4NXXA

Crystal structure of the cytosolic domain of human mid51
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
325
structure length
325
Chain Sequence
MSLQEKLLTYYRNRAAIPAGEQARAKQAAVDICAELRSFLRAKLPDMPLRDMYLSGSLYDDLQVVTADHIQLIVPLVLEQNLWSCIPGEDTIMNVPGFFLVRRENRGSSYWDRCVVGGYLSPKTVADTFEKVVAGSINWPAIGSLLDYVIRPAPPPEALTLEVQYERDKHLFIDFLPSVTLGDTVLVAKPHRLAQYDNLWRLSLRPAETARLRALDQADSGCRSLCLKILKAICKSTPALGHLTASQLTNVILHLAQEEADWSPDMLADRFLQALRGLISYLEAGVLPSALNPKVNLFAELTPEEIDELGYTLYCSLSEPEVLLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondrial dynamic protein MID51
publication title Structural and functional analysis of MiD51, a dynamin receptor required for mitochondrial fission.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 107
structure length 325
sequence length 325
ec nomenclature
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03281 Mab-21 Mab-21 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.40 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain Poly(a)-polymerase, middle domain 4nxxA01
3.30.460.90 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 4nxxA02
4LEWA 4KB6A 4LEYA 4O67A 4O6AA 4K98A 4AT7A 4OAGA 4AT9B 4NXUA 4K99A 4JLXA 4AT8B 4OAHA 4O68A 4O69A 4K9AA 4K96A 4NXWA 4NXXA 4AT9A 4ATBB 4NXTA 4LEZA 4NXVA 4JLZA 4KM5A 4OAFA 4WOYA 4AT8A 4OAIZ 4K97A 4K8VA 4K9BA 4AT7B 4MKPA 4LEVA 4ATBA
chains in the Genus database with same CATH superfamily
1XSLA 5DBCA 3EF2A 3OUYB 4KLEA 4E80A 8ICVA 5J0SA 4AT7A 3JPTA 1XSNA 4FO1A 3NKUA 3H37A 4N7RA 1XSPA 5HRDA 7ICMA 8ICTA 4NXWA 5D63A 1R8BA 8ICMA 3L9DA 8ICCA 2FMPA 4GXIA 3ER8C 4QZ9A 4LZDA 2ZH9A 3PHZA 9ICPA 3AQLA 4XA5A 5CR0A 2PXIA 5J2KA 4KLGA 5CP2A 9ICRA 4K4HA 4TURA 4PPXA 4E8FA 3V7JA 4NLNA 4R63A 5J0RA 9ICMA 7ICTA 1ZQZA 4UD5A 1ZQVA 4RWQA 4JLXA 1ZQJA 4PHAA 4PH5A 4QZDA 4M9HA 3HX0A 5J0PA 2DR9A 9ICTA 3UXOA 4IG8A 4KM5A 4WOYA 4Z6EA 3ER9B 4F5PA 2RFFA 3MCRA 4Z6CA 9ICUA 5DEDA 5J0WA 1ZQGA 4O6AA 4UAWA 2B51A 5J29A 1TVAA 4UAZA 5D46A 8ICWA 4KLFA 2IUBA 4F5QA 4AT8B 1PX5A 1TFYA 5DB8A 4UBCA 4O5CA 