4PHEA

Structure of human dna polymerase beta complexed with t in the template base paired with incoming non-hydrolyzable gtp
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
329
structure length
325
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title The spontaneous base substitution mechanisms of human DNA polymerase beta
rcsb
source organism Homo sapiens
molecule tags Transferase,lyase/dna
total genus 107
structure length 325
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2014-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4pheA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4pheA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4pheA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4pheA03
1XSLA 2IHNA 2ASJA 2ZH7A 8ICWA 4UAWA 4RT3A 8ICSA 5CB1A 4RNMA 1L3VA 3V7KA 4CCHA 3M9NB 7ICRA 4I2FA 1ZQPA 3ZD9A 4F4YA 2Y1JA 3OJUA 2F1HA 5HRBA 2DFLA 5J0TA 3RB4A 3H37A 4IQVA 5DBBA 2M2WA 1NKBA 5HMLA 5IIKA 3BQ0A 3QEAZ 1ZQWA 4O3RA 3C18A 3C1ZA 4Q8EA 4E7XA 4Q45A 3T5LA 2FPKA 3M9MB 4R8UB 4I27A 3QEBZ 3TI0A 8ICMA 4EBDA 1S10A 1TK8A 4KLFA 2BCQA 3IHQB 3OSNA 4KMUA 3AUOA 5HRHA 1NK7A 1ZQVA 4PHAA 2XO7A 1WOTA 3PW5A 2PFNA 2DRAA 4J9RA 2VA3A 5KFVA 4YMNA 4JUZA 1C7YA 2W9BB 1ZQRA 2VA2A 2ZJAA 4BXOA 1D8LA 8ICXA 5KFEA 3PW4A 2PXIA 3BJYA 5KFTA 1TFWA 4Z6CA 1S0NA 5KTQA 5EWGA 2P66A 9ICXA 4ATBB 4LZGA 5KG4A 2IMWP 3TFSA 3MR5A 1NJYA 3OVBA 4ED3A 5F9LA 2W9AA 4XA5A 1TFYA 4F4WA 4IRCA 1X9SA 4IRDA 5KFQA 1ZQUA 1A76A 2XGQA 2ALZA 1S9FA 4R63A 4YP3A 4WC6A 3SYZA 1BGXT 3C1YA 1KFTA 1WCNA 4EBEA 3HPOA 3UPQA 3GIKA 4K4HA 4B9TA 3EWAA 4FHXA 4MF8A 4F2SA 3EPGA 2HHWA 4WBYA 5KFAA 3G6VA 1SZPA 5D49A 5J0XA 3C23A 5CHGA 4DQRA 2BPFA 7ICQA 2JEFA 4GXIA 4NM1A 5BPCA 2V4RA 2R8HA 2LYHA 2HW3A 1TAUA 1T7PA 2FPMA 3MDCA 4KTQA 2F1JA 9ICUA 3WFQE 3THVA 1JX4A 2DR9A 5J0RA 2KN7A 4YMOA 4R65A 4IQWA 2BCVA 5DLFA 4UB4A 2Q66A 4JV1A 3OHAA 4GLXA 5DDMA 3WFSC 4PPXA 3MGIA 1TFRA 4FHVA 4PHPA 4I2GA 3H38A 2V9WA 4RT2A 2W8LA 4QZAA 1Z3EB 3MR2A 3SZ2A 5HRGA 1A77A 2M9NA 4BWMA 5HNKA 4YMMA 2HVHA 2IBKA 9ICCA 1VFGA 1CEZA 2I1QA 4YD2A 3C21A 2BQUA 4F2RA 1KEJA 1XO1A 2C2DA 2FLNA 5EWEA 4QZ8A 4PHDA 3T5JA 4I2BA 4FS1A 4DL3A 5DB7A 1QSSA 4KLSA 3K75D 3RBDA 3B0XA 7ICKA 4XRHA 4E8FA 4IRKA 4UQGA 4QWDA 3HX0A 1QLNA 5KFZA 9ICVA 5HC9A 4R64A 3MFIA 4UB2A 3JPQA 2GWSA 1ZQEA 3RJKA 1B43A 4B9VA 3OGUA 1MC8A 3AQLA 3GIJA 4GC7A 2DPIA 5KFBA 3RJGA 3OUYA 2NRVA 5DLGA 8ICFA 1B22A 5HRDA 2BE3A 4J9QA 4YR2A 5TZVA 1ZQKA 4F4KA 3H8SA 3HW8A 2DPJA 8ICYA 3MABA 3KHHA 1S0MA 3MDAA 4ECUA 1Z00A 3RRHA 4M2YA 3AQMA 4NXZA 5DGBA 3NGDA 3RJHA 5KT3A 4J9NA 4DFKA 4AT8A 2ISPA 4I2EA 1NK0A 4QZBA 1MSWD 3BQ1A 9ICEA 5KFRA 2NRTA 3C5GA 2HHVA 7ICEA 9ICGA 2XGPA 5KFJA 5J0WA 1ZQYA 4X5VA 1U4BA 3QE9Y 1L3SA 1ZQIA 2VA8A 1ZQJA 1ZQFA 4DSIA 9ICPA 2AQ0A 3T3FA 4FH3A 1LV5A 3RB0A 4LT6A 3LDAA 3Q8QB 5KFKA 4KLEA 4YR0A 3LQCB 4DFPA 5F9NA 3BQ2A 5DG9A 2BR0A 7ICNA 4KLDA 3OJSA 9ICKA 3NTUA 4I28A 3TQ1A 5KFCA 2ZTEA 4M04A 4YR3A 4XQ7A 1XC9A 2C2EA 3GV8B 4PGXA 3RJJA 8ICBA 5L1IA 1S76D 4ELVA 2HHUA 4DL2A 2Y1IA 1XSPA 4KN7A 3PV8A 4WC7A 4X0BA 3RR7A 4QZFA 4DQQA 5KG7A 7ICMA 4Z6FA 3UXPA 4QW9A 4DFMA 2V4QA 3PW0A 4DF8A 2ZH5A 4DLEA 3H4BA 4EP7A 3ZDCA 4M9JA 3ISBA 8ICAA 5KFUA 4RQ5A 3EZ5A 2DRBA 4O3PA 5C5JA 4BDPA 3UQ0A 4JWNA 2IHMA 3V6JA 3OUYB 3RAQA 4DL5A 1JQRA 4RQ7A 2FPLA 5D4BA 2W9CB 2W8KA 2HHXA 2JEJA 5DKWA 1ZYQA 5DQIA 5DQHA 4FHYA 3ZD8A 4KLOA 4RWOA 3GFKB 2NRZA 5J0SA 9ICIA 9ICRA 4AT7B 4C8OA 1D9DA 1ZQMA 3PO5A 8ICJA 1KFSA 1SL0A 2MUTA 4NLZA 3G6YA 4PGYA 5HHIA 4M47A 4UAYA 3G6XA 5KFDA 2W9MA 3HT3A 4NKUA 2P6RA 4MFFA 4RUCA 3RR8A 3QZ7A 1UEUA 4YCXA 1UEVA 5IILA 3WFRE 3MR3A 1HUOA 1KLNA 1D9FA 4F5OA 5KFMA 3FYHA 2J6SA 9ICLA 1WCLA 2HVIA 2KP7A 4RWNA 2BQRA 3PMNA 4FHWA 1NO5A 1NJXA 1ZQAA 9ICNA 3C66A 1X2IA 4B9SA 1VJ7A 3RB6A 3E2EA 3UXOA 4DOCA 4PH5A 4UD4A 1S0OA 4NLKA 4O3NA 4ED6A 2XY6A 4EEYA 2JEIA 4NM2A 2XCAA 1K1QA 4M6WB 4ELUA 2UVUA 8ICEA 2M2TA 1Q79A 4WC1A 4WC4A 4XUSA 5J2FA 3MFHA 5J0OA 2NRXA 4X4UA 2A1JA 3GDXA 3GV7B 5KFWA 9ICWA 2HHPA 5JUMA 4WC0A 4RQ8A 1DK3A 1ZQBA 1SL1A 2JZBA 4RQ6A 1UA1A 8ICUA 5IIJA 2F1IA 5J29A 4O3OA 4UB1A 1JAJA 5KFPA 4KLMA 4F92B 1BVSA 1NKCA 3PVXA 4DSEA 2ZH8A 3TAQA 4AT9A 4RPYA 2BGWA 3KHRA 2MUTB 4QWEA 4EYHB 3TANA 1NK5A 4TQSA 3JPPA 1PZNA 4O3QA 5KG2A 2PI4A 4FBUA 4EZ6A 4KLTA 2ZUBA 3K4GA 5KFSA 5CA7A 4FO6A 4F5NA 4EBJA 4DL7A 4ECWA 3OSPA 1JN3A 4RNOA 4DSLA 3V7JA 4IQTA 4O9MA 1MIYA 3SV4A 2RFFA 1NZPA 1UA0A 4DS5A 4BXOB 4NLGA 3C2MA 2FLLA 4QW8A 8ICQA 3LWLA 5L1JA 4IR9A 1Q78A 1JXLA 1ZQHA 4C8MA 2BQ3A 4QZHA 4YFKA 3Q8PB 9ICSA 1BNPA 4RUAA 1QSYA 8ICCA 2P6UA 4RQ0A 2RDJA 9ICQA 4UD5A 1U45A 4DEZA 2ZH3A 5J2GA 3WFPA 4IG8A 1L5UA 3H40A 3T5KA 4M9LA 3PY8A 4RU9A 4ECZA 3JPSA 5KT5A 3UQ2A 4YVZA 3RJIA 5J2KA 2IA6A 7ICPA 3OV7A 4ED1A 5J2IA 1ZQTA 9ICOA 5J0YA 5DB8A 2ZJ8A 4RWQA 4ECYA 5BOLA 4ED2A 3GV5B 2XY7A 3RBEA 5CP2A 2JZBB 3OHBA 4ECTA 4X4PA 4XQ8A 4RQ2A 1IM4A 3ORYA 4TUSA 2ISOA 1L3TA 4X4OA 5J0UA 3M8RA 5J2AA 1H38A 1AROP 4O3SA 1U47A 4RNNA 1N56A 1SKRA 1KSPA 4TURA 4GC6A 1KFDA 1ZQGA 4PHEA 4J9PA 2AGOA 3MGHA 3EPIA 3TAPA 2C28A 1LB2B 1XSNA 1FA0A 4WC3A 2XY5A 4QZGA 4P4PA 3PX6A 2PFOA 2ZHBA 5HREA 3ISCA 4MEXA 5KFFA 4P2HA 2FMSA 2HHQA 4C8LA 3GIMA 3TFRA 1BPXA 8ICHA 4K4IA 3H8WA 5KG5A 5J2JA 5J2DA 4F5QA 3RTVA 1TK5A 9ICMA 1F5AA 2FMPA 1UT5A 5J2EA 2ZH6A 4R8UA 4UAZA 1IXRA 4DOAA 3BQTA 1NJZA 3ZDBA 3OVAA 5F2VO 3FDSA 2ZH1A 1UT8A 1T3NA 4KLGA 1BPDA 2BPCA 5J0QA 1S77D 2M2UA 4S3NA 5KG0A 4YXJA 4Q8FA 7ICSA 4I2DA 2J6TA 3IM1A 4NKTA 2HHSA 4RPXA 2VANA 2W9BA 4LZDA 1CUKA 5DB6A 4IR1A 1Y88A 4ECSA 2J6UA 4RQ3A 5IIIA 4J9MA 4ED0A 7ICOA 9ICJA 2BCSA 2KZMA 1PX5A 2XCPA 1XU4A 3RJEA 4ECQA 5KFHA 3RAXA 4DSJA 7ICGA 4I29A 1Z00B 5DBCA 2ATLA 5HRLA 4FH5A 4I2HA 4PGQA 4ATBA 3UXNA 9ICTA 5DEDA 7ICTA 2KFNA 2ZTCA 4AT8B 1ZJNA 3KHLA 4UB3A 4WC5A 1TKDA 2AJQA 9ICAA 4LVSA 2O1PA 2ZJ5A 2R8KA 1R8CA 9ICFA 3HJ4A 2ZH2A 8ICVA 2KZ3A 4YN4A 2O5AA 1HJPA 3PR4A 1RPLA 3OVSA 4F50A 1QSLA 4DF4A 4RQ1A 1EXNA 5IIOA 5J2CA 3PX4A 2R8GA 1RXVA 4KITB 2AQ4A 5IINA 5D46A 2R8IA 4NY8A 3V6KA 1ZQNA 5KFLA 5DG8A 8ICRA 4F5RA 4Q44A 1S97A 1U48A 3N97B 2FLPA 4M0AA 4FHPA 3QZ8A 1JMSA 3H8JA 3PO4A 4K4GA 4I2CA 4Z6EA 4JWMA 7ICUA 4X4NA 1NK8A 5L1KA 4DSFA 1SKSA 3HIYA 2ZH9A 3PR5B 3HJ1A 1KDHA 8ICLA 3H7IA 5HRKA 1R8BA 4E80A 5J0PA 7ICVA 3MBYA 1KNYA 1N48A 2NRWA 4DO9A 3TARA 3Q8LA 3RH5A 3Q8SB 5KT6A 3PW7A 1SKWA 5CR0A 2I9GA 2AU0A 4F3OA 4RWPA 3C5FA 5IIMA 1ZJMA 4DQPA 5HHHA 4MF2A 1TV9A 4RZRA 1ZQZA 4I2AA 1T8EA 3M9OB 4F91B 8ICNA 1R8AA 4G3IA 3M8SA 3ZDAA 4KLIA 4X4QA 4X4VA 2KZZA 5CJ7A 4DLGA 3MR6A 2ASLA 4YXMA 4M9GA 4I2IA 3GIIA 4KLJA 4DS4A 2ZHAA 2UVWA 3RRGA 5DGAA 4O5KA 2ZUCA 1MIVA 5HRFA 4QZIA 4NLNA 2ZUDA 4WC2A 9ICBA 4GXJA 5HMMA 2WTFA 3L9DA 4X4SA 2DR5A 1BPYA 5KFYA 4YG2A 4KN4A 3RB3A 1ZQQA 4DQSA 1RYRA 2OWOA 4B9LA 4RQ4A 1X9WA 3JPOA 3RJFA 1RZTA 8ICOA 2M2VA 1YLQA 2NRKA 1T4GA 1HUZA 2BCUA 1NKEA 5KFGA 8ICGA 2AGPA 2AGQA 4Q43A 2BDPA 4J9LA 4ED7A 8ICIA 4X0AA 1V9PA 2KTQA 5DB9A 2RDIA 4EBKA 3JZ0A 5EWFA 4I2JA 5DBAA 4JV2A 1TK0A 2MAXA 4MFCA 4YD1A 4MEYA 1ZQDA 4F8RA 1NOMA 1BPEA 1DGSA 3ZDEA 3H3AA 1ZQSA 4X4TA 4J9OA 4UBBA 4TUPA 4GXKA 4FBTA 1S0VA 4F4XA 2FMQA 4J9SA 2UVRA 4QZCA 5HR9A 3V72A 4ECRA 5HRIA 4RPZA 3SV3A 5DECA 3H39A 4M9HA 1JIHA 3RH4A 1MIWA 4F4ZA 1U9LA 4C8KA 1KTQA 3BDPA 3AU2A 5KFIA 3GILA 3GQCA 1NK4A 1TVAA 2A1JB 4QZDA 2C2RA 1SL2A 4X4RA 7ICFA 3LK9A 2KFZA 1NJWA 7ICJA 4P4MA 4QZEA 1DOQA 1BNOA 3AQKA 1JXEA 2ASDA 1ZQXA 4F5PA 4M5DA 4WBZA 1DK2A 2B21A 4QWBA 3C2LA 4JK1A 4P4OA 4Z6DA 1XWLA 5EOZA 4TQRA 4ED8A 3T5HA 1RXWA 1L3UA 4KLHA 1QTMA 4UB5A 5J2BA 4O5CA 5KG6A 1MQ3A 4DWIA 1TAQA 2Q0ZX 4DL6A 8ICZA 2PFPA 3ZDDA 4ZH4A 5KT7A 5BOMA 2XC9A 3KHGA 5L9XA 4DFJA 4AT9B 3PMLA 3ETLA 5KFXA 1K1SA 5KFNA 3JPNA 3C2KA 3RH6A 1UETA 4KLQA 2PBEA 5KT4A 3AU6A 4EZ9A 4EBCA 4C8NA 4O5EA 2W9CA 4IQUA 5KG1A 3V6HA 1BPBA 4DQIA 4O0IA 1R89A 2BCRA 2DR7A 1ZQCA 3PW2A 4R66A 4FS2A 4BWJA 9ICHA 2BHNA 2HHTA 1NK9A 7ICIA 4AT7A 4KLLA 3JPRA 2ID1A 3H4DA 2PI5A 4ELTA 1X9MA 3WFOA 5KT2A 4BGDA 5KFOA 3SI8A 2DR8A 2C22A 3Q8RB 4DSKA 4F93B 5CWRA 3PX0A 2BPGA 2PFQA 4TUQA 5DG7A 2BKEA 4JV0A 4ECXA 1D8YA 7ICLA 2ZTDA 2H5XA 5DQGA 4DL4A 3JYYA 4QWCA 4WCWA 3UPSA 3EYZA 4HYKA 1OU5A 3JPTA 3PNCA 7ICHA 3NYBA 5KG3A 1KRPA 1ZQLA 2R8JA 3ISDA 3AQNA 3Q8KA 4B9MA 4QWAA 3Q8MA 3N4MB 1BPZA 3B0YA 1MQ2A 4UBCA 5L1LA 5DDYA 4EYIB 4DOBA 4ECVA 2UVVA 4B9UA 1COOA 4MFAA 4J9KA 2DVIA 1RYSA 4QZ9A 3HWTA 1ZETA 2JEGA 4B9NA 4M9NA 1NK6A 2ZH4A 1ZQOA 4M6WA 4KLUA 5J2HA 4E0DA 3HP6A 3V7LA 3LWMA 1XS9D 8ICKA 8ICPA 1U49A 1V4AA 5HP4A 4YQWA 8ICTA 3EW9A 3KTQA
