2DR9 A;  4NXX A;  4LEV A;  3OVA A;  4LEY A;  5D61 A;  5D63 A;  2ZH5 A;  4X4P A;  4UD4 A;  5CHE A;  3EF2 A;  2B4V A;  4FHV A;  2ZHB A;  1UEU A;  3NYB A;  4KB6 A;  4E7X A;  4OAG A;  4JLZ A;  4O68 A;  3NKU A;  4E8F A;  4XJE A;  4UD5 A;  4OAI Z;  4FHW A;  4AT9 A;  4NXW A;  2GAF D;  3C66 A;  2O1P A;  4WOY A;  4FO1 A;  2IHO A;  1Q79 A;  3PHZ A;  4AT8 A;  4NKT A;  5CFS A;  4K99 A;  3OWG A;  2DRA A;  4E80 A;  3ER9 B;  1R8C A;  2FCL A;  4NKU A;  1R89 A;  1F5A A;  5B3P A;  4K97 A;  2DR5 A;  3OUY A;  4ATB A;  2ZH3 A;  3HIY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...