1BPZA 3H38A 3RH5A 9ICBA 3GDXA 3UQ0A 4QZ8A 4KLQA 3OV7A 1ZQKA 3NVOA 8ICFA 5HHHA 4P4PA 4RPYA 5IILA 1KEJA 1YLQA 4LZGA 3AU6A 4EGWA 4AT7B 1JAJA 4QZCA 5IIOA 4WC6A 5CA7A 4O67A 4I2CA 7ICFA 3LQCB 4FHPA 4NXUA 1RPLA 5DECA 5CFSA 3OVAA 5CWRA 4K9AA 8ICZA 4MF2A 4QZGA 1R8AA 4KLIA 4AT9A 1ZQUA 8ICEA 4X4NA 1BPBA 4RT3A 3C5GA 4TUQA 3RH6A 9ICCA 3RJEA 4FHXA 2HN2A 5HRFA 4UB4A 4LEVA 4M47A 5J0YA 5J2EA 1MQ3A 1ZQMA 4QZFA 3MDCA 3JPNA 4NKUA 4NLKA 4I29A 4UB1A 4F5NA 8ICLA 4RQ0A 8ICOA 4QZBA 4EEBA 3C5FA 2BBHA 5HREA 4P4MA 3RJHA 2DRAA 4KLUA 5HRIA 7ICJA 9ICSA 4WC0A 5J0OA 1FA0A 2IHMA 8ICJA 2GA9D 4GXJA 9ICVA 1KNYA 3JPQA 2GWSA 1KDHA 4XUSA 1WOTA 9ICNA 5D61A 2HHPA 4NM1A 2BCRA 7ICSA 1TFWA 3PMLA 1ZJNA 8ICYA 4WBYA 4PHDA 2FMQA 3C66A 4FHYA 1GPJA 4XJEA 4R65A 3JYYA 4WQLA 4YCXA 7ICHA 3B0YA 2DVIA 2ZH1A 3UXNA 1V4AA 9ICOA 4X4PA 4K97A 4LT6A 2HN1A 3B0XA 3WFOA 4RPXA 2ZH6A 4EBKA 5DDYA 3RJFA 8ICHA 4NKTA 4X5VA 4KLTA 2DR8A 4AT9B 8ICQA 9ICLA 4RT2A 7ICNA 4O69A 1JMSA 3OGUA 4RWNA 4F5RA 4YD1A 5J2CA 3WFRE 4M04A 4O9MA 3OVSA 2W9MA 4I0UA 4PHPA 4K8VA 2ZH8A 1ZQCA 2Q66A 1BPEA 4MFAA 5CFTA 1RZTA 4YN4A 3ERCC 1UEUA 5CHEA 1ZQBA 4X4OA 4EEDA 2PFQA 3JPRA 4IQTA 1MQ2A 4QZEA 4FO6A 2BCUA 4YMNA 7ICLA 8ICSA 4RQ1A 5J2JA 3UPSA 5BPCA 2M2WA 1Q79A 1Q78A 5HRGA 4OAIZ 4K9BA 9ICHA 2BPCA 2BCSA 3JPSA 3AQMA 4WC2A 1ZQPA 4KLHA 4P4OA 4MFFA 4DOBA 5J2FA 2P66A 2ID1A 4EP7A 3RJJA 7ICOA 1JQRA 3HJ1A 3HIYA 7ICQA 4KLSA 4GXKA 3NWIA 3WFPA 4K96A 4I2DA 5DB6A 4JWNA 1VFGA 2FMSA 4NXZA 7ICEA 5BOLA 4WBZA 4LEZA 4Z6DA 5J2GA 3MGHA 3MGIA 4MF8A 4RQ6A 5D62A 5HRLA 2ISPA 4S3NA 5J0TA 5HRHA 1UEVA 4Z6FA 7ICVA 3LK9A 3ISCA 3MDAA 4I2FA 2DR7A 5J2HA 4I2BA 4I2HA 4K98A 8ICXA 4JWMA 4RQ7A 5IIKA 3UPQA 1ZQFA 4FHVA 4X4UA 3H39A 3NYBA 4O68A 4X4VA 4I28A 1ZQYA 4RQ8A 5DKWA 5HC9A 2O5AA 4WC1A 4R66A 2VANA 4NXVA 4JLZA 3WFSC 1UETA 4FH3A 5J0XA 5J2IA 2BCQA 2B4VA 3H3AA 4LEYA 4EBJA 3UQ2A 9ICQA 4DOAA 2BCVA 4YD2A 5J2AA 4M2YA 4LVSA 4XRHA 5BOMA 2BPFA 4RQ5A 5CFUA 7ICPA 4X0AA 1BPYA 5IIJA 4ATBB 3AU2A 4KLDA 4M9JA 4FH5A 5TZVA 4RWPA 5CB1A 2ZH3A 5J0QA 4X4RA 2ZHAA 7ICUA 7ICGA 4P2HA 4KLOA 3UXPA 