chains in the Genus database with same CATH superfamily
2MRLA 3KBBA 8ICSA 5CB1A 7ICRA 2WF8A 1QQ6A 1ZQPA 3ZD9A 2D8CA 3OJUA 5F3XB 1UCVA 2IUBA 5J0TA 4QIWC 4IQVA 2M2WA 5AKJA 4O3RA 3CYMA 3C1ZA 4Q45A 3T5LA 3M9MB 4R8UB 3QEBZ 1O08A 2YMMA 3QU2A 2XO7A 2PFNA 1Z1BA 4YMNA 1ZQRA 2VA2A 1JUDA 1RQNA 5KFTA 2ESEA 9ICXA 5KTQA 2JH7A 2DBYA 1NJYA 3OVBA 2W9AA 4IRDA 5KFQA 1A76A 1ZD4A 1BGXT 1KFTA 1WCNA 2RLTA 2I5HA 3GIKA 3EWAA 4F2SA 5KFAA 5D49A 7ICQA 3KKAC 4X0BA 2K8BB 2R8HA 2HW3A 3MDCA 1L7PA 3SAGA 4R65A 2KN7A 3VCBA 4IQWA 2Q4TA 2Q66A 2DUYA 4GLXA 3WFSC 3MGIA 1KQQA 4I2GA 3NWIA 4RT2A 3MR2A 1Z3EB 5HRGA 1DXSA 2KJ5A 4BWMA 1LKYA 2ZXHA 4IC9A 4UB8U 3C21A 2BQUA 4F2RA 1JRPA 5T14A 4I2BA 1QSSA 3RBDA 1Z4NA 7ICKA 3SENA 9ICVA 1X9XA 5KFZA 5HC9A 4R64A 4UB2A 1ZQEA 2EDUA 5KFBA 1GO3F 5DLGA 1B22A 2BE3A 2KHQA 3DV9A 4O68A 5AKLA 4GFJA 2B51A 3MABA 3MDAA 1N5XA 3AQMA 5DGBA 2E3TA 2PMZC 4DFKA 4I2EA 1NK0A 1MSWD 3BQ1A 3C5GA 7ICEA 1PK1A 2O6KA 5J0WA 1ZQYA 1ZQIA 4FH3A 1ZQFA 1LV5A 4LT6A 1L7NA 3LQCB 4YR0A 3IDWA 5DG9A 3NTUA 3A0BU 4XQ7A 1XC9A 3GV8B 2Y1IA 1XSPA 4KN7A 2JRZA 4MHVA 7ICMA 4DFMA 3PW0A 2V4QA 4PZNA 2EZYA 3H4BA 3PSIA 2F76X 3ISBA 4RQ5A 1N61A 3V6JA 4RQ7A 2FPLA 4C4TA 2HHXA 1IV8A 3HKZF 4RWOA 2NRZA 9ICIA 2YQEA 2EZZA 1ZQMA 1KFSA 1NZBA 4NLZA 1QQ5A 3G6YA 4M47A 2W9MA 3RR8A 2ZIUB 5AI0A 4F5OA 2J6SA 4O3MA 3PMNA 1ZQAA 2BBHA 2KIWA 4PH5A 1OUQA 1M6YA 4ED6A 1OW5A 4WC4A 5J0OA 5JUMA 4WJ3B 4OAIZ 5AKHA 1UA1A 3ERCC 5J29A 2GO7A 1HEKA 4F92B 4RPYA 3ONNA 2MUTB 2EAPA 3KFUF 1PZNA 2DR9A 4FO6A 3UMBA 4QNLA 4DL7A 4EX7A 4ECWA 1JN3A 3OSPA 2QLTA 3SV4A 4UARA 4BXOB 1S5LU 3C2MA 2FLLA 3WK9A 2GAFD 5EE9A 4C8MA 1BNPA 1ED1A 2M0NA 1A6SA 2HOQA 3ALRA 3C29A 5J2GA 2DGZA 2ODGA 4RU9A 4ECZA 3UQ2A 7ICPA 1ZQTA 5J0YA 2ZJ8A 4AP9A 4RWQA 1SIJA 5BOLA 5KL8B 3OHBA 3N28A 4TUSA 1L3TA 5J2AA 1H38A 2KIVA 1N56A 3IG5A 4O3SA 3BS7A 4PHEA 2HDOA 2XY5A 3PX6A 5KFFA 1ZD3A 5ALVA 4C8LA 1BPXA 2KHVA 3H8MA 8ICHA 4K4IA 1TK5A 2IOFA 4K8VA 3LVWA 4R8UA 2K4EA 5KAIU 1FFVA 2M2UA 4S3NA 4YXJA 1SZHA 4Q8FA 1KKXA 4NL9A 4RPXA 3QUCA 5DB6A 1Y88A 3LYSA 5IIIA 7ICOA 4OAHA 3AM9A 2KZMA 4C4SA 1XU4A 7ICGA 1Z00B 2ATLA 1S8OA 3WKDA 5DEDA 9ICTA 7ICTA 1ZJNA 4NJ8A 1TKDA 4LVSA 2O1PA 2ZH2A 2O5AA 1HJPA 5CFTA 4F50A 3NVOA 2AQ4A 5IINA 8ICRA 3V6KA 1ZQNA 5B3PA 5DG8A 2K4HA 4Q44A 2FLPA 3QZ8A 4LEZA 4I2CA 4Z6EA 4X4NA 1SWWA 3MC1A 2K8AA 2W43A 2ZH9A 3PR5B 3H7IA 4US9A 1SGGA 1ZXIA 2NRWA 3ETRA 4RWPA 1ZJMA 4MF2A 4RZRA 1ZQZA 1R8AA 1T8EA 3M9OB 4G3IA 2F2AB 3ZDAA 1Q46A 1VJ5A 4DLGA 4M9GA 2B6GA 4I2IA 3ZI4A 2UVWA 4N7RA 2ZUCA 3WK6A 4NLNA 2WTFA 2DKXA 4KN4A 4CF5A 1ZQQA 2OWOA 2M2VA 3JPOA 2JMGA 2NRKA 2AGPA 4Q43A 4J9LA 3JZ0A 4CF4A 4JB3A 2W3RA 5DBAA 1Q3VA 2G07A 4DCCA 2MAXA 1ZOLA 2QKQA 4F8RA 3F2CA 1DGSA 5EE3A 1Z19A 4TUPA 1S0VA 4F4XA 2FMQA 4U6PA 3F2DA 4QZCA 2FCLA 3V72A 1URJA 5HRIA 3SV3A 3SAHA 2W3SA 1JIHA 1Q3UA 4C8KA 3GQCA 1TVAA 2A1JB 4QZDA 2C2RA 3LK9A 2JH1A 2YY6A 4QZEA 1ZRMA 4M5DA 2B21A 4TQRA 1XWLA 1JALA 1TAQA 5CHEA 4FZNA 4DL6A 8ICZA 3PSTA 1FO4A 3ZDDA 1COKA 1XO0A 5KFXA 3JPNA 1OXJA 3C2KA 1WG8A 4EV6A 1K5OA 5KT4A 4WQLA 4DQIA 1BPBA 1R89A 3UMCA 2BHNA 1X9MA 3WFOA 4F93B 5EE0A 2PFQA 5DG7A 2BKEA 4JV0A 4ECXA 2ZIUA 5FP0A 4CE6A 3PNCA 4Y2JA 3JPTA 7ICHA 5KG3A 1KRPA 3NYBA 1CRXA 1BPZA 1SWVA 4EYIB 5DDYA 4DOBA 4ECVA 4MFAA 2DVIA 1RYSA 2JEGA 4B9NA 4M9NA 5D61A 2QB1A 3HP6A 1Q8KA 1XSLA 2ZH7A 2ASJA 5ALGA 4RNMA 2QB0B 2HBLA 3M9NB 2ZIXB 4P0PB 4LEYA 2AH5A 1KW4A 2F1HA 2EQYA 1NKBA 5IIKA 4F71A 3C18A 2Y0SC 4Q8EA 4UAUA 4FFDA 8ICMA 5AM3A 4EBDA 1S10A 4FZLA 5HRHA 3AUOA 3NVYA 4PHAA 1Z4OA 2E5SA 2ZXIA 2ZJAA 1A0PA 4BXOA 1D8LA 5KFEA 2KKPA 3GZFA 3BJYA 2BBJA 3UM9A 1S0NA 2NO5A 5EWGA 2P66A 2W04A 3MR5A 4ED3A 3L4PA 4F4WA 4IRCA 4F72A 2W11A 4R63A 4YP3A 3SYZA 3C1YA 3D2QA 3HPOA 3KD3A 1WYGA 1DRGA 4K4HA 4B9TA 4FHXA 4MF8A 4WBYA 3G6VA 1SZPA 2WHEA 3QU9A 4DQRA 2JEFA 4NM1A 5BPCA 2OH2A 1T7PA 3WFQE 4J03A 2H3VA 1TFRA 3H38A 2W8LA 1A77A 2M9NA 5HNKA 4YMMA 1VFGA 2IBKA 1CEZA 3HJEA 4K96A 4YD2A 1KEJA 4C4RA 2FLNA 5DB7A 2K4IA 4XRHA 2RHFA 5B5EU 4QWDA 1B43A 3OGUA 3GIJA 4O69A 1ZD5A 4YR2A 1RQLA 5TZVA 4F4KA 3H8SA 3HW8A 2KICA 1NI3A 4ECUA 1Z00A 4M2YA 2YMLA 4NXZA 2FJ6A 5KT3A 5AM5A 2E1FA 9ICEA 5KFJA 3WKCA 1U4BA 3PSFA 3LDAA 3Q8QB 2BR0A 4NWIA 7ICNA 2CXYA 3TACB 4WOYA 2ZTEA 4M04A 2LBOA 3K7DA 5CEHA 2C2EA 8ICBA 1S76D 5L1IA 1V85A 2KNJA 1B0XA 1J97A 3NS1A 4Z6FA 2YTUA 4DF8A 2ZH5A 4DLEA 1PVRA 3IRUA 4M9JA 5B66U 1YZ6A 3D2SA 2DRBA 4IL6U 1C20A 4K9BA 3OUYB 4DL5A 2CN1A 2KVSA 2JEJA 1ZYQA 4LJXA 1VLBA 5J0SA 3PO5A 1SL0A 5HHIA 5KFDA 2P6RA 4RUCA 1MN8A 2HI0A 1UEVA 5G5HA 5IILA 3NRZA 3WFRE 1HUOA 5HR7A 3FYHA 1WCLA 1X6JA 2BQRA 1NO5A 4NXXA 3KZIU 1ZQ1C 5K4LA 4UD4A 2YB1A 3BS5B 2JEIA 2XCAA 4ELUA 4WC1A 2UVUA 1Q79A 5J2FA 3MFHA 4X4UA 2A1JA 3GV7B 2HHPA 2F8LA 2EANA 1DK3A 2W7PA 5IIJA 1XNSA 2WF7A 2H3FA 2WAQF 5AICA 5ALUA 1NKCA 5H2FU 4DSEA 1NK5A 3CW2C 4TQSA 3JPPA 2K8CB 5KG2A 4EZ6A 2KSOA 5KFSA 4EBJA 1YT3A 1D8BA 4O9MA 3V7JA 1NZPA 4OAGA 5C0YA 2BQ3A 3Q8PB 4RUAA 4UD5A 4RQ0A 2ZH3A 4DEZA 3AMZA 3T5KA 5J2IA 2DF4B 4ECYA 2JZBB 3ORYA 2ISOA 4X4OA 1V97A 5J0UA 3M8RA 3T79A 3NKUA 1KSPA 4Y2PA 1ZQGA 2G5IB 1LB2B 2QB0A 3TAPA 1FA0A 2ZIXA 4P4PA 4P0PA 5HREA 4MEXA 4P2HA 4KMOB 5AHXA 3H8WA 5J2JA 9ICMA 3N7PD 3RTVA 2HMXA 2FMPA 4UAZA 3ZDBA 3IV6A 1T3NA 5AKKA 7ICSA 4NKTA 3IM1A 3C28A 4IR1A 1X66A 2HN1A 2K89A 4DSJA 4ECQA 5KFHA 3PZPA 3K1ZA 2D3DA 4AT8B 2ZTCA 3KHLA 4QIWF 1FIQA 1R8CA 3HJ4A 8ICVA 3QU5A 2Y9UA 1QSLA 3PX4A 1EXNA 5IIOA 5J2CA 3F5AA 4I0UA 4NY8A 4F5RA 1S97A 3N97B 4K4GA 2WF9A 4JWMA 4OJ5A 1ECWA 8ICLA 1R8BA 2HN2A 5J0PA 7ICVA 3MBYA 2I9GA 4NLBA 3Q8SB 5KT6A 2ES6A 1LVHA 4KLIA 4X4QA 3CK6A 3SR6A 2KZZA 5CJ7A 2ASLA 3GIIA 1J2MA 3RRGA 4O5KA 1X42A 1MIVA 4FZMA 2GLEA 1FFUA 5HMMA 2DR5A 3L9DA 2IOHA 3RB3A 4DQSA 4B9LA 8ICOA 4RQ4A 1RZTA 1TE2A 4X0AA 1V9PA 2RDIA 4EGWA 1RYUA 4I2JA 1KBUA 4JV2A 5KAFU 4MFCA 3WK7A 1NOMA 4PZOA 3ZDEA 1ZQSA 1T3QA 3FAHA 4UBBA 1IG6A 3ER9B 4CRXA 4RQMA 4ECRA 3H39A 5AKGA 2QARA 3RH4A 3GILA 3WKBA 1SL2A 4NL9C 1NJWA 7ICJA 1ZD2P 4P4MA 3EUB2 5L1MA 3SD7A 4QWBA 3C2LA 4JK1A 1L3UA 4Z6DA 1AQ6A 5J2BA 3I28A 5KG6A 2PMZF 3J81j 4DWIA 2Q0ZX 3AQEA 4ZH4A 2XC9A 4AT9B 4OJPA 1ZRNA 3ETLA 2PBEA 3N7SC 4JMUA 4EZ9A 2BZFA 4IQUA 5EE1A 3V6HA 1N62A 1ZQCA 3PW2A 9ICHA 1NK9A 3AN1A 3CRXA 4ELTA 2OEHA 5KT2A 4BGDA 3SI8A 2C22A 3Q8RB 2FDRA 5JU5A 4TUQA 2A1AA 1D8YA 2ZTDA 5DQGA 3EYZA 4HYKA 3U26A 3Q8KA 4QWAA 2MU2A 3HRDD 2UVVA 4B9UA 1COOA 4QZ9A 3HWTA 1ZETA 4E0DA 3V7LA 1XS9D 8ICKA 1U49A 1V4AA 4YQWA 1WWUA 8ICTA 5GTHU 2IHNA 4EEDA 4RT3A 4CCHA 3V7KA 2OYYA 2MSNA 4G9BA 3H0MB 4F4YA 2CRXA 3RB4A 2EZXA 5HMLA 3QEAZ 3BQ0A 2W55A 4E7XA 2VKQA 4I27A 3H0RB 3IHQB 1NK7A 1ZQVA 1WOTA 2DRAA 3PW5A 2G5HB 4J9RA 2VA3A 5KFVA 1PUZA 2W9BB 8ICXA 3PW4A 2PXIA 3SEIA 4Z6CA 4EEBA 4ATBB 4LZGA 4UASA 2IMWP 3TFSA 5F9LA 2HCFA 1WUDA 1X9SA 2K4PA 2ALZA 1PVPA 3BQ7A 1IIPA 4EBEA 3OWGA 2YMPA 4Y2QA 2KG5A 5J0XA 3C23A 4GXIA 3I76A 1TAUA 2FPMA 4KTQA 3THVA 1JX4A 5J0RA 4YMOA 4OO1J 2BCVA 3D2NA 4BJQA 1B4FA 5DDMA 3WU2U 4FHVA 4PHPA 4QZAA 1F44A 3WKAA 2HVHA 2CPRA 2LPEA 2I1QA 1XO1A 1T94A 2C2DA 5EWEA 4QZ8A 4PHDA 4DL3A 3D6JA 3B0XA 5AIBA 3S6JA 4UQGA 4B9VA 1MC8A 3AQLA 4OCZA 3RJGA 4UB6U 2NRVA 4J9QA 4KX5A 1ZQKA 3QXGA 8ICYA 4C80A 3KHHA 3RRHA 3NGDA 3RJHA 2IHOA 2A19A 4J9NA 4AT8A 2KOBA 3QU4A 2NRTA 2HHVA 4OD0A 3QE9Y 9ICPA 2VA8A 4DSIA 3RB0A 3OPXA 3VC8A 3WK5A 5KFKA 4KLEA 5F9NA 1NNLA 9ICKA 1L7MA 5AI4A 3OJSA 4OAFA 3TQ1A 2DL0A 3RJJA 1UQVA 2HHUA 2WFAA 3RR7A 5KG7A 2F44A 3ZDCA 2ZIWB 5KFUA 2EAOA 3EZ5A 3M7DA 2WF6A 2WB1C 5C5JA 3UQ0A 4AYBC 2G08A 1JQRA 1WWVA 2W8KA 5DQHA 