4IQWA 7ICRA 4NM2A 1R8CA 2NRKA 3TFRA 4PGYA 1ZQQA 4I27A 1MIVA 3JPPA 1ZJMA 1ZQTA 5HRBA 4I2GA 5D49A 1MIWA 5CHGA 5DBAA 4K99A 3ISBA 2M2VA 1ZQHA 4I2IA 4M0AA 2M2TA 2M2UA 4KLMA 5JTGA 8ICPA 4YMOA 4K4GA 4PGXA 2BPGA 4UD4A 4X4QA 1BPXA 8ICAA 2ISOA 4M9LA 4X4TA 2IHOA 2PFOA 3TFSA 2ZHBA 4HX0A 4RWOA 4MKPA 3AUOA 3V7KA 3RH4A 2DR5A 2ZH4A 2ZH7A 2EWRA 3K75D 5HHIA 3C2LA 5IINA 4X0BA 3C18A 4DOCA 8ICRA 4OAHA 9ICKA 8ICUA 5F2VO 9ICFA 2I9GA 4NXXA 4EV6A 2O1PA 5J2BA 4TUPA 5B3PA 5DBBA 4YMMA 5CJ7A 4MFCA 3JZ0A 4WH5A 1ZQWA 1F5AA 3PMNA 2FCLA 5HR9A 1JN3A 4IQUA 4K4IA 3MBYA 4ATBA 8ICGA 2PFPA 4IQVA 4XQ8A 4M5DA 1MIYA 4UB5A 3HJ4A 4UBBA 4OAGA 4WCWA 3ISDA 5D4BA 3RJIA 5DB9A 4UB3A 4KLLA 1ZQAA 4WC3A 4RQ2A 4XQ7A 4RQ4A 3OUYA 3PNCA 5IIMA 1ZQEA 3K7DA 1ZQSA 1R89A 1NOMA 1VJ7A 9ICEA 4NXTA 3C2MA 8ICNA 1ZQXA 3OWGA 1BPDA 1ZQRA 3WFQE 4UAYA 3JPOA 2DRBA 2B56A 3OVBA 4PHEA 3AQKA 9ICJA 3AQNA 3JCFA 1TV9A 4UB2A 4R64A 4QZAA 4E7XA 4WC4A 1ZQNA 4I2JA 4X4SA 2BBJA 3V7LA 1HUZA 3V72A 4O5KA 2PFNA 4TUSA 1ZQLA 4NY8A 1HUOA 4M9NA 3RJGA 1OU5A 4NLZA 2PBEA 4OAFA 3RJKA 2ZH2A 5HRKA 1ZQOA 8ICBA 5DB7A 9ICWA 4M9GA 4KLJA 8ICIA 4LEWA 7ICKA 9ICIA 4KB6A 1ZQDA 4O5EA 1ZQIA 7ICIA 9ICGA 5J0UA 2BE3A 4PGQA 3HW8A 4FHWA 1NO5A 4I2AA 2ZH5A 5J2DA 3CK6A 4QZHA 4RPZA 8ICKA 5EOZA 5B3QA 4WC7A 9ICAA 3HWTA 4AT8A 4WQKA 4F5OA 3C2KA 5DDMA 2GAFD 4QZIA 4RQ3A 4WC5A 5IIIA 9ICXA 4I2EA 4DO9A
chains in the Genus database with same CATH topology
2ZH4A 2ZH7A 2EWRA 4EP7A 3OUYB 3EF2A 4E80A 3HJ1A 4AT7A 3HIYA 4NKUA 4FO1A 3NKUA 4OAHA 4N7RA 4K96A 4NXWA 4NXXA 5D63A 2O1PA 1R8BA 5B3PA 2DRAA 4LEZA 3ER8C 4WH5A 1FA0A 1F5AA 2ZH9A 2FCLA 2GA9D 3PHZA 5D62A 1UEVA 5D61A 4ATBA 2HHPA 2DR7A 1TFWA 4M5DA 4K98A 4E8FA 3HJ4A 4OAGA 4FHVA 4UD5A 4X4UA 3C66A 4JLXA 3NYBA 4O68A 4FHYA 4X4VA 1GPJA 4XJEA 2DR9A 3OUYA 4WQLA 3K7DA 1R89A 2DVIA 4NXTA 2ZH1A 4NXVA 4JLZA 4KM5A 1UETA 4WOYA 3OWGA 4X4PA 4FH3A 4LT6A 4K97A 2ZH6A 2DRBA 2B56A 3OVBA 3ER9B 2B4VA 3MCRA 4NKTA 4LEYA 4O6AA 2B51A 2DR8A 4AT9B 4E7XA 4X4SA 4AT8B 4O69A 1TFYA 5CFUA 3OV7A 4ATBB 4FH5A 4OAFA 3OVSA 2ZH2A 2ZH3A 4K8VA 2ZH8A 4X4RA 2ZHAA 2Q66A 5CFTA 4AT7B 3ERCC 1UEUA 5CHEA 4LEWA 4X4OA 1R8CA 4KB6A 4O67A 4FHPA 4NXUA 4FHWA 4K99A 5CFSA 3OVAA 4K9AA 2ZH5A 1R8AA 4AT9A 1Q79A 4UD4A 4X4QA 1Q78A 5B3QA 4X4NA 4AT8A 4OAIZ 4K9BA 4WQKA 4X4TA 2IHOA 2GAFD 2ZHBA 4HX0A 4MKPA 4FHXA 2DR5A 4LEVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LEW A;  4KB6 A;  4LEY A;  4O67 A;  4O6A A;  4K98 A;  4AT7 A;  4OAG A;  4AT9 B;  4NXU A;  4K99 A;  4JLX A;  4AT8 B;  4OAH A;  4O68 A;  4O69 A;  4K9A A;  4K96 A;  4NXW A;  4NXX A;  4AT9 A;  4ATB B;  4NXT A;  4LEZ A;  4NXV A;  4JLZ A;  4KM5 A;  4OAF A;  4WOY A;  4AT8 A;  4OAI Z;  4K97 A;  4K8V A;  4K9B A;  4AT7 B;  4MKP A;  4LEV A;  4ATB A; 
#chains in the Genus database with same CATH topology
 1XSL A;  5DBC A;  3EF2 A;  3OUY B;  4KLE A;  4E80 A;  8ICV A;  5J0S A;  4AT7 A;  3JPT A;  1XSN A;  4FO1 A;  3NKU A;  3H37 A;  4N7R A;  1XSP A;  5HRD A;  7ICM A;  8ICT A;  4NXW A;  5D63 A;  1R8B A;  8ICM A;  3L9D A;  8ICC A;  2FMP A;  4GXI A;  3ER8 C;  4QZ9 A;  4LZD A;  2ZH9 A;  3PHZ A;  9ICP A;  3AQL A;  4XA5 A;  5CR0 A;  2PXI A;  5J2K A;  4KLG A;  5CP2 A;  9ICR A;  4K4H A;  4TUR A;  4PPX A;  4E8F A;  3V7J A;  4NLN A;  4R63 A;  5J0R A;  9ICM A;  7ICT A;  1ZQZ A;  4UD5 A;  1ZQV A;  4RWQ A;  4JLX A;  1ZQJ A;  4PHA A;  4PH5 A;  4QZD A;  4M9H A;  3HX0 A;  5J0P A;  2DR9 A;  9ICT A;  3UXO A;  4IG8 A;  4KM5 A;  4WOY A;  4Z6E A;  3ER9 B;  4F5P A;  2RFF A;  3MCR A;  4Z6C A;  9ICU A;  5DED A;  5J0W A;  1ZQG A;  4O6A A;  4UAW A;  2B51 A;  5J29 A;  1TVA A;  4UAZ A;  5D46 A;  8ICW A;  4KLF A;  2IUB A;  4F5Q A;  4AT8 B;  1PX5 A;  1TFY A;  5DB8 A;  4UBC A;  4O5C A;  1BPZ A;  3H38 A;  3RH5 A;  9ICB A;  3GDX A;  3UQ0 A;  4QZ8 A;  4KLQ A;  3OV7 A;  1ZQK A;  3NVO A;  8ICF A;  5HHH A;  4P4P A;  4RPY A;  5IIL A;  1KEJ A;  1YLQ A;  4LZG A;  3AU6 A;  4EGW A;  4AT7 B;  1JAJ A;  4QZC A;  5IIO A;  4WC6 A;  5CA7 A;  4O67 A;  4I2C A;  7ICF A;  3LQC B;  4FHP A;  4NXU A;  1RPL A;  5DEC A;  5CFS A;  3OVA A;  5CWR A;  4K9A A;  8ICZ A;  4MF2 A;  4QZG A;  1R8A A;  4KLI A;  4AT9 