4KLOA 3GFKB 4UW9A 3SMVA 9ICRA 8ICJA 3OTQA 2MUTA 2KK0A 4PGYA 4UAYA 1UEUA 4YCXA 2GOLA 1DGJA 2OM6A 5AI5A 1D9FA 5KFMA 2KP7A 2OXOA 2HVIA 4FHWA 2I6XA 2XICA 1VJ7A 3RB6A 3E2EA 3QUBA 3UXOA 3RF9A 5KL1B 4EEYA 4NM2A 8ICEA 2M2TA 2YN4A 4HX0A 5AI8A 4OJOA 4BX9C 3GDXA 9ICWA 2KJ8A 4RQ8A 3WKEA 4RQ6A 8ICUA 5ALIA 4UB1A 4JLZA 3NUQA 2NV3A 4KLMA 4C0ZA 3PVXA 4AT9A 1HIWA 5ALWA 4O3QA 3K4GA 1L6NA 3AL0B 4DSLA 4RNOA 3TADC 1UA0A 5CRXA 3QX7A 8ICQA 3LWLA 4A8EA 4K9AA 5L1JA 1JXLA 4YFKA 4K97A 3QUQA 1QSYA 9ICQA 5AM2A 2EAMA 3WFPA 4PL1A 3H40A 4X4RA 1F5AA 5KT5A 5J2KA 3OV7A 2RP5A 4ED1A 4Y2YA 9ICOA 3GV5B 2XY7A 5CP2A 4ECTA 3NVWA 4X4PA 4P0QB 1Z1VA 2LM1A 3QUTA 5ALOA 4RNNA 4HAIA 3TADA 2PFOA 2LHTA 3ISCA 3O0FA 4KM5A 5ALEA 3TKAA 3TFRA 2GH1A 5KG5A 3AQFA 1IXRA 4DOAA 3BQTA 1NJZA 5F2VO 2VJ4A 3DDHA 1BPDA 2BPCA 4Y2RA 5KG0A 4I2DA 2J6TA 1KL9A 2FE9A 2HHSA 2W9BA 4LZDA 1CUKA 3R9KA 4ECSA 9ICJA 4RQ3A 4ED0A 4I29A 5DBCA 5HRLA 4FH5A 4ATBA 4I2HA 1F5SA 2KFNA 5AKXA 1VDVA 3F5EA 4JLXA 3CP8A 2ZJ5A 2R8KA 2Y0SF 1RPLA 4DF4A 5ALQA 4RQ1A 2R8GA 1RXVA 3HKZC 4KITB 4ZOHC 5GTIU 4CF3A 3PO4A 3H8JA 3KOOA 7ICUA 2VJ5A 4DSFA 4OJLA 3HJ1A 5HRKA 2LYAA 4PJ0U 1KNYA 1N48A 2EH9A 4DO9A 4F3OA 5B3QA 5AI6A 2AU0A 3C5FA 5IIMA 3M6ZA 1TV9A 4F91B 8ICNA 4X4VA 2XI9A 3MR6A 5ALNA 4DS4A 2DQNB 5A0LA 5HRFA 4QZIA 3B9JA 3IN5A 2ZUDA 4WC2A 5HR6A 3BZCA 5KFYA 1BPYA 1RYRA 1L8LA 1X9WA 1YLQA 2KD1A 5AKIA 1T4GA 1HUZA 2BCUA 1NKEA 5KFGA 4IS7A 5DB9A 4EBKA 4MEYA 4EELA 1ZQDA 3H3AA 3NVVA 3QYPA 1SV4A 4GXKA 2UVRA 1SV0C 1MIWA 4F4ZA 1KTQA 2HOIA 3M6KA 3AQKA 1DOQA 1SXEA 1ZQXA 4F5PA 1DK2A 4ED8A 5EOZA 3L5KA 1RXWA 4KX3A 2ZIWA 2RRDA 1MQ3A 2PFPA 5KT7A 1K1SA 5KFNA 2E8NA 5AKYA 5ALLA 3RH6A 4EEKA 2YX8A 4KLQA 4PL2A 3AU6A 4O5EA 3KKAA 4Y2UA 2DR7A 2BCRA 5E79U 3AEVA 4R66A 5G5GA 4BWJA 4FS2A 2HHTA 7ICIA 3IP4B 4KLLA 3JPRA 2ID1A 2PI5A 2DR8A 1SV0A 2E1EA 1UHUA 2H3IA 2OCEA 3E0FA 7ICLA 3SAFA 2G09A 3ED5A 3NVZA 3JYYA 2KKVA 4WCWA 1OU5A 1ZQLA 3AQNA 1PVQA 2W03A 3Q8MA 3N4MB 2MA1A 1MQ2A 5L1LA 1ZQOA 4KLUA 5AK3A 1P7DA 3LWMA 5HP4A 3EW9A 8ICWA 1RM6C 4UAWA 4EX6A 1L3VA 4I2FA 1X6IA 2ZIVB 2Y1JA 2F77X 5HRBA 2DFLA 4CNQA 5DBBA 3H37A 3M1YA 1ZQWA 2KMDA 2FPKA 4NXTA 3TI0A 1PK3A 3FC4A 1TK8A 4KLFA 2BCQA 3OSNA 5AK5A 4KMUA 4ICAA 4DFDA 4JUZA 4Y2SA 4CDGA 5AI9A 4U7CA 1TFWA 3CNHA 5KG4A 2RQ5A 4FE3A 4XA5A 2OHFA 1TFYA 3JCFA 2AHOB 1ZQUA 4NXWA 2XGQA 1S9FA 4WC6A 3UPQA 2H3QA 5AKZA 5JRTA 2HHWA 2JV3A 3EPGA 1RG6A 5CHGA 4P0QA 2BPFA 2V4RA 2LYHA 2F1JA 9ICUA 1JROA 5DLFA 4UB4A 4JV1A 3OHAA 1GPJA 2LI6A 5ALKA 4PPXA 3N7RC 2V9WA 3SZ2A 2L5YA 2D6FC 9ICCA 2IOFK 3K1RB 4ACOA 3T5JA 5J8YC 4FS1A 4KLSA 3K75D 2E8MA 4E8FA 4LEWA 2FI1A 4IRKA 1QLNA 3HX0A 2JXJA 3MFIA 3JPQA 2GWSA 3RJKA 2HBMA 5JTIA 4GC7A 2DPIA 3OUYA 8ICFA 5HRDA 1N63A 2YB4A 1L7OA 2Y9TA 2DPJA 5JTGA 1S0MA 4NXVA 5ALSA 2ISPA 5AM0A 4QZBA 9ICGA 5KFRA 2JR5A 2XGPA 4X5VA 4US8A 5AK4A 1ZQJA 2AQ0A 3T3FA 2HBKA 4DFPA 3BQ2A 4KLDA 4I28A 5J8YA 4XJEA 5KFCA 4YR3A 3A0HU 4MKPA 4PGXA 4ELVA 4DL2A 2DKZA 3PV8A 4WC7A 4QZFA 4DQQA 3BS5A 2B56A 3UXPA 4QW9A 4EP7A 8ICAA 2DWQA 4O3PA 4BDPA 1QQ7A 5AM4A 4JWNA 2IHMA 3RAQA 4Y2VA 5D4BA 4C7YA 2W9CB 5DKWA 5DQIA 4FHYA 3ZD8A 4NLCA 4AT7B 4C8OA 1D9DA 5KNIA 1KN5A 3MCRA 3G6XA 3HT3A 4NKUA 2NO4A 4MFFA 5AM1A 3QZ7A 3MR3A 1KLNA 9ICLA 4O67A 2NYVA 4RWNA 2P35A 1NJXA 9ICNA 3C66A 2XIDA 1N5WA 1X2IA 2Z7JA 4B9SA 4DOCA 1S0OA 3EF2A 4NLKA 4O3NA 2XY6A 1K1QA 4M6WB 1QCKA 4XUSA 3MGVA 2A3VA 1F0MA 2NRXA 5KFWA 4EENA 4WC0A 1UPHA 1ZQBA 1SL1A 3DEEA 2JZBA 5ALDA 4QJFB 3SQIA 2F1IA 1N2XA 4O3OA 1JAJA 5KFPA 2W54A 1BVSA 4BUGA 3TAQA 2KV2A 2BGWA 2JGAA 3KHRA 1TAMA 4QWEA 4EYHB 3TANA 5CFUA 2B0CA 2PI4A 5ALYA 4FBUA 1J2NA 4KLTA 2GA9D 2ZUBA 5CA7A 4UAVA 4F5NA 1MIYA 4IQTA 2R18A 1JI7A 2RFFA 5AK6A 2HOFA 4DS5A 4NLGA 5D62A 3L3FX 4QW8A 4IR9A 1Q78A 1ZQHA 4QZHA 9ICSA 2K60A 1MA7A 8ICCA 2P6UA 2RDJA 1U45A 5ALFA 4IG8A 1L5UA 4M9LA 5ALPA 3PY8A 4O6AA 3JPSA 4YVZA 3RJIA 2IA6A 4K99A 2F3NA 5DB8A 4ED2A 4UATA 4Y2XA 3RBEA 2E8PA 4XQ8A 2G0AA 4RQ2A 1IM4A 3HILA 2EWRA 5D63A 1AROP 1U47A 1RDFA 1SKRA 4TURA 4GC6A 1KFDA 4J9PA 2AGOA 3MGHA 3EPIA 2C28A 2ZHAA 1XSNA 2ZIVA 4WC3A 4QZGA 2KSOB 3I1YA 2ZHBA 2KEYA 3NRWA 2G06A 5ALXA 2FMSA 2HHQA 4LEVA 1LKYB 3GIMA 2B4VA 5J2DA 4F5QA 1UT5A 5J2EA 2ZH6A 3OVAA 3FDSA 2ZH1A 1UT8A 4KLGA 1S77D 5J0QA 2E8OA 2LKYA 3F53A 2VANA 3PSPA 4C7ZA 2H3ZA 3QNMA 2J6UA 4NXUA 4J9MA 2BCSA 1PX5A 2XCPA 1V38A 3RJEA 1YZ7A 3RAXA 4USAA 4CGZA 4PGQA 4FO1A 3UXNA 4UB3A 4WC5A 2AJQA 9ICAA 9ICFA 1PK1B 2KZ3A 4YN4A 3PR4A 1L8OA 3KZXA 3OVSA 5ALJA 3LVVA 2HBJA 5D46A 2JHDA 2R8IA 5KFLA 1U48A 4M0AA 4FHPA 1JMSA 1NK8A 5L1KA 1SKSA 3HIYA 1KDHA 2KVCA 1SB3C 1C7YA 4Y2TA 1N60A 3TARA 3Q8LA 3RH5A 1SKWA 3PW7A 3ER8C 5CR0A 2ZH8A 1SXDA 5ALTA 4DQPA 5HHHA 4I2AA 4KB6A 1O03A 3M8SA 4YXMA 4KLJA 5DGAA 2KJ9A 9ICBA 4GXJA 4X4SA 4YG2A 3GU3A 5CFSA 2KE7A 3RJFA 3FM9A 3QU7A 3ICXA 8ICGA 2AGQA 2BDPA 2YMQA 4ED7A 8ICIA 2KTQA 5ALHA 5EWFA 1TK0A 2WAQC 4YD1A 1BPEA 4X4TA 4J9OA 4B6JA 4FBTA 4J9SA 4K98A 5HR9A 3RFAA 4RPZA 5ALMA 3NASA 5DECA 2W7OA 4M9HA 3E58A 1U9LA 2LYBA 3BDPA 3AU2A 5KFIA 1NK4A 1L3SA 1QH9A 5TISU 7ICFA 1BNOA 4OJ6A 1JXEA 2ASDA 1X40A 4WBZA 3F2BA 1NK6A 2KFZA 4P4OA 4KLHA 3T5HA 2PKEA 1QTMA 2LM4A 4UB5A 4O5CA 2HSZA 5BOMA 3KHGA 5L9XA 4DFJA 5AIAA 3PMLA 1UETA 4E80A 2VIXA 3WK8A 4EBCA 4C8NA 4WH5A 2W9CA 5KG1A 4O0IA 2XVTA 3IG8A 4GIBA 3WK4A 4AT7A 3H4DA 5KFOA 4DSKA 5CWRA 2F8KA 3PX0A 2BPGA 1FEZA 4NV0A 2H5XA 5ALRA 4DL4A 4QWCA 3UPSA 2QARB 2R8JA 2WB1F 3ISDA 2BDUA 4B9MA 3UMGA 4AYBF 5ALZA 3B0YA 4UBCA 2AXTU 4J9KA 4WQKA 3H0LB 2LMRA 4RQNA 2ZH4A 4M6WA 2N1RA 5J2HA 3PHZA 2ZG6A 8ICPA 1CI4A 3BZKA 2WF5A 5AKEA 3KTQA
chains in the Genus database with same CATH topology
1XSLA 2IHNA 2ASJA 2ZH7A 8ICWA 4UAWA 4RT3A 8ICSA 5CB1A 4RNMA 1L3VA 3V7KA 4CCHA 3M9NB 7ICRA 4I2FA 1ZQPA 3ZD9A 4F4YA 2Y1JA 3OJUA 2F1HA 5HRBA 2DFLA 5J0TA 3RB4A 3H37A 4IQVA 5DBBA 2M2WA 1NKBA 5HMLA 5IIKA 3BQ0A 3QEAZ 1ZQWA 4O3RA 3C18A 3C1ZA 4Q8EA 4E7XA 4Q45A 3T5LA 2FPKA 3M9MB 4R8UB 4I27A 3QEBZ 3TI0A 8ICMA 4EBDA 1S10A 1TK8A 4KLFA 2BCQA 3IHQB 3OSNA 4KMUA 3AUOA 5HRHA 1NK7A 1ZQVA 4PHAA 2XO7A 1WOTA 3PW5A 2PFNA 2DRAA 4J9RA 2VA3A 5KFVA 4YMNA 4JUZA 1C7YA 2W9BB 1ZQRA 2VA2A 2ZJAA 4BXOA 1D8LA 8ICXA 5KFEA 3PW4A 2PXIA 3BJYA 5KFTA 1TFWA 4Z6CA 1S0NA 5KTQA 5EWGA 2P66A 9ICXA 4ATBB 4LZGA 5KG4A 2IMWP 3TFSA 3MR5A 1NJYA 3OVBA 4ED3A 5F9LA 2W9AA 4XA5A 1TFYA 4F4WA 4IRCA 1X9SA 4IRDA 5KFQA 1ZQUA 1A76A 2XGQA 2ALZA 1S9FA 4R63A 4YP3A 4WC6A 3SYZA 1BGXT 3C1YA 1KFTA 1WCNA 4EBEA 3HPOA 3UPQA 3GIKA 4K4HA 4B9TA 3EWAA 4FHXA 4MF8A 4F2SA 3EPGA 2HHWA 4WBYA 5KFAA 3G6VA 1SZPA 5D49A 5J0XA 3C23A 5CHGA 4DQRA 2BPFA 7ICQA 2JEFA 4GXIA 4NM1A 5BPCA 2V4RA 2R8HA 2LYHA 2HW3A 1TAUA 1T7PA 2FPMA 3MDCA 4KTQA 2F1JA 9ICUA 3WFQE 3THVA 1JX4A 2DR9A 5J0RA 2KN7A 4YMOA 4R65A 4IQWA 2BCVA 5DLFA 4UB4A 2Q66A 4JV1A 3OHAA 4GLXA 5DDMA 3WFSC 4PPXA 3MGIA 1TFRA 4FHVA 4PHPA 4I2GA 3H38A 2V9WA 4RT2A 2W8LA 4QZAA 1Z3EB 3MR2A 3SZ2A 5HRGA 1A77A 2M9NA 4BWMA 5HNKA 4YMMA 2HVHA 2IBKA 9ICCA 1VFGA 1CEZA 2I1QA 4YD2A 3C21A 2BQUA 4F2RA 1KEJA 1XO1A 2C2DA 2FLNA 5EWEA 4QZ8A 4PHDA 3T5JA 4I2BA 4FS1A 4DL3A 5DB7A 1QSSA 4KLSA 3K75D 3RBDA 3B0XA 7ICKA 4XRHA 4E8FA 4IRKA 4UQGA 4QWDA 3HX0A 1QLNA 5KFZA 9ICVA 5HC9A 4R64A 3MFIA 4UB2A 3JPQA 2GWSA 1ZQEA 3RJKA 1B43A 4B9VA 3OGUA 1MC8A 3AQLA 3GIJA 4GC7A 2DPIA 5KFBA 3RJGA 3OUYA 2NRVA 5DLGA 8ICFA 1B22A 5HRDA 2BE3A 4J9QA 4YR2A 5TZVA 1ZQKA 4F4KA 3H8SA 3HW8A 2DPJA 8ICYA 3MABA 3KHHA 1S0MA 3MDAA 4ECUA 1Z00A 3RRHA 4M2YA 3AQMA 4NXZA 5DGBA 3NGDA 3RJHA 5KT3A 4J9NA 4DFKA 4AT8A 2ISPA 4I2EA 1NK0A 4QZBA 1MSWD 3BQ1A 9ICEA 5KFRA 2NRTA 3C5GA 2HHVA 7ICEA 9ICGA 2XGPA 5KFJA 5J0WA 1ZQYA 4X5VA 1U4BA 3QE9Y 1L3SA 1ZQIA 2VA8A 1ZQJA 1ZQFA 4DSIA 9ICPA 2AQ0A 3T3FA 4FH3A 1LV5A 3RB0A 4LT6A 3LDAA 3Q8QB 5KFKA 4KLEA 4YR0A 3LQCB 4DFPA 5F9NA 3BQ2A 5DG9A 2BR0A 7ICNA 4KLDA 3OJSA 9ICKA 3NTUA 4I28A 3TQ1A 5KFCA 2ZTEA 4M04A 4YR3A 4XQ7A 1XC9A 2C2EA 3GV8B 4PGXA 3RJJA 8ICBA 5L1IA 1S76D 4ELVA 2HHUA 4DL2A 2Y1IA 1XSPA 4KN7A 3PV8A 4WC7A 4X0BA 3RR7A 4QZFA 4DQQA 5KG7A 7ICMA 4Z6FA 3UXPA 4QW9A 4DFMA 2V4QA 