A;  1ZQU A;  8ICE A;  4X4N A;  1BPB A;  4RT3 A;  3C5G A;  4TUQ A;  3RH6 A;  9ICC A;  3RJE A;  4FHX A;  2HN2 A;  5HRF A;  4UB4 A;  4LEV A;  4M47 A;  5J0Y A;  5J2E A;  1MQ3 A;  1ZQM A;  4QZF A;  3MDC A;  3JPN A;  4NKU A;  4NLK A;  4I29 A;  4UB1 A;  4F5N A;  8ICL A;  4RQ0 A;  8ICO A;  4QZB A;  4EEB A;  3C5F A;  2BBH A;  5HRE A;  4P4M A;  3RJH A;  2DRA A;  4KLU A;  5HRI A;  7ICJ A;  9ICS A;  4WC0 A;  5J0O A;  1FA0 A;  2IHM A;  8ICJ A;  2GA9 D;  4GXJ A;  9ICV A;  1KNY A;  3JPQ A;  2GWS A;  1KDH A;  4XUS A;  1WOT A;  9ICN A;  5D61 A;  2HHP A;  4NM1 A;  2BCR A;  7ICS A;  1TFW A;  3PML A;  1ZJN A;  8ICY A;  4WBY A;  4PHD A;  2FMQ A;  3C66 A;  4FHY A;  1GPJ A;  4XJE A;  4R65 A;  3JYY A;  4WQL A;  4YCX A;  7ICH A;  3B0Y A;  2DVI A;  2ZH1 A;  3UXN A;  1V4A A;  9ICO A;  4X4P A;  4K97 A;  4LT6 A;  2HN1 A;  3B0X A;  3WFO A;  4RPX A;  2ZH6 A;  4EBK A;  5DDY A;  3RJF A;  8ICH A;  4NKT A;  4X5V A;  4KLT A;  2DR8 A;  4AT9 B;  8ICQ A;  9ICL A;  4RT2 A;  7ICN A;  4O69 A;  1JMS A;  3OGU A;  4RWN A;  4F5R A;  4YD1 A;  5J2C A;  3WFR E;  4M04 A;  4O9M A;  3OVS A;  2W9M A;  4I0U A;  4PHP A;  4K8V A;  2ZH8 A;  1ZQC A;  2Q66 A;  1BPE A;  4MFA A;  5CFT A;  1RZT A;  4YN4 A;  3ERC C;  1UEU A;  5CHE A;  1ZQB A;  4X4O A;  4EED A;  2PFQ A;  3JPR A;  4IQT A;  1MQ2 A;  4QZE A;  4FO6 A;  2BCU A;  4YMN A;  7ICL A;  8ICS A;  4RQ1 A;  5J2J A;  3UPS A;  5BPC A;  2M2W A;  1Q79 A;  1Q78 A;  5HRG A;  4OAI Z;  4K9B A;  9ICH A;  2BPC A;  2BCS A;  3JPS A;  3AQM A;  4WC2 A;  1ZQP A;  4KLH A;  4P4O A;  4MFF A;  4DOB A;  5J2F A;  2P66 A;  2ID1 A;  4EP7 A;  3RJJ A;  7ICO A;  1JQR A;  3HJ1 A;  3HIY A;  7ICQ A;  4KLS A;  4GXK A;  3NWI A;  3WFP A;  4K96 A;  4I2D A;  5DB6 A;  4JWN A;  1VFG A;  2FMS A;  4NXZ A;  7ICE A;  5BOL A;  4WBZ A;  4LEZ A;  4Z6D A;  5J2G A;  3MGH A;  3MGI A;  4MF8 A;  4RQ6 A;  5D62 A;  5HRL A;  2ISP A;  4S3N A;  5J0T A;  5HRH A;  1UEV A;  4Z6F A;  7ICV A;  3LK9 A;  3ISC A;  3MDA A;  4I2F A;  2DR7 A;  5J2H A;  4I2B A;  4I2H A;  4K98 A;  8ICX A;  4JWM A;  