3PW0A 4DF8A 2ZH5A 4DLEA 3H4BA 4EP7A 3ZDCA 4M9JA 3ISBA 8ICAA 5KFUA 4RQ5A 3EZ5A 2DRBA 4O3PA 5C5JA 4BDPA 3UQ0A 4JWNA 2IHMA 3V6JA 3OUYB 3RAQA 4DL5A 1JQRA 4RQ7A 2FPLA 5D4BA 2W9CB 2W8KA 2HHXA 2JEJA 5DKWA 1ZYQA 5DQIA 5DQHA 4FHYA 3ZD8A 4KLOA 4RWOA 3GFKB 2NRZA 5J0SA 9ICIA 9ICRA 4AT7B 4C8OA 1D9DA 1ZQMA 3PO5A 8ICJA 1KFSA 1SL0A 2MUTA 4NLZA 3G6YA 4PGYA 5HHIA 4M47A 4UAYA 3G6XA 5KFDA 2W9MA 3HT3A 4NKUA 2P6RA 4MFFA 4RUCA 3RR8A 3QZ7A 1UEUA 4YCXA 1UEVA 5IILA 3WFRE 3MR3A 1HUOA 1KLNA 1D9FA 4F5OA 5KFMA 3FYHA 2J6SA 9ICLA 1WCLA 2HVIA 2KP7A 4RWNA 2BQRA 3PMNA 4FHWA 1NO5A 1NJXA 1ZQAA 9ICNA 3C66A 1X2IA 4B9SA 1VJ7A 3RB6A 3E2EA 3UXOA 4DOCA 4PH5A 4UD4A 1S0OA 4NLKA 4O3NA 4ED6A 2XY6A 4EEYA 2JEIA 4NM2A 2XCAA 1K1QA 4M6WB 4ELUA 2UVUA 8ICEA 2M2TA 1Q79A 4WC1A 4WC4A 4XUSA 5J2FA 3MFHA 5J0OA 2NRXA 4X4UA 2A1JA 3GDXA 3GV7B 5KFWA 9ICWA 2HHPA 5JUMA 4WC0A 4RQ8A 1DK3A 1ZQBA 1SL1A 2JZBA 4RQ6A 1UA1A 8ICUA 5IIJA 2F1IA 5J29A 4O3OA 4UB1A 1JAJA 5KFPA 4KLMA 4F92B 1BVSA 1NKCA 3PVXA 4DSEA 2ZH8A 3TAQA 4AT9A 4RPYA 2BGWA 3KHRA 2MUTB 4QWEA 4EYHB 3TANA 1NK5A 4TQSA 3JPPA 1PZNA 4O3QA 5KG2A 2PI4A 4FBUA 4EZ6A 4KLTA 2ZUBA 3K4GA 5KFSA 5CA7A 4FO6A 4F5NA 4EBJA 4DL7A 4ECWA 3OSPA 1JN3A 4RNOA 4DSLA 3V7JA 4IQTA 4O9MA 1MIYA 3SV4A 2RFFA 1NZPA 1UA0A 4DS5A 4BXOB 4NLGA 3C2MA 2FLLA 4QW8A 8ICQA 3LWLA 5L1JA 4IR9A 1Q78A 1JXLA 1ZQHA 4C8MA 2BQ3A 4QZHA 4YFKA 3Q8PB 9ICSA 1BNPA 4RUAA 1QSYA 8ICCA 2P6UA 4RQ0A 2RDJA 9ICQA 4UD5A 1U45A 4DEZA 2ZH3A 5J2GA 3WFPA 4IG8A 1L5UA 3H40A 3T5KA 4M9LA 3PY8A 4RU9A 4ECZA 3JPSA 5KT5A 3UQ2A 4YVZA 3RJIA 5J2KA 2IA6A 7ICPA 3OV7A 4ED1A 5J2IA 1ZQTA 9ICOA 5J0YA 5DB8A 2ZJ8A 4RWQA 4ECYA 5BOLA 4ED2A 3GV5B 2XY7A 3RBEA 5CP2A 2JZBB 3OHBA 4ECTA 4X4PA 4XQ8A 4RQ2A 1IM4A 3ORYA 4TUSA 2ISOA 1L3TA 4X4OA 5J0UA 3M8RA 5J2AA 1H38A 1AROP 4O3SA 1U47A 4RNNA 1N56A 1SKRA 1KSPA 4TURA 4GC6A 1KFDA 1ZQGA 4PHEA 4J9PA 2AGOA 3MGHA 3EPIA 3TAPA 2C28A 1LB2B 1XSNA 1FA0A 4WC3A 2XY5A 4QZGA 4P4PA 3PX6A 2PFOA 2ZHBA 5HREA 3ISCA 4MEXA 5KFFA 4P2HA 2FMSA 2HHQA 4C8LA 3GIMA 3TFRA 1BPXA 8ICHA 4K4IA 3H8WA 5KG5A 5J2JA 5J2DA 4F5QA 3RTVA 1TK5A 9ICMA 1F5AA 2FMPA 1UT5A 5J2EA 2ZH6A 4R8UA 4UAZA 1IXRA 4DOAA 3BQTA 1NJZA 3ZDBA 3OVAA 5F2VO 3FDSA 2ZH1A 1UT8A 1T3NA 4KLGA 1BPDA 2BPCA 5J0QA 1S77D 2M2UA 4S3NA 5KG0A 4YXJA 4Q8FA 7ICSA 4I2DA 2J6TA 3IM1A 4NKTA 2HHSA 4RPXA 2VANA 2W9BA 4LZDA 1CUKA 5DB6A 4IR1A 1Y88A 4ECSA 2J6UA 4RQ3A 5IIIA 4J9MA 4ED0A 7ICOA 9ICJA 2BCSA 2KZMA 1PX5A 2XCPA 1XU4A 3RJEA 4ECQA 5KFHA 3RAXA 4DSJA 7ICGA 4I29A 1Z00B 5DBCA 2ATLA 5HRLA 4FH5A 4I2HA 4PGQA 4ATBA 3UXNA 9ICTA 5DEDA 7ICTA 2KFNA 2ZTCA 4AT8B 1ZJNA 3KHLA 4UB3A 4WC5A 1TKDA 2AJQA 9ICAA 4LVSA 2O1PA 2ZJ5A 2R8KA 1R8CA 9ICFA 3HJ4A 2ZH2A 8ICVA 2KZ3A 4YN4A 2O5AA 1HJPA 3PR4A 1RPLA 3OVSA 4F50A 1QSLA 4DF4A 4RQ1A 1EXNA 5IIOA 5J2CA 3PX4A 2R8GA 1RXVA 4KITB 2AQ4A 5IINA 5D46A 2R8IA 4NY8A 3V6KA 1ZQNA 5KFLA 5DG8A 8ICRA 4F5RA 4Q44A 1S97A 1U48A 3N97B 2FLPA 4M0AA 4FHPA 3QZ8A 1JMSA 3H8JA 3PO4A 4K4GA 4I2CA 4Z6EA 4JWMA 7ICUA 4X4NA 1NK8A 5L1KA 4DSFA 1SKSA 3HIYA 2ZH9A 3PR5B 3HJ1A 1KDHA 8ICLA 3H7IA 5HRKA 1R8BA 4E80A 5J0PA 7ICVA 3MBYA 1KNYA 1N48A 2NRWA 4DO9A 3TARA 3Q8LA 3RH5A 3Q8SB 5KT6A 3PW7A 1SKWA 5CR0A 2I9GA 2AU0A 4F3OA 4RWPA 3C5FA 5IIMA 1ZJMA 4DQPA 5HHHA 4MF2A 1TV9A 4RZRA 1ZQZA 4I2AA 1T8EA 3M9OB 4F91B 8ICNA 1R8AA 4G3IA 3M8SA 3ZDAA 4KLIA 4X4QA 4X4VA 2KZZA 5CJ7A 4DLGA 3MR6A 2ASLA 4YXMA 4M9GA 4I2IA 3GIIA 4KLJA 4DS4A 2ZHAA 2UVWA 3RRGA 5DGAA 4O5KA 2ZUCA 1MIVA 5HRFA 4QZIA 4NLNA 2ZUDA 4WC2A 9ICBA 4GXJA 5HMMA 2WTFA 3L9DA 4X4SA 2DR5A 1BPYA 5KFYA 4YG2A 4KN4A 3RB3A 1ZQQA 4DQSA 1RYRA 2OWOA 4B9LA 4RQ4A 1X9WA 3JPOA 3RJFA 1RZTA 8ICOA 2M2VA 1YLQA 2NRKA 1T4GA 1HUZA 2BCUA 1NKEA 5KFGA 8ICGA 2AGPA 2AGQA 4Q43A 2BDPA 4J9LA 4ED7A 8ICIA 4X0AA 1V9PA 2KTQA 5DB9A 2RDIA 4EBKA 3JZ0A 5EWFA 4I2JA 5DBAA 4JV2A 1TK0A 2MAXA 4MFCA 4YD1A 4MEYA 1ZQDA 4F8RA 1NOMA 1BPEA 1DGSA 3ZDEA 3H3AA 1ZQSA 4X4TA 4J9OA 4UBBA 4TUPA 4GXKA 4FBTA 1S0VA 4F4XA 2FMQA 4J9SA 2UVRA 4QZCA 5HR9A 3V72A 4ECRA 5HRIA 4RPZA 3SV3A 5DECA 3H39A 4M9HA 1JIHA 3RH4A 1MIWA 4F4ZA 1U9LA 4C8KA 1KTQA 3BDPA 3AU2A 5KFIA 3GILA 3GQCA 1NK4A 1TVAA 2A1JB 4QZDA 2C2RA 1SL2A 4X4RA 7ICFA 3LK9A 2KFZA 1NJWA 7ICJA 4P4MA 4QZEA 1DOQA 1BNOA 3AQKA 1JXEA 2ASDA 1ZQXA 4F5PA 4M5DA 4WBZA 1DK2A 2B21A 4QWBA 3C2LA 4JK1A 4P4OA 4Z6DA 1XWLA 5EOZA 4TQRA 4ED8A 3T5HA 1RXWA 1L3UA 4KLHA 1QTMA 4UB5A 5J2BA 4O5CA 5KG6A 1MQ3A 4DWIA 1TAQA 2Q0ZX 4DL6A 8ICZA 2PFPA 3ZDDA 4ZH4A 5KT7A 5BOMA 2XC9A 3KHGA 5L9XA 4DFJA 4AT9B 3PMLA 3ETLA 5KFXA 1K1SA 5KFNA 3JPNA 3C2KA 3RH6A 1UETA 4KLQA 2PBEA 5KT4A 3AU6A 4EZ9A 4EBCA 4C8NA 4O5EA 2W9CA 4IQUA 5KG1A 3V6HA 1BPBA 4DQIA 4O0IA 1R89A 2BCRA 2DR7A 1ZQCA 3PW2A 4R66A 4FS2A 4BWJA 9ICHA 2BHNA 2HHTA 1NK9A 7ICIA 4AT7A 4KLLA 3JPRA 2ID1A 3H4DA 2PI5A 4ELTA 1X9MA 3WFOA 5KT2A 4BGDA 5KFOA 3SI8A 2DR8A 2C22A 3Q8RB 4DSKA 4F93B 5CWRA 3PX0A 2BPGA 2PFQA 4TUQA 5DG7A 2BKEA 4JV0A 4ECXA 1D8YA 7ICLA 2ZTDA 2H5XA 5DQGA 4DL4A 3JYYA 4QWCA 4WCWA 3UPSA 3EYZA 4HYKA 1OU5A 3JPTA 3PNCA 7ICHA 3NYBA 5KG3A 1KRPA 1ZQLA 2R8JA 3ISDA 3AQNA 3Q8KA 4B9MA 4QWAA 3Q8MA 3N4MB 1BPZA 3B0YA 1MQ2A 4UBCA 5L1LA 5DDYA 4EYIB 4DOBA 4ECVA 2UVVA 4B9UA 1COOA 4MFAA 4J9KA 2DVIA 1RYSA 4QZ9A 3HWTA 1ZETA 2JEGA 4B9NA 4M9NA 1NK6A 2ZH4A 1ZQOA 4M6WA 4KLUA 5J2HA 4E0DA 3HP6A 3V7LA 3LWMA 1XS9D 8ICKA 8ICPA 1U49A 1V4AA 5HP4A 4YQWA 8ICTA 3EW9A 3KTQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XSL A;  2IHN A;  2ASJ A;  2ZH7 A;  8ICW A;  4UAW A;  4RT3 A;  8ICS A;  5CB1 A;  4RNM A;  1L3V A;  3V7K A;  4CCH A;  3M9N B;  7ICR A;  4I2F A;  1ZQP A;  3ZD9 A;  4F4Y A;  2Y1J A;  3OJU A;  2F1H A;  5HRB A;  2DFL A;  5J0T A;  3RB4 A;  3H37 A;  4IQV A;  5DBB A;  2M2W A;  1NKB A;  5HML A;  5IIK A;  3BQ0 A;  3QEA Z;  1ZQW A;  4O3R A;  3C18 A;  3C1Z A;  4Q8E A;  4E7X A;  4Q45 A;  3T5L A;  2FPK A;  3M9M B;  4R8U B;  4I27 A;  3QEB Z;  3TI0 A;  8ICM A;  4EBD A;  1S10 A;  1TK8 A;  4KLF A;  2BCQ A;  3IHQ B;  3OSN A;  4KMU A;  3AUO A;  5HRH A;  1NK7 A;  1ZQV A;  4PHA A;  2XO7 A;  1WOT A;  3PW5 A;  2PFN A;  2DRA A;  4J9R A;  2VA3 A;  5KFV A;  4YMN A;  4JUZ A;  1C7Y A;  2W9B B;  1ZQR A;  2VA2 A;  2ZJA A;  4BXO A;  1D8L A;  8ICX A;  5KFE A;  3PW4 A;  2PXI A;  3BJY A;  5KFT A;  1TFW A;  4Z6C A;  1S0N A;  5KTQ A;  5EWG A;  2P66 A;  9ICX A;  4ATB B;  4LZG A;  5KG4 A;  2IMW P;  3TFS A;  3MR5 A;  1NJY A;  3OVB A;  4ED3 A;  5F9L A;  2W9A A;  4XA5 A;  1TFY A;  4F4W A;  4IRC A;  1X9S A;  4IRD A;  5KFQ A;  1ZQU A;  1A76 A;  2XGQ A;  2ALZ A;  1S9F A;  4R63 A;  4YP3 A;  4WC6 A;  3SYZ A;  1BGX T;  3C1Y A;  1KFT A;  1WCN A;  4EBE A;  3HPO A;  3UPQ A;  3GIK A;  4K4H A;  4B9T A;  3EWA A;  4FHX A;  4MF8 A;  4F2S A;  3EPG A;  2HHW A;  4WBY A;  5KFA A;  3G6V A;  1SZP A;  5D49 A;  5J0X A;  3C23 A;  5CHG A;  4DQR A;  2BPF A;  7ICQ A;  2JEF A;  4GXI A;  4NM1 A;  5BPC A;  2V4R A;  2R8H A;  2LYH A;  2HW3 A;  1TAU A;  1T7P A;  2FPM A;  3MDC A;  4KTQ A;  2F1J A;  9ICU A;  3WFQ E;  3THV A;  1JX4 A;  2DR9 A;  5J0R A;  2KN7 A;  4YMO A;  4R65 A;  4IQW A;  2BCV A;  5DLF A;  4UB4 A;  2Q66 A;  4JV1 A;  3OHA A;  4GLX A;  5DDM A;  3WFS C;  4PPX A;  3MGI A;  1TFR A;  4FHV A;  4PHP A;  4I2G A;  3H38 A;  2V9W A;  4RT2 A;  2W8L A;  4QZA A;  1Z3E B;  3MR2 A;  3SZ2 A;  5HRG A;  1A77 A;  2M9N A;  4BWM A;  5HNK A;  4YMM A;  2HVH A;  2IBK A;  9ICC A;  1VFG A;  1CEZ A;  2I1Q A;  4YD2 A;  3C21 A;  2BQU A;  4F2R A;  1KEJ A;  1XO1 A;  2C2D A;  2FLN A;  5EWE A;  4QZ8 A;  4PHD A;  3T5J A;  4I2B A;  4FS1 A;  4DL3 A;  5DB7 A;  1QSS A;  4KLS A;  3K75 D;  3RBD A;  3B0X A;  7ICK A;  4XRH A;  4E8F A;  4IRK A;  4UQG A;  4QWD A;  3HX0 A;  1QLN A;  5KFZ A;  9ICV A;  5HC9 A;  4R64 A;  3MFI A;  4UB2 A;  3JPQ A;  2GWS A;  1ZQE A;  3RJK A;  1B43 A;  4B9V A;  3OGU A;  1MC8 A;  3AQL A;  3GIJ A;  4GC7 A;  2DPI A;  5KFB A;  3RJG A;  3OUY A;  2NRV A;  5DLG A;  8ICF A;  1B22 A;  5HRD A;  2BE3 A;  4J9Q A;  4YR2 A;  5TZV A;  1ZQK A;  4F4K A;  3H8S A;  3HW8 A;  2DPJ A;  8ICY A;  3MAB A;  3KHH A;  1S0M A;  3MDA A;  4ECU A;  1Z00 A;  3RRH A;  4M2Y A;  3AQM A;  4NXZ A;  5DGB A;  3NGD A;  3RJH A;  5KT3 A;  4J9N A;  4DFK A;  4AT8 A;  2ISP A;  4I2E A;  1NK0 A;  4QZB A;  1MSW D;  3BQ1 A;  9ICE A;  5KFR A;  2NRT A;  3C5G A;  2HHV A;  7ICE A;  9ICG A;  2XGP A;  5KFJ A;  5J0W A;  1ZQY A;  4X5V A;  1U4B A;  3QE9 Y;  1L3S A;  1ZQI A;  2VA8 A;  1ZQJ A;  1ZQF A;  4DSI A;  9ICP A;  2AQ0 A;  3T3F A;  4FH3 A;  1LV5 A;  3RB0 A;  4LT6 A;  3LDA A;  3Q8Q B;  5KFK A;  4KLE A;  4YR0 A;  3LQC B;  4DFP A;  5F9N A;  3BQ2 A;  5DG9 A;  2BR0 A;  7ICN A;  4KLD A;  3OJS A;  9ICK A;  3NTU A;  4I28 A;  3TQ1 A;  5KFC A;  2ZTE A;  4M04 A;  4YR3 A;  4XQ7 A;  1XC9 A;  2C2E A;  3GV8 B;  4PGX A;  3RJJ A;  8ICB A;  5L1I A;  1S76 D;  4ELV A;  2HHU A;  4DL2 A;  2Y1I A;  1XSP A;  4KN7 A;  3PV8 A;  4WC7 A;  4X0B A;  3RR7 A;  4QZF A;  4DQQ A;  5KG7 A;  7ICM A;  4Z6F A;  3UXP A;  4QW9 A;  4DFM A;  2V4Q A;  3PW0 A;  4DF8 A;  2ZH5 A;  4DLE A;  3H4B A;  4EP7 A;  3ZDC A;  4M9J A;  3ISB A;  8ICA A;  5KFU A;  4RQ5 A;  3EZ5 A;  2DRB A;  4O3P A;  5C5J A;  4BDP A;  3UQ0 A;  4JWN A;  2IHM A;  3V6J A;  3OUY B;  3RAQ A;  4DL5 A;  1JQR A;  4RQ7 A;  2FPL A;  5D4B A;  2W9C B;  2W8K A;  2HHX A;  2JEJ A;  5DKW A;  1ZYQ A;  5DQI A;  5DQH A;  4FHY A;  3ZD8 A;  4KLO A;  4RWO A;  3GFK B;  2NRZ A;  5J0S A;  9ICI A;  9ICR A;  4AT7 B;  4C8O A;  1D9D A;  1ZQM A;  3PO5 A;  8ICJ A;  1KFS A;  1SL0 A;  2MUT A;  4NLZ A;  3G6Y A;  4PGY A;  5HHI A;  4M47 A;  4UAY A;  3G6X A;  5KFD A;  2W9M A;  3HT3 A;  4NKU A;  2P6R A;  4MFF A;  4RUC A;  3RR8 A;  3QZ7 A;  1UEU A;  4YCX A;  1UEV A;  5IIL A;  3WFR E;  3MR3 A;  1HUO A;  1KLN A;  1D9F A;  4F5O A;  5KFM A;  3FYH A;  2J6S A;  9ICL A;  1WCL A;  2HVI A;  2KP7 A;  4RWN A;  2BQR A;  3PMN A;  4FHW A;  1NO5 A;  1NJX A;  1ZQA A;  9ICN A;  3C66 A;  1X2I A;  4B9S A;  1VJ7 A;  3RB6 A;  3E2E A;  3UXO A;  4DOC A;  4PH5 A;  4UD4 A;  1S0O A;  4NLK A;  4O3N A;  4ED6 A;  2XY6 A;  4EEY A;  2JEI A;  4NM2 A;  2XCA A;  1K1Q A;  4M6W B;  4ELU A;  2UVU A;  8ICE A;  2M2T A;  1Q79 A;  4WC1 A;  4WC4 A;  4XUS A;  5J2F A;  3MFH A;  5J0O A;  2NRX A;  4X4U A;  2A1J A;  3GDX A;  3GV7 B;  5KFW A;  9ICW A;  2HHP A;  5JUM A;  4WC0 A;  4RQ8 A;  1DK3 A;  1ZQB A;  1SL1 A;  2JZB A;  4RQ6 A;  1UA1 A;  8ICU A;  5IIJ A;  2F1I A;  5J29 A;  4O3O A;  4UB1 A;  1JAJ A;  5KFP A;  4KLM A;  4F92 B;  1BVS A;  1NKC A;  3PVX A;  4DSE A;  2ZH8 A;  3TAQ A;  4AT9 A;  4RPY A;  2BGW A;  3KHR A;  2MUT B;  4QWE A;  4EYH B;  3TAN A;  1NK5 A;  4TQS A;  3JPP A;  1PZN A;  4O3Q A;  5KG2 A;  2PI4 A;  4FBU A;  4EZ6 A;  4KLT A;  2ZUB A;  3K4G A;  5KFS A;  5CA7 A;  4FO6 A;  4F5N A;  4EBJ A;  4DL7 A;  4ECW A;  3OSP A;  1JN3 A;  4RNO A;  4DSL A;  3V7J A;  4IQT A;  4O9M A;  1MIY A;  3SV4 A;  2RFF A;  1NZP A;  1UA0 A;  4DS5 A;  4BXO B;  4NLG A;  3C2M A;  2FLL A;  4QW8 A;  8ICQ A;  3LWL A;  5L1J A;  4IR9 A;  1Q78 A;  1JXL A;  1ZQH A;  4C8M A;  2BQ3 A;  4QZH A;  4YFK A;  3Q8P B;  9ICS A;  1BNP A;  4RUA A;  1QSY A;  8ICC A;  2P6U A;  4RQ0 A;  2RDJ A;  9ICQ A;  4UD5 A;  1U45 A;  4DEZ A;  2ZH3 A;  5J2G A;  3WFP A;  4IG8 A;  1L5U A;  3H40 A;  3T5K A;  4M9L A;  3PY8 A;  4RU9 A;  4ECZ A;  3JPS A;  5KT5 A;  3UQ2 A;  4YVZ A;  3RJI A;  5J2K A;  2IA6 A;  7ICP A;  3OV7 A;  4ED1 A;  5J2I A;  1ZQT A;  9ICO A;  5J0Y A;  5DB8 A;  2ZJ8 A;  4RWQ A;  4ECY A;  5BOL A;  4ED2 A;  3GV5 B;  2XY7 A;  3RBE A;  5CP2 A;  2JZB B;  3OHB A;  4ECT A;  4X4P A;  4XQ8 A;  4RQ2 A;  1IM4 A;  3ORY A;  4TUS A;  2ISO A;  1L3T A;  4X4O A;  5J0U A;  3M8R A;  5J2A A;  1H38 A;  1ARO P;  4O3S A;  1U47 A;  4RNN A;  1N56 A;  1SKR A;  1KSP A;  4TUR A;  4GC6 A;  1KFD A;  1ZQG A;  4PHE A;  4J9P A;  2AGO A;  3MGH A;  3EPI A;  3TAP A;  2C28 A;  1LB2 B;  1XSN A;  1FA0 A;  4WC3 A;  2XY5 A;  4QZG A;  4P4P A;  3PX6 A;  2PFO A;  2ZHB A;  5HRE A;  3ISC A;  4MEX A;  5KFF A;  4P2H A;  2FMS A;  2HHQ A;  4C8L A;  3GIM A;  3TFR A;  1BPX A;  8ICH A;  4K4I A;  3H8W A;  5KG5 A;  5J2J A;  5J2D A;  4F5Q A;  3RTV A;  1TK5 A;  9ICM A;  1F5A A;  2FMP A;  1UT5 A;  5J2E A;  2ZH6 A;  4R8U A;  4UAZ A;  1IXR A;  4DOA A;  3BQT A;  1NJZ A;  3ZDB A;  3OVA A;  5F2V O;  3FDS A;  2ZH1 A;  1UT8 A;  1T3N A;  4KLG A;  1BPD A;  2BPC A;  5J0Q A;  1S77 D;  2M2U A;  4S3N A;  5KG0 A;  4YXJ A;  4Q8F A;  7ICS A;  4I2D A;  2J6T A;  3IM1 A;  4NKT A;  2HHS A;  4RPX A;  2VAN A;  2W9B A;  4LZD A;  1CUK A;  5DB6 A;  4IR1 A;  1Y88 A;  4ECS A;  2J6U A;  4RQ3 A;  5III A;  4J9M A;  4ED0 A;  7ICO A;  9ICJ A;  2BCS A;  2KZM A;  1PX5 A;  2XCP A;  1XU4 A;  3RJE A;  4ECQ A;  5KFH A;  3RAX A;  4DSJ A;  7ICG A;  4I29 A;  1Z00 B;  5DBC A;  2ATL A;  5HRL A;  4FH5 A;  4I2H A;  4PGQ A;  4ATB A;  3UXN A;  9ICT A;  5DED A;  7ICT A;  2KFN A;  2ZTC A;  4AT8 B;  1ZJN A;  3KHL A;  4UB3 A;  4WC5 A;  1TKD A;  2AJQ A;  9ICA A;  4LVS A;  2O1P A;  2ZJ5 A;  2R8K A;  1R8C A;  9ICF A;  3HJ4 A;  2ZH2 A;  8ICV A;  2KZ3 A;  4YN4 A;  2O5A A;  1HJP A;  3PR4 A;  1RPL A;  3OVS A;  4F50 A;  1QSL A;  4DF4 A;  4RQ1 A;  1EXN A;  5IIO A;  5J2C A;  3PX4 A;  2R8G A;  1RXV A;  4KIT B;  2AQ4 A;  5IIN A;  5D46 A;  2R8I A;  4NY8 A;  3V6K A;  1ZQN A;  5KFL A;  5DG8 A;  8ICR A;  4F5R A;  4Q44 A;  1S97 A;  1U48 A;  3N97 B;  2FLP A;  4M0A A;  4FHP A;  3QZ8 A;  1JMS A;  3H8J A;  3PO4 A;  4K4G A;  4I2C A;  4Z6E A;  4JWM A;  7ICU A;  4X4N A;  1NK8 A;  5L1K A;  4DSF A;  1SKS A;  3HIY A;  2ZH9 A;  3PR5 B;  3HJ1 A;  1KDH A;  8ICL A;  3H7I A;  5HRK A;  1R8B A;  4E80 A;  5J0P A;  7ICV A;  3MBY A;  1KNY A;  1N48 A;  2NRW A;  4DO9 A;  3TAR A;  3Q8L A;  3RH5 A;  3Q8S B;  5KT6 A;  3PW7 A;  1SKW A;  5CR0 A;  2I9G A;  2AU0 A;  4F3O A;  4RWP A;  3C5F A;  5IIM A;  1ZJM A;  4DQP A;  5HHH A;  4MF2 A;  1TV9 A;  4RZR A;  1ZQZ A;  4I2A A;  1T8E A;  3M9O B;  4F91 B;  8ICN A;  1R8A A;  4G3I A;  3M8S A;  3ZDA A;  4KLI A;  4X4Q A;  4X4V A;  2KZZ A;  5CJ7 A;  4DLG A;  3MR6 A;  2ASL A;  4YXM A;  4M9G A;  4I2I A;  3GII A;  4KLJ A;  4DS4 A;  2ZHA A;  2UVW A;  3RRG A;  5DGA A;  4O5K A;  2ZUC A;  1MIV A;  5HRF A;  4QZI A;  4NLN A;  2ZUD A;  4WC2 A;  9ICB A;  4GXJ A;  5HMM A;  2WTF A;  3L9D A;  4X4S A;  2DR5 A;  1BPY A;  5KFY A;  4YG2 A;  4KN4 A;  3RB3 A;  1ZQQ A;  4DQS A;  1RYR A;  2OWO A;  4B9L A;  4RQ4 A;  1X9W A;  3JPO A;  3RJF A;  1RZT A;  8ICO A;  2M2V A;  1YLQ A;  2NRK A;  1T4G A;  1HUZ A;  2BCU A;  1NKE A;  5KFG A;  8ICG A;  2AGP A;  2AGQ A;  4Q43 A;  2BDP A;  4J9L A;  4ED7 A;  8ICI A;  4X0A A;  1V9P A;  2KTQ A;  5DB9 A;  2RDI A;  4EBK A;  3JZ0 A;  5EWF A;  4I2J A;  5DBA A;  4JV2 A;  1TK0 A;  2MAX A;  4MFC A;  4YD1 A;  4MEY A;  1ZQD A;  4F8R A;  1NOM A;  1BPE A;  1DGS A;  3ZDE A;  3H3A A;  1ZQS A;  4X4T A;  4J9O A;  4UBB A;  4TUP A;  4GXK A;  4FBT A;  1S0V A;  4F4X A;  2FMQ A;  4J9S A;  2UVR A;  4QZC A;  5HR9 A;  3V72 A;  4ECR A;  5HRI A;  4RPZ A;  3SV3 A;  5DEC A;  3H39 A;  4M9H A;  1JIH A;  3RH4 A;  1MIW A;  4F4Z A;  1U9L A;  4C8K A;  1KTQ A;  3BDP A;  3AU2 A;  5KFI A;  3GIL A;  3GQC A;  1NK4 A;  1TVA A;  2A1J B;  4QZD A;  2C2R A;  1SL2 A;  4X4R A;  7ICF A;  3LK9 A;  2KFZ A;  1NJW A;  7ICJ A;  4P4M A;  4QZE A;  1DOQ A;  1BNO A;  3AQK A;  1JXE A;  2ASD A;  1ZQX A;  4F5P A;  4M5D A;  4WBZ A;  1DK2 A;  2B21 A;  4QWB A;  3C2L A;  4JK1 A;  4P4O A;  4Z6D A;  1XWL A;  5EOZ A;  4TQR A;  4ED8 A;  3T5H A;  1RXW A;  1L3U A;  4KLH A;  1QTM A;  4UB5 A;  5J2B A;  4O5C A;  5KG6 A;  1MQ3 A;  4DWI A;  1TAQ A;  2Q0Z X;  4DL6 A;  8ICZ A;  2PFP A;  3ZDD A;  4ZH4 A;  5KT7 A;  5BOM A;  2XC9 A;  3KHG A;  5L9X A;  4DFJ A;  4AT9 B;  3PML A;  3ETL A;  5KFX A;  1K1S A;  5KFN A;  3JPN A;  3C2K A;  3RH6 A;  1UET A;  4KLQ A;  2PBE A;  5KT4 A;  3AU6 A;  4EZ9 A;  4EBC A;  4C8N A;  4O5E A;  2W9C A;  4IQU A;  5KG1 A;  3V6H A;  1BPB A;  4DQI A;  4O0I A;  1R89 A;  2BCR A;  2DR7 A;  1ZQC A;  3PW2 A;  4R66 A;  4FS2 A;  4BWJ A;  9ICH A;  2BHN A;  2HHT A;  1NK9 A;  7ICI A;  4AT7 A;  4KLL A;  3JPR A;  2ID1 A;  3H4D A;  2PI5 A;  4ELT A;  1X9M A;  3WFO A;  5KT2 A;  4BGD A;  5KFO A;  3SI8 A;  2DR8 A;  2C22 A;  3Q8R B;  4DSK A;  4F93 B;  5CWR A;  3PX0 A;  2BPG A;  2PFQ A;  4TUQ A;  5DG7 A;  2BKE A;  4JV0 A;  4ECX A;  1D8Y A;  7ICL A;  2ZTD A;  2H5X A;  5DQG A;  4DL4 A;  3JYY A;  4QWC A;  4WCW A;  3UPS A;  3EYZ A;  4HYK A;  1OU5 A;  3JPT A;  3PNC A;  7ICH A;  3NYB A;  5KG3 A;  1KRP A;  1ZQL A;  2R8J A;  3ISD A;  3AQN A;  3Q8K A;  4B9M A;  4QWA A;  3Q8M A;  3N4M B;  1BPZ A;  3B0Y A;  1MQ2 A;  4UBC A;  5L1L A;  5DDY A;  4EYI B;  4DOB A;  4ECV A;  2UVV A;  4B9U A;  1COO A;  4MFA A;  4J9K A;  2DVI A;  1RYS A;  4QZ9 A;  3HWT A;  1ZET A;  2JEG A;  4B9N A;  4M9N A;  1NK6 A;  2ZH4 A;  1ZQO A;  4M6W A;  4KLU A;  5J2H A;  4E0D A;  3HP6 A;  3V7L A;  3LWM A;  1XS9 D;  8ICK A;  8ICP A;  1U49 A;  1V4A A;  5HP4 A;  4YQW A;  8ICT A;  3EW9 A;  3KTQ A; 