4RQ7 A;  5IIK A;  3UPQ A;  1ZQF A;  4FHV A;  4X4U A;  3H39 A;  3NYB A;  4O68 A;  4X4V A;  4I28 A;  1ZQY A;  4RQ8 A;  5DKW A;  5HC9 A;  2O5A A;  4WC1 A;  4R66 A;  2VAN A;  4NXV A;  4JLZ A;  3WFS C;  1UET A;  4FH3 A;  5J0X A;  5J2I A;  2BCQ A;  2B4V A;  3H3A A;  4LEY A;  4EBJ A;  3UQ2 A;  9ICQ A;  4DOA A;  2BCV A;  4YD2 A;  5J2A A;  4M2Y A;  4LVS A;  4XRH A;  5BOM A;  2BPF A;  4RQ5 A;  5CFU A;  7ICP A;  4X0A A;  1BPY A;  5IIJ A;  4ATB B;  3AU2 A;  4KLD A;  4M9J A;  4FH5 A;  5TZV A;  4RWP A;  5CB1 A;  2ZH3 A;  5J0Q A;  4X4R A;  2ZHA A;  7ICU A;  7ICG A;  4P2H A;  4KLO A;  3UXP A;  4IQW A;  7ICR A;  4NM2 A;  1R8C A;  2NRK A;  3TFR A;  4PGY A;  1ZQQ A;  4I27 A;  1MIV A;  3JPP A;  1ZJM A;  1ZQT A;  5HRB A;  4I2G A;  5D49 A;  1MIW A;  5CHG A;  5DBA A;  4K99 A;  3ISB A;  2M2V A;  1ZQH A;  4I2I A;  4M0A A;  2M2T A;  2M2U A;  4KLM A;  5JTG A;  8ICP A;  4YMO A;  4K4G A;  4PGX A;  2BPG A;  4UD4 A;  4X4Q A;  1BPX A;  8ICA A;  2ISO A;  4M9L A;  4X4T A;  2IHO A;  2PFO A;  3TFS A;  2ZHB A;  4HX0 A;  4RWO A;  4MKP A;  3AUO A;  3V7K A;  3RH4 A;  2DR5 A;  2ZH4 A;  2ZH7 A;  2EWR A;  3K75 D;  5HHI A;  3C2L A;  5IIN A;  4X0B A;  3C18 A;  4DOC A;  8ICR A;  4OAH A;  9ICK A;  8ICU A;  5F2V O;  9ICF A;  2I9G A;  4NXX A;  4EV6 A;  2O1P A;  5J2B A;  4TUP A;  5B3P A;  5DBB A;  4YMM A;  5CJ7 A;  4MFC A;  3JZ0 A;  4WH5 A;  1ZQW A;  1F5A A;  3PMN A;  2FCL A;  5HR9 A;  1JN3 A;  4IQU A;  4K4I A;  3MBY A;  4ATB A;  8ICG A;  2PFP A;  4IQV A;  4XQ8 A;  4M5D A;  1MIY A;  4UB5 A;  3HJ4 A;  4UBB A;  4OAG A;  4WCW A;  3ISD A;  5D4B A;  3RJI A;  5DB9 A;  4UB3 A;  4KLL A;  1ZQA A;  4WC3 A;  4RQ2 A;  4XQ7 A;  4RQ4 A;  3OUY A;  3PNC A;  5IIM A;  1ZQE A;  3K7D A;  1ZQS A;  1R89 A;  1NOM A;  1VJ7 A;  9ICE A;  4NXT A;  3C2M A;  8ICN A;  1ZQX A;  3OWG A;  1BPD A;  1ZQR A;  3WFQ E;  4UAY A;  3JPO A;  2DRB A;  2B56 A;  3OVB A;  4PHE A;  3AQK A;  9ICJ A;  3AQN A;  3JCF A;  1TV9 A;  4UB2 A;  4R64 A;  4QZA A;  4E7X A;  4WC4 A;  1ZQN A;  4I2J A;  4X4S A;  2BBJ A;  3V7L A;  1HUZ A;  3V72 A;  4O5K A;  2PFN A;  4TUS A;  1ZQL A;  4NY8 A;  1HUO A;  4M9N A;  3RJG A;  1OU5 A;  4NLZ A;  2PBE A;  4OAF A;  3RJK A;  2ZH2 A;  5HRK A;  1ZQO A;  8ICB A;  5DB7 A;  9ICW A;  4M9G A;  4KLJ A;  8ICI A;  4LEW A;  7ICK A;  9ICI A;  4KB6 A;  1ZQD A;  4O5E A;  1ZQI A;  7ICI A;  9ICG A;  5J0U A;  2BE3 A;  4PGQ A;  3HW8 A;  4FHW A;  1NO5 A;  4I2A A;  2ZH5 A;  5J2D A;  3CK6 A;  4QZH A;  4RPZ A;  8ICK A;  5EOZ A;  5B3Q A;  4WC7 A;  9ICA A;  3HWT A;  4AT8 A;  4WQK A;  4F5O A;  3C2K A;  5DDM A;  2GAF D;  4QZI A;  4RQ3 A;  4WC5 A;  5III A;  9ICX A;  4I2E A;  4DO9 A; 
#chains in the Genus database with same CATH homology
 2ZH4 A;  2ZH7 A;  2EWR A;  4EP7 A;  3OUY B;  3EF2 A;  4E80 A;  3HJ1 A;  4AT7 A;  3HIY A;  4NKU A;  4FO1 A;  3NKU A;  4OAH A;  4N7R A;  4K96 A;  4NXW A;  4NXX A;  5D63 A;  2O1P A;  1R8B A;  5B3P A;  2DRA A;  4LEZ A;  3ER8 C;  4WH5 A;  1FA0 A;  1F5A A;  2ZH9 A;  2FCL A;  2GA9 D;  3PHZ A;  5D62 A;  1UEV A;  5D61 A;  4ATB A;  2HHP A;  2DR7 A;  1TFW A;  4M5D A;  4K98 A;  4E8F A;  3HJ4 A;  4OAG A;  4FHV A;  4UD5 A;  4X4U A;  3C66 A;  4JLX A;  3NYB A;  4O68 A;  4FHY A;  4X4V A;  1GPJ A;  4XJE A;  2DR9 A;  3OUY A;  4WQL A;  3K7D A;  1R89 A;  2DVI A;  4NXT A;  2ZH1 A;  4NXV A;  4JLZ A;  4KM5 A;  1UET A;  4WOY A;  3OWG A;  4X4P A;  4FH3 A;  4LT6 A;  4K97 A;  2ZH6 A;  2DRB A;  2B56 A;  3OVB A;  3ER9 B;  2B4V A;  3MCR A;  4NKT A;  4LEY A;  4O6A A;  2B51 A;  2DR8 A;  4AT9 B;  4E7X A;  4X4S A;  4AT8 B;  4O69 A;  1TFY A;  5CFU A;  3OV7 A;  4ATB B;  4FH5 A;  4OAF A;  3OVS A;  2ZH2 A;  2ZH3 A;  4K8V A;  2ZH8 A;  4X4R A;  2ZHA A;  2Q66 A;  5CFT A;  4AT7 B;  3ERC C;  1UEU A;  5CHE A;  4LEW A;  4X4O A;  1R8C A;  4KB6 A;  4O67 A;  4FHP A;  4NXU A;  4FHW A;  4K99 A;  5CFS A;  3OVA A;  4K9A A;  2ZH5 A;  1R8A A;  4AT9 A;  1Q79 A;  4UD4 A;  4X4Q A;  1Q78 A;  5B3Q A;  4X4N A;  4AT8 A;  4OAI Z;  4K9B A;  4WQK A;  4X4T A;  2IHO A;  2GAF D;  2ZHB A;  4HX0 A;  4MKP A;  4FHX A;  2DR5 A;  4LEV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...