#chains in the Genus database with same CATH topology
 2MRL A;  3KBB A;  8ICS A;  5CB1 A;  7ICR A;  2WF8 A;  1QQ6 A;  1ZQP A;  3ZD9 A;  2D8C A;  3OJU A;  5F3X B;  1UCV A;  2IUB A;  5J0T A;  4QIW C;  4IQV A;  2M2W A;  5AKJ A;  4O3R A;  3CYM A;  3C1Z A;  4Q45 A;  3T5L A;  3M9M B;  4R8U B;  3QEB Z;  1O08 A;  2YMM A;  3QU2 A;  2XO7 A;  2PFN A;  1Z1B A;  4YMN A;  1ZQR A;  2VA2 A;  1JUD A;  1RQN A;  5KFT A;  2ESE A;  9ICX A;  5KTQ A;  2JH7 A;  2DBY A;  1NJY A;  3OVB A;  2W9A A;  4IRD A;  5KFQ A;  1A76 A;  1ZD4 A;  1BGX T;  1KFT A;  1WCN A;  2RLT A;  2I5H A;  3GIK A;  3EWA A;  4F2S A;  5KFA A;  5D49 A;  7ICQ A;  3KKA C;  4X0B A;  2K8B B;  2R8H A;  2HW3 A;  3MDC A;  1L7P A;  3SAG A;  4R65 A;  2KN7 A;  3VCB A;  4IQW A;  2Q4T A;  2Q66 A;  2DUY A;  4GLX A;  3WFS C;  3MGI A;  1KQQ A;  4I2G A;  3NWI A;  4RT2 A;  3MR2 A;  1Z3E B;  5HRG A;  1DXS A;  2KJ5 A;  4BWM A;  1LKY A;  2ZXH A;  4IC9 A;  4UB8 U;  3C21 A;  2BQU A;  4F2R A;  1JRP A;  5T14 A;  4I2B A;  1QSS A;  3RBD A;  1Z4N A;  7ICK A;  3SEN A;  9ICV A;  1X9X A;  5KFZ A;  5HC9 A;  4R64 A;  4UB2 A;  1ZQE A;  2EDU A;  5KFB A;  1GO3 F;  5DLG A;  1B22 A;  2BE3 A;  2KHQ A;  3DV9 A;  4O68 A;  5AKL A;  4GFJ A;  2B51 A;  3MAB A;  3MDA A;  1N5X A;  3AQM A;  5DGB A;  2E3T A;  2PMZ C;  4DFK A;  4I2E A;  1NK0 A;  1MSW D;  3BQ1 A;  3C5G A;  7ICE A;  1PK1 A;  2O6K A;  5J0W A;  1ZQY A;  1ZQI A;  4FH3 A;  1ZQF A;  1LV5 A;  4LT6 A;  1L7N A;  3LQC B;  4YR0 A;  3IDW A;  5DG9 A;  3NTU A;  3A0B U;  4XQ7 A;  1XC9 A;  3GV8 B;  2Y1I A;  1XSP A;  4KN7 A;  2JRZ A;  4MHV A;  7ICM A;  4DFM A;  3PW0 A;  2V4Q A;  4PZN A;  2EZY A;  3H4B A;  3PSI A;  2F76 X;  3ISB A;  4RQ5 A;  1N61 A;  3V6J A;  4RQ7 A;  2FPL A;  4C4T A;  2HHX A;  1IV8 A;  3HKZ F;  4RWO A;  2NRZ A;  9ICI A;  2YQE A;  2EZZ A;  1ZQM A;  1KFS A;  1NZB A;  4NLZ A;  1QQ5 A;  3G6Y A;  4M47 A;  2W9M A;  3RR8 A;  2ZIU B;  5AI0 A;  4F5O A;  2J6S A;  4O3M A;  3PMN A;  1ZQA A;  2BBH A;  2KIW A;  4PH5 A;  1OUQ A;  1M6Y A;  4ED6 A;  1OW5 A;  4WC4 A;  5J0O A;  5JUM A;  4WJ3 B;  4OAI Z;  5AKH A;  1UA1 A;  3ERC C;  5J29 A;  2GO7 A;  1HEK A;  4F92 B;  4RPY A;  3ONN A;  2MUT B;  2EAP A;  3KFU F;  1PZN A;  2DR9 A;  4FO6 A;  3UMB A;  4QNL A;  4DL7 A;  4EX7 A;  4ECW A;  1JN3 A;  3OSP A;  2QLT A;  3SV4 A;  4UAR A;  4BXO B;  1S5L U;  3C2M A;  2FLL A;  3WK9 A;  2GAF D;  5EE9 A;  4C8M A;  1BNP A;  1ED1 A;  2M0N A;  1A6S A;  2HOQ A;  3ALR A;  3C29 A;  5J2G A;  2DGZ A;  2ODG A;  4RU9 A;  4ECZ A;  3UQ2 A;  7ICP A;  1ZQT A;  5J0Y A;  2ZJ8 A;  4AP9 A;  4RWQ A;  1SIJ A;  5BOL A;  5KL8 B;  3OHB A;  3N28 A;  4TUS A;  1L3T A;  5J2A A;  1H38 A;  2KIV A;  1N56 A;  3IG5 A;  4O3S A;  3BS7 A;  4PHE A;  2HDO A;  2XY5 A;  3PX6 A;  5KFF A;  1ZD3 A;  5ALV A;  4C8L A;  1BPX A;  2KHV A;  3H8M A;  8ICH A;  4K4I A;  1TK5 A;  2IOF A;  4K8V A;  3LVW A;  4R8U A;  2K4E A;  5KAI U;  1FFV A;  2M2U A;  4S3N A;  4YXJ A;  1SZH A;  4Q8F A;  1KKX A;  4NL9 A;  4RPX A;  3QUC A;  5DB6 A;  1Y88 A;  3LYS A;  5III A;  7ICO A;  4OAH A;  3AM9 A;  2KZM A;  4C4S A;  1XU4 A;  7ICG A;  1Z00 B;  2ATL A;  1S8O A;  3WKD A;  5DED A;  9ICT A;  7ICT A;  1ZJN A;  4NJ8 A;  1TKD A;  4LVS A;  2O1P A;  2ZH2 A;  2O5A A;  1HJP A;  5CFT A;  4F50 A;  3NVO A;  2AQ4 A;  5IIN A;  8ICR A;  3V6K A;  1ZQN A;  5B3P A;  5DG8 A;  2K4H A;  4Q44 A;  2FLP A;  3QZ8 A;  4LEZ A;  4I2C A;  4Z6E A;  4X4N A;  1SWW A;  3MC1 A;  2K8A A;  2W43 A;  2ZH9 A;  3PR5 B;  3H7I A;  4US9 A;  1SGG A;  1ZXI A;  2NRW A;  3ETR A;  4RWP A;  1ZJM A;  4MF2 A;  4RZR A;  1ZQZ A;  1R8A A;  1T8E A;  3M9O B;  4G3I A;  2F2A B;  3ZDA A;  1Q46 A;  1VJ5 A;  4DLG A;  4M9G A;  2B6G A;  4I2I A;  3ZI4 A;  2UVW A;  4N7R A;  2ZUC A;  3WK6 A;  4NLN A;  2WTF A;  2DKX A;  4KN4 A;  4CF5 A;  1ZQQ A;  2OWO A;  2M2V A;  3JPO A;  2JMG A;  2NRK A;  2AGP A;  4Q43 A;  4J9L A;  3JZ0 A;  4CF4 A;  4JB3 A;  2W3R A;  5DBA A;  1Q3V A;  2G07 A;  4DCC A;  2MAX A;  1ZOL A;  2QKQ A;  4F8R A;  3F2C A;  1DGS A;  5EE3 A;  1Z19 A;  4TUP A;  1S0V A;  4F4X A;  2FMQ A;  4U6P A;  3F2D A;  4QZC A;  2FCL A;  3V72 A;  1URJ A;  5HRI A;  3SV3 A;  3SAH A;  2W3S A;  1JIH A;  1Q3U A;  4C8K A;  3GQC A;  1TVA A;  2A1J B;  4QZD A;  2C2R A;  3LK9 A;  2JH1 A;  2YY6 A;  4QZE A;  1ZRM A;  4M5D A;  2B21 A;  4TQR A;  1XWL A;  1JAL A;  1TAQ A;  5CHE A;  4FZN A;  4DL6 A;  8ICZ A;  3PST A;  1FO4 A;  3ZDD A;  1COK A;  1XO0 A;  5KFX A;  3JPN A;  1OXJ A;  3C2K A;  1WG8 A;  4EV6 A;  1K5O A;  5KT4 A;  4WQL A;  4DQI A;  1BPB A;  1R89 A;  3UMC A;  2BHN A;  1X9M A;  3WFO A;  4F93 B;  5EE0 A;  2PFQ A;  5DG7 A;  2BKE A;  4JV0 A;  4ECX A;  2ZIU A;  5FP0 A;  4CE6 A;  3PNC A;  4Y2J A;  3JPT A;  7ICH A;  5KG3 A;  1KRP A;  3NYB A;  1CRX A;  1BPZ A;  1SWV A;  4EYI B;  5DDY A;  4DOB A;  4ECV A;  4MFA A;  2DVI A;  1RYS A;  2JEG A;  4B9N A;  4M9N A;  5D61 A;  2QB1 A;  3HP6 A;  1Q8K A;  1XSL A;  2ZH7 A;  2ASJ A;  5ALG A;  4RNM A;  2QB0 B;  2HBL A;  3M9N B;  2ZIX B;  4P0P B;  4LEY A;  2AH5 A;  1KW4 A;  2F1H A;  2EQY A;  1NKB A;  5IIK A;  4F71 A;  3C18 A;  2Y0S C;  4Q8E A;  4UAU A;  4FFD A;  8ICM A;  5AM3 A;  4EBD A;  1S10 A;  4FZL A;  5HRH A;  3AUO A;  3NVY A;  4PHA A;  1Z4O A;  2E5S A;  2ZXI A;  2ZJA A;  1A0P A;  4BXO A;  1D8L A;  5KFE A;  2KKP A;  3GZF A;  3BJY A;  2BBJ A;  3UM9 A;  1S0N A;  2NO5 A;  5EWG A;  2P66 A;  2W04 A;  3MR5 A;  4ED3 A;  3L4P A;  4F4W A;  4IRC A;  4F72 A;  2W11 A;  4R63 A;  4YP3 A;  3SYZ A;  3C1Y A;  3D2Q A;  3HPO A;  3KD3 A;  1WYG A;  1DRG A;  4K4H A;  4B9T A;  4FHX A;  4MF8 A;  4WBY A;  3G6V A;  1SZP A;  2WHE A;  3QU9 A;  4DQR A;  2JEF A;  4NM1 A;  5BPC A;  2OH2 A;  1T7P A;  3WFQ E;  4J03 A;  2H3V A;  1TFR A;  3H38 A;  2W8L A;  1A77 A;  2M9N A;  5HNK A;  4YMM A;  1VFG A;  2IBK A;  1CEZ A;  3HJE A;  4K96 A;  4YD2 A;  1KEJ A;  4C4R A;  2FLN A;  5DB7 A;  2K4I A;  4XRH A;  2RHF A;  5B5E U;  4QWD A;  1B43 A;  3OGU A;  3GIJ A;  4O69 A;  1ZD5 A;  4YR2 A;  1RQL A;  5TZV A;  4F4K A;  3H8S A;  3HW8 A;  2KIC A;  1NI3 A;  4ECU A;  1Z00 A;  4M2Y A;  2YML A;  4NXZ A;  2FJ6 A;  5KT3 A;  5AM5 A;  2E1F A;  9ICE A;  5KFJ A;  3WKC A;  1U4B A;  3PSF A;  3LDA A;  3Q8Q B;  2BR0 A;  4NWI A;  7ICN A;  2CXY A;  3TAC B;  4WOY A;  2ZTE A;  4M04 A;  2LBO A;  3K7D A;  5CEH A;  2C2E A;  8ICB A;  1S76 D;  5L1I A;  1V85 A;  2KNJ A;  1B0X A;  1J97 A;  3NS1 A;  4Z6F A;  2YTU A;  4DF8 A;  2ZH5 A;  4DLE A;  1PVR A;  3IRU A;  4M9J A;  5B66 U;  1YZ6 A;  3D2S A;  2DRB A;  4IL6 U;  1C20 A;  4K9B A;  3OUY B;  4DL5 A;  2CN1 A;  2KVS A;  2JEJ A;  1ZYQ A;  4LJX A;  1VLB A;  5J0S A;  3PO5 A;  1SL0 A;  5HHI A;  5KFD A;  2P6R A;  4RUC A;  1MN8 A;  2HI0 A;  1UEV A;  5G5H A;  5IIL A;  3NRZ A;  3WFR E;  1HUO A;  5HR7 A;  3FYH A;  1WCL A;  1X6J A;  2BQR A;  1NO5 A;  4NXX A;  3KZI U;  1ZQ1 C;  5K4L A;  4UD4 A;  2YB1 A;  3BS5 B;  2JEI A;  2XCA A;  4ELU A;  4WC1 A;  2UVU A;  1Q79 A;  5J2F A;  3MFH A;  4X4U A;  2A1J A;  3GV7 B;  2HHP A;  2F8L A;  2EAN A;  1DK3 A;  2W7P A;  5IIJ A;  1XNS A;  2WF7 A;  2H3F A;  2WAQ F;  5AIC A;  5ALU A;  1NKC A;  5H2F U;  4DSE A;  1NK5 A;  3CW2 C;  4TQS A;  3JPP A;  2K8C B;  5KG2 A;  4EZ6 A;  2KSO A;  5KFS A;  4EBJ A;  1YT3 A;  1D8B A;  4O9M A;  3V7J A;  1NZP A;  4OAG A;  5C0Y A;  2BQ3 A;  3Q8P B;  4RUA A;  4UD5 A;  4RQ0 A;  2ZH3 A;  4DEZ A;  3AMZ A;  3T5K A;  5J2I A;  2DF4 B;  4ECY A;  2JZB B;  3ORY A;  2ISO A;  4X4O A;  1V97 A;  5J0U A;  3M8R A;  3T79 A;  3NKU A;  1KSP A;  4Y2P A;  1ZQG A;  2G5I B;  1LB2 B;  2QB0 A;  3TAP A;  1FA0 A;  2ZIX A;  4P4P A;  4P0P A;  5HRE A;  4MEX A;  4P2H A;  4KMO B;  5AHX A;  3H8W A;  5J2J A;  9ICM A;  3N7P D;  3RTV A;  2HMX A;  2FMP A;  4UAZ A;  3ZDB A;  3IV6 A;  1T3N A;  5AKK A;  7ICS A;  4NKT A;  3IM1 A;  3C28 A;  4IR1 A;  1X66 A;  2HN1 A;  2K89 A;  4DSJ A;  4ECQ A;  5KFH A;  3PZP A;  3K1Z A;  2D3D A;  4AT8 B;  2ZTC A;  3KHL A;  4QIW F;  1FIQ A;  1R8C A;  3HJ4 A;  8ICV A;  3QU5 A;  2Y9U A;  1QSL A;  3PX4 A;  1EXN A;  5IIO A;  5J2C A;  3F5A A;  4I0U A;  4NY8 A;  4F5R A;  1S97 A;  3N97 B;  4K4G A;  2WF9 A;  4JWM A;  4OJ5 A;  1ECW A;  8ICL A;  1R8B A;  2HN2 A;  5J0P A;  7ICV A;  3MBY A;  2I9G A;  4NLB A;  3Q8S B;  5KT6 A;  2ES6 A;  1LVH A;  4KLI A;  4X4Q A;  3CK6 A;  3SR6 A;  2KZZ A;  5CJ7 A;  2ASL A;  3GII A;  1J2M A;  3RRG A;  4O5K A;  1X42 A;  1MIV A;  4FZM A;  2GLE A;  1FFU A;  5HMM A;  2DR5 A;  3L9D A;  2IOH A;  3RB3 A;  4DQS A;  4B9L A;  8ICO A;  4RQ4 A;  1RZT A;  1TE2 A;  4X0A A;  1V9P A;  2RDI A;  4EGW A;  1RYU A;  4I2J A;  1KBU A;  4JV2 A;  5KAF U;  4MFC A;  3WK7 A;  1NOM A;  4PZO A;  3ZDE A;  1ZQS A;  1T3Q A;  3FAH A;  4UBB A;  1IG6 A;  3ER9 B;  4CRX A;  4RQM A;  4ECR A;  3H39 A;  5AKG A;  2QAR A;  3RH4 A;  3GIL A;  3WKB A;  1SL2 A;  4NL9 C;  1NJW A;  7ICJ A;  1ZD2 P;  4P4M A;  3EUB 2;  5L1M A;  3SD7 A;  4QWB A;  3C2L A;  4JK1 A;  1L3U A;  4Z6D A;  1AQ6 A;  5J2B A;  3I28 A;  5KG6 A;  2PMZ F;  3J81 j;  4DWI A;  2Q0Z X;  3AQE A;  4ZH4 A;  2XC9 A;  4AT9 B;  4OJP A;  1ZRN A;  3ETL A;  2PBE A;  3N7S C;  4JMU A;  4EZ9 A;  2BZF A;  4IQU A;  5EE1 A;  3V6H A;  1N62 A;  1ZQC A;  3PW2 A;  9ICH A;  1NK9 A;  3AN1 A;  3CRX A;  4ELT A;  2OEH A;  5KT2 A;  4BGD A;  3SI8 A;  2C22 A;  3Q8R B;  2FDR A;  5JU5 A;  4TUQ A;  2A1A A;  1D8Y A;  2ZTD A;  5DQG A;  3EYZ A;  4HYK A;  3U26 A;  3Q8K A;  4QWA A;  2MU2 A;  3HRD D;  2UVV A;  4B9U A;  1COO A;  4QZ9 A;  3HWT A;  1ZET A;  4E0D A;  3V7L A;  1XS9 D;  8ICK A;  1U49 A;  1V4A A;  4YQW A;  1WWU A;  8ICT A;  5GTH U;  2IHN A;  4EED A;  4RT3 A;  4CCH A;  3V7K A;  2OYY A;  2MSN A;  4G9B A;  3H0M B;  4F4Y A;  2CRX A;  3RB4 A;  2EZX A;  5HML A;  3QEA Z;  3BQ0 A;  2W55 A;  4E7X A;  2VKQ A;  4I27 A;  3H0R B;  3IHQ B;  1NK7 A;  1ZQV A;  1WOT A;  2DRA A;  3PW5 A;  2G5H B;  4J9R A;  2VA3 A;  5KFV A;  1PUZ A;  2W9B B;  8ICX A;  3PW4 A;  2PXI A;  3SEI A;  4Z6C A;  4EEB A;  4ATB B;  4LZG A;  4UAS A;  2IMW P;  3TFS A;  5F9L A;  2HCF A;  1WUD A;  1X9S A;  2K4P A;  2ALZ A;  1PVP A;  3BQ7 A;  1IIP A;  4EBE A;  3OWG A;  2YMP A;  4Y2Q A;  2KG5 A;  5J0X A;  3C23 A;  4GXI A;  3I76 A;  1TAU A;  2FPM A;  4KTQ A;  3THV A;  1JX4 A;  5J0R A;  4YMO A;  4OO1 J;  2BCV A;  3D2N A;  4BJQ A;  1B4F A;  5DDM A;  3WU2 U;  4FHV A;  4PHP A;  4QZA A;  1F44 A;  3WKA A;  2HVH A;  2CPR A;  2LPE A;  2I1Q A;  1XO1 A;  1T94 A;  2C2D A;  5EWE A;  4QZ8 A;  4PHD A;  4DL3 A;  3D6J A;  3B0X A;  5AIB A;  3S6J A;  4UQG A;  4B9V A;  1MC8 A;  3AQL A;  4OCZ A;  3RJG A;  4UB6 U;  2NRV A;  4J9Q A;  4KX5 A;  1ZQK A;  3QXG A;  8ICY A;  4C80 A;  3KHH A;  3RRH A;  3NGD A;  3RJH A;  2IHO A;  2A19 A;  4J9N A;  4AT8 A;  2KOB A;  3QU4 A;  2NRT A;  2HHV A;  4OD0 A;  3QE9 Y;  9ICP A;  2VA8 A;  4DSI A;  3RB0 A;  3OPX A;  3VC8 A;  3WK5 A;  5KFK A;  4KLE A;  5F9N A;  1NNL A;  9ICK A;  1L7M A;  5AI4 A;  3OJS A;  4OAF A;  3TQ1 A;  2DL0 A;  3RJJ A;  1UQV A;  2HHU A;  2WFA A;  3RR7 A;  5KG7 A;  2F44 A;  3ZDC A;  2ZIW B;  5KFU A;  2EAO A;  3EZ5 A;  3M7D A;  2WF6 A;  2WB1 C;  5C5J A;  3UQ0 A;  4AYB C;  2G08 A;  1JQR A;  1WWV A;  2W8K A;  5DQH A;  4KLO A;  3GFK B;  4UW9 A;  3SMV A;  9ICR A;  8ICJ A;  3OTQ A;  2MUT A;  2KK0 A;  4PGY A;  4UAY A;  1UEU A;  4YCX A;  2GOL A;  1DGJ A;  2OM6 A;  5AI5 A;  1D9F A;  5KFM A;  2KP7 A;  2OXO A;  2HVI A;  4FHW A;  2I6X A;  2XIC A;  1VJ7 A;  3RB6 A;  3E2E A;  3QUB A;  3UXO A;  3RF9 A;  5KL1 B;  4EEY A;  4NM2 A;  8ICE A;  2M2T A;  2YN4 A;  4HX0 A;  5AI8 A;  4OJO A;  4BX9 C;  3GDX A;  9ICW A;  2KJ8 A;  4RQ8 A;  3WKE A;  4RQ6 A;  8ICU A;  5ALI A;  4UB1 A;  4JLZ A;  3NUQ A;  2NV3 A;  4KLM A;  4C0Z A;  3PVX A;  4AT9 A;  1HIW A;  5ALW A;  4O3Q A;  3K4G A;  1L6N A;  3AL0 B;  4DSL A;  4RNO A;  3TAD C;  1UA0 A;  5CRX A;  3QX7 A;  8ICQ A;  3LWL A;  4A8E A;  4K9A A;  5L1J A;  1JXL A;  4YFK A;  4K97 A;  3QUQ A;  1QSY A;  9ICQ A;  5AM2 A;  2EAM A;  3WFP A;  4PL1 A;  3H40 A;  4X4R A;  1F5A A;  5KT5 A;  5J2K A;  3OV7 A;  2RP5 A;  4ED1 A;  4Y2Y A;  9ICO A;  3GV5 B;  2XY7 A;  5CP2 A;  4ECT A;  3NVW A;  4X4P A;  4P0Q B;  1Z1V A;  2LM1 A;  3QUT A;  5ALO A;  4RNN A;  4HAI A;  3TAD A;  2PFO A;  2LHT A;  3ISC A;  3O0F A;  4KM5 A;  5ALE A;  3TKA A;  3TFR A;  2GH1 A;  5KG5 A;  3AQF A;  1IXR A;  4DOA A;  3BQT A;  1NJZ A;  5F2V O;  2VJ4 A;  3DDH A;  1BPD A;  2BPC A;  4Y2R A;  5KG0 A;  4I2D A;  2J6T A;  1KL9 A;  2FE9 A;  2HHS A;  2W9B A;  4LZD A;  1CUK A;  3R9K A;  4ECS A;  9ICJ A;  4RQ3 A;  4ED0 A;  4I29 A;  5DBC A;  5HRL A;  4FH5 A;  4ATB A;  4I2H A;  1F5S A;  2KFN A;  5AKX A;  1VDV A;  3F5E A;  4JLX A;  3CP8 A;  2ZJ5 A;  2R8K A;  2Y0S F;  1RPL A;  4DF4 A;  5ALQ A;  4RQ1 A;  2R8G A;  1RXV A;  3HKZ C;  4KIT B;  4ZOH C;  5GTI U;  4CF3 A;  3PO4 A;  3H8J A;  3KOO A;  7ICU A;  2VJ5 A;  4DSF A;  4OJL A;  3HJ1 A;  5HRK A;  2LYA A;  4PJ0 U;  1KNY A;  1N48 A;  2EH9 A;  4DO9 A;  4F3O A;  5B3Q A;  5AI6 A;  2AU0 A;  3C5F A;  5IIM A;  3M6Z A;  1TV9 A;  4F91 B;  8ICN A;  4X4V A;  2XI9 A;  3MR6 A;  5ALN A;  4DS4 A;  2DQN B;  5A0L A;  5HRF A;  4QZI A;  3B9J A;  3IN5 A;  2ZUD A;  4WC2 A;  5HR6 A;  3BZC A;  5KFY A;  1BPY A;  1RYR A;  1L8L A;  1X9W A;  1YLQ A;  2KD1 A;  5AKI A;  1T4G A;  1HUZ A;  2BCU A;  1NKE A;  5KFG A;  4IS7 A;  5DB9 A;  4EBK A;  4MEY A;  4EEL A;  1ZQD A;  3H3A A;  3NVV A;  3QYP A;  1SV4 A;  4GXK A;  2UVR A;  1SV0 C;  1MIW A;  4F4Z A;  1KTQ A;  2HOI A;  3M6K A;  3AQK A;  1DOQ A;  1SXE A;  1ZQX A;  4F5P A;  1DK2 A;  4ED8 A;  5EOZ A;  3L5K A;  1RXW A;  4KX3 A;  2ZIW A;  2RRD A;  1MQ3 A;  2PFP A;  5KT7 A;  1K1S A;  5KFN A;  2E8N A;  5AKY A;  5ALL A;  3RH6 A;  4EEK A;  2YX8 A;  4KLQ A;  4PL2 A;  3AU6 A;  4O5E A;  3KKA A;  4Y2U A;  2DR7 A;  2BCR A;  5E79 U;  3AEV A;  4R66 A;  5G5G A;  4BWJ A;  4FS2 A;  2HHT A;  7ICI A;  3IP4 B;  4KLL A;  3JPR A;  2ID1 A;  2PI5 A;  2DR8 A;  1SV0 A;  2E1E A;  1UHU A;  2H3I A;  2OCE A;  3E0F A;  7ICL A;  3SAF A;  2G09 A;  3ED5 A;  3NVZ A;  3JYY A;  2KKV A;  4WCW A;  1OU5 A;  1ZQL A;  3AQN A;  1PVQ A;  2W03 A;  3Q8M A;  3N4M B;  2MA1 A;  1MQ2 A;  5L1L A;  1ZQO A;  4KLU A;  5AK3 A;  1P7D A;  3LWM A;  5HP4 A;  3EW9 A;  8ICW A;  1RM6 C;  4UAW A;  4EX6 A;  1L3V A;  4I2F A;  1X6I A;  2ZIV B;  2Y1J A;  2F77 X;  5HRB A;  2DFL A;  4CNQ A;  5DBB A;  3H37 A;  3M1Y A;  1ZQW A;  2KMD A;  2FPK A;  4NXT A;  3TI0 A;  1PK3 A;  3FC4 A;  1TK8 A;  4KLF A;  2BCQ A;  3OSN A;  5AK5 A;  4KMU A;  4ICA A;  4DFD A;  4JUZ A;  4Y2S A;  4CDG A;  5AI9 A;  4U7C A;  1TFW A;  3CNH A;  5KG4 A;  2RQ5 A;  4FE3 A;  4XA5 A;  2OHF A;  1TFY A;  3JCF A;  2AHO B;  1ZQU A;  4NXW A;  2XGQ A;  1S9F A;  4WC6 A;  3UPQ A;  2H3Q A;  5AKZ A;  5JRT A;  2HHW A;  2JV3 A;  3EPG A;  1RG6 A;  5CHG A;  4P0Q A;  2BPF A;  2V4R A;  2LYH A;  2F1J A;  9ICU A;  1JRO A;  5DLF A;  4UB4 A;  4JV1 A;  3OHA A;  1GPJ A;  2LI6 A;  5ALK A;  4PPX A;  3N7R C;  2V9W A;  3SZ2 A;  2L5Y A;  2D6F C;  9ICC A;  2IOF K;  3K1R B;  4ACO A;  3T5J A;  5J8Y C;  4FS1 A;  4KLS A;  3K75 D;  2E8M A;  4E8F A;  4LEW A;  2FI1 A;  4IRK A;  1QLN A;  3HX0 A;  2JXJ A;  3MFI A;  3JPQ A;  2GWS A;  3RJK A;  2HBM A;  5JTI A;  4GC7 A;  2DPI A;  3OUY A;  8ICF A;  5HRD A;  1N63 A;  2YB4 A;  1L7O A;  2Y9T A;  2DPJ A;  5JTG A;  1S0M A;  4NXV A;  5ALS A;  2ISP A;  5AM0 A;  4QZB A;  9ICG A;  5KFR A;  2JR5 A;  2XGP A;  4X5V A;  4US8 A;  5AK4 A;  1ZQJ A;  2AQ0 A;  3T3F A;  2HBK A;  4DFP A;  3BQ2 A;  4KLD A;  4I28 A;  5J8Y A;  4XJE A;  5KFC A;  4YR3 A;  3A0H U;  4MKP A;  4PGX A;  4ELV A;  4DL2 A;  2DKZ A;  3PV8 A;  4WC7 A;  4QZF A;  4DQQ A;  3BS5 A;  2B56 A;  3UXP A;  4QW9 A;  4EP7 A;  8ICA A;  2DWQ A;  4O3P A;  4BDP A;  1QQ7 A;  5AM4 A;  4JWN A;  2IHM A;  3RAQ A;  4Y2V A;  5D4B A;  4C7Y A;  2W9C B;  5DKW A;  5DQI A;  4FHY A;  3ZD8 A;  4NLC A;  4AT7 B;  4C8O A;  1D9D A;  5KNI A;  1KN5 A;  3MCR A;  3G6X A;  3HT3 A;  4NKU A;  2NO4 A;  4MFF A;  5AM1 A;  3QZ7 A;  3MR3 A;  1KLN A;  9ICL A;  4O67 A;  2NYV A;  4RWN A;  2P35 A;  1NJX A;  9ICN A;  3C66 A;  2XID A;  1N5W A;  1X2I A;  2Z7J A;  4B9S A;  4DOC A;  1S0O A;  3EF2 A;  4NLK A;  4O3N A;  2XY6 A;  1K1Q A;  4M6W B;  1QCK A;  4XUS A;  3MGV A;  2A3V A;  1F0M A;  2NRX A;  5KFW A;  4EEN A;  4WC0 A;  1UPH A;  1ZQB A;  1SL1 A;  3DEE A;  2JZB A;  5ALD A;  4QJF B;  3SQI A;  2F1I A;  1N2X A;  4O3O A;  1JAJ A;  5KFP A;  2W54 A;  1BVS A;  4BUG A;  3TAQ A;  2KV2 A;  2BGW A;  2JGA A;  3KHR A;  1TAM A;  4QWE A;  4EYH B;  3TAN A;  5CFU A;  2B0C A;  2PI4 A;  5ALY A;  4FBU A;  1J2N A;  4KLT A;  2GA9 D;  2ZUB A;  5CA7 A;  4UAV A;  4F5N A;  1MIY A;  4IQT A;  2R18 A;  1JI7 A;  2RFF A;  5AK6 A;  2HOF A;  4DS5 A;  4NLG A;  5D62 A;  3L3F X;  4QW8 A;  4IR9 A;  1Q78 A;  1ZQH A;  4QZH A;  9ICS A;  2K60 A;  1MA7 A;  8ICC A;  2P6U A;  2RDJ A;  1U45 A;  5ALF A;  4IG8 A;  1L5U A;  4M9L A;  5ALP A;  3PY8 A;  4O6A A;  3JPS A;  4YVZ A;  3RJI A;  2IA6 A;  4K99 A;  2F3N A;  5DB8 A;  4ED2 A;  4UAT A;  4Y2X A;  3RBE A;  2E8P A;  4XQ8 A;  2G0A A;  4RQ2 A;  1IM4 A;  3HIL A;  2EWR A;  5D63 A;  1ARO P;  1U47 A;  1RDF A;  1SKR A;  4TUR A;  4GC6 A;  1KFD A;  4J9P A;  2AGO A;  3MGH A;  3EPI A;  2C28 A;  2ZHA A;  1XSN A;  2ZIV A;  4WC3 A;  4QZG A;  2KSO B;  3I1Y A;  2ZHB A;  2KEY A;  3NRW A;  2G06 A;  5ALX A;  2FMS A;  2HHQ A;  4LEV A;  1LKY B;  3GIM A;  2B4V A;  5J2D A;  4F5Q A;  1UT5 A;  5J2E A;  2ZH6 A;  3OVA A;  3FDS A;  2ZH1 A;  1UT8 A;  4KLG A;  1S77 D;  5J0Q A;  2E8O A;  2LKY A;  3F53 A;  2VAN A;  3PSP A;  4C7Z A;  2H3Z A;  3QNM A;  2J6U A;  4NXU A;  4J9M A;  2BCS A;  1PX5 A;  2XCP A;  1V38 A;  3RJE A;  1YZ7 A;  3RAX A;  4USA A;  4CGZ A;  4PGQ A;  4FO1 A;  3UXN A;  4UB3 A;  4WC5 A;  2AJQ A;  9ICA A;  9ICF A;  1PK1 B;  2KZ3 A;  4YN4 A;  3PR4 A;  1L8O A;  3KZX A;  3OVS A;  5ALJ A;  3LVV A;  2HBJ A;  5D46 A;  2JHD A;  2R8I A;  5KFL A;  1U48 A;  4M0A A;  4FHP A;  1JMS A;  1NK8 A;  5L1K A;  1SKS A;  3HIY A;  1KDH A;  2KVC A;  1SB3 C;  1C7Y A;  4Y2T A;  1N60 A;  3TAR A;  3Q8L A;  3RH5 A;  1SKW A;  3PW7 A;  3ER8 C;  5CR0 A;  2ZH8 A;  1SXD A;  5ALT A;  4DQP A;  5HHH A;  4I2A A;  4KB6 A;  1O03 A;  3M8S A;  4YXM A;  4KLJ A;  5DGA A;  2KJ9 A;  9ICB A;  4GXJ A;  4X4S A;  4YG2 A;  3GU3 A;  5CFS A;  2KE7 A;  3RJF A;  3FM9 A;  3QU7 A;  3ICX A;  8ICG A;  2AGQ A;  2BDP A;  2YMQ A;  4ED7 A;  8ICI A;  2KTQ A;  5ALH A;  5EWF A;  1TK0 A;  2WAQ C;  4YD1 A;  1BPE A;  4X4T A;  4J9O A;  4B6J A;  4FBT A;  4J9S A;  4K98 A;  5HR9 A;  3RFA A;  4RPZ A;  5ALM A;  3NAS A;  5DEC A;  2W7O A;  4M9H A;  3E58 A;  1U9L A;  2LYB A;  3BDP A;  3AU2 A;  5KFI A;  1NK4 A;  1L3S A;  1QH9 A;  5TIS U;  7ICF A;  1BNO A;  4OJ6 A;  1JXE A;  2ASD A;  1X40 A;  4WBZ A;  3F2B A;  1NK6 A;  2KFZ A;  4P4O A;  4KLH A;  3T5H A;  2PKE A;  1QTM A;  2LM4 A;  4UB5 A;  4O5C A;  2HSZ A;  5BOM A;  3KHG A;  5L9X A;  4DFJ A;  5AIA A;  3PML A;  1UET A;  4E80 A;  2VIX A;  3WK8 A;  4EBC A;  4C8N A;  4WH5 A;  2W9C A;  5KG1 A;  4O0I A;  2XVT A;  3IG8 A;  4GIB A;  3WK4 A;  4AT7 A;  3H4D A;  5KFO A;  4DSK A;  5CWR A;  2F8K A;  3PX0 A;  2BPG A;  1FEZ A;  4NV0 A;  2H5X A;  5ALR A;  4DL4 A;  4QWC A;  3UPS A;  2QAR B;  2R8J A;  2WB1 F;  3ISD A;  2BDU A;  4B9M A;  3UMG A;  4AYB F;  5ALZ A;  3B0Y A;  4UBC A;  2AXT U;  4J9K A;  4WQK A;  3H0L B;  2LMR A;  4RQN A;  2ZH4 A;  4M6W A;  2N1R A;  5J2H A;  3PHZ A;  2ZG6 A;  8ICP A;  1CI4 A;  3BZK A;  2WF5 A;  5AKE A;  3KTQ A; 
#chains in the Genus database with same CATH homology
 1XSL A;  2IHN A;  2ASJ A;  2ZH7 A;  8ICW A;  4UAW A;  4RT3 A;  8ICS A;  5CB1 A;  4RNM A;  1L3V A;  3V7K A;  4CCH A;  3M9N B;  7ICR A;  4I2F A;  1ZQP A;  3ZD9 A;  4F4Y A;  2Y1J A;  3OJU A;  2F1H A;  5HRB A;  2DFL A;  5J0T A;  3RB4 A;  3H37 A;  4IQV A;  5DBB A;  2M2W A;  1NKB A;  5HML A;  5IIK A;  3BQ0 A;  3QEA Z;  1ZQW A;  4O3R A;  3C18 A;  3C1Z A;  4Q8E A;  4E7X A;  4Q45 A;  3T5L A;  2FPK A;  3M9M B;  4R8U B;  4I27 A;  3QEB Z;  3TI0 A;  8ICM A;  4EBD A;  1S10 A;  1TK8 A;  4KLF A;  2BCQ A;  3IHQ B;  3OSN A;  4KMU A;  3AUO A;  5HRH A;  1NK7 A;  1ZQV A;  4PHA A;  2XO7 A;  1WOT A;  3PW5 A;  2PFN A;  2DRA A;  4J9R A;  2VA3 A;  5KFV A;  4YMN A;  4JUZ A;  1C7Y A;  2W9B B;  1ZQR A;  2VA2 A;  2ZJA A;  4BXO A;  1D8L A;  8ICX A;  5KFE A;  3PW4 A;  2PXI A;  3BJY A;  5KFT A;  1TFW A;  4Z6C A;  1S0N A;  5KTQ A;  5EWG A;  2P66 A;  9ICX A;  4ATB B;  4LZG A;  5KG4 A;  2IMW P;  3TFS A;  3MR5 A;  1NJY A;  3OVB A;  4ED3 A;  5F9L A;  2W9A A;  4XA5 A;  1TFY A;  4F4W A;  4IRC A;  1X9S A;  4IRD A;  5KFQ A;  1ZQU A;  1A76 A;  2XGQ A;  2ALZ A;  1S9F A;  4R63 A;  4YP3 A;  4WC6 A;  3SYZ A;  1BGX T;  3C1Y A;  1KFT A;  1WCN A;  4EBE A;  3HPO A;  3UPQ A;  3GIK A;  4K4H A;  4B9T A;  3EWA A;  4FHX A;  4MF8 A;  4F2S A;  3EPG A;  2HHW A;  4WBY A;  5KFA A;  3G6V A;  1SZP A;  5D49 A;  5J0X A;  3C23 A;  5CHG A;  4DQR A;  2BPF A;  7ICQ A;  2JEF A;  4GXI A;  4NM1 A;  5BPC A;  2V4R A;  2R8H A;  2LYH A;  2HW3 A;  1TAU A;  1T7P A;  2FPM A;  3MDC A;  4KTQ A;  2F1J A;  9ICU A;  3WFQ E;  3THV A;  1JX4 A;  2DR9 A;  5J0R A;  2KN7 A;  4YMO A;  4R65 A;  4IQW A;  2BCV A;  5DLF A;  4UB4 A;  2Q66 A;  4JV1 A;  3OHA A;  4GLX A;  5DDM A;  3WFS C;  4PPX A;  3MGI A;  1TFR A;  4FHV A;  4PHP A;  4I2G A;  3H38 A;  2V9W A;  4RT2 A;  2W8L A;  4QZA A;  1Z3E B;  3MR2 A;  3SZ2 A;  5HRG A;  1A77 A;  2M9N A;  4BWM A;  5HNK A;  4YMM A;  2HVH A;  2IBK A;  9ICC A;  1VFG A;  1CEZ A;  2I1Q A;  4YD2 A;  3C21 A;  2BQU A;  4F2R A;  1KEJ A;  1XO1 A;  2C2D A;  2FLN A;  5EWE A;  4QZ8 A;  4PHD A;  3T5J A;  4I2B A;  4FS1 A;  4DL3 A;  5DB7 A;  1QSS A;  4KLS A;  3K75 D;  3RBD A;  3B0X A;  7ICK A;  4XRH A;  4E8F A;  4IRK A;  4UQG A;  4QWD A;  3HX0 A;  1QLN A;  5KFZ A;  9ICV A;  5HC9 A;  4R64 A;  3MFI A;  4UB2 A;  3JPQ A;  2GWS A;  1ZQE A;  3RJK A;  1B43 A;  4B9V A;  3OGU A;  1MC8 A;  3AQL A;  3GIJ A;  4GC7 A;  2DPI A;  5KFB A;  3RJG A;  3OUY A;  2NRV A;  5DLG A;  8ICF A;  1B22 A;  5HRD A;  2BE3 A;  4J9Q A;  4YR2 A;  5TZV A;  1ZQK A;  4F4K A;  3H8S A;  3HW8 A;  2DPJ A;  8ICY A;  3MAB A;  3KHH A;  1S0M A;  3MDA A;  4ECU A;  1Z00 A;  3RRH A;  4M2Y A;  3AQM A;  4NXZ A;  5DGB A;  3NGD A;  3RJH A;  5KT3 A;  4J9N A;  4DFK A;  4AT8 A;  2ISP A;  4I2E A;  1NK0 A;  4QZB A;  1MSW D;  3BQ1 A;  9ICE A;  5KFR A;  2NRT A;  3C5G A;  2HHV A;  7ICE A;  9ICG A;  2XGP A;  5KFJ A;  5J0W A;  1ZQY A;  4X5V A;  1U4B A;  3QE9 Y;  1L3S A;  1ZQI A;  2VA8 A;  1ZQJ A;  1ZQF A;  4DSI A;  9ICP A;  2AQ0 A;  3T3F A;  4FH3 A;  1LV5 A;  3RB0 A;  4LT6 A;  3LDA A;  3Q8Q B;  5KFK A;  4KLE A;  4YR0 A;  3LQC B;  4DFP A;  5F9N A;  3BQ2 A;  5DG9 A;  2BR0 A;  7ICN A;  4KLD A;  3OJS A;  9ICK A;  3NTU A;  4I28 A;  3TQ1 A;  5KFC A;  2ZTE A;  4M04 A;  4YR3 A;  4XQ7 A;  1XC9 A;  2C2E A;  3GV8 B;  4PGX A;  3RJJ A;  8ICB A;  5L1I A;  1S76 D;  4ELV A;  2HHU A;  4DL2 A;  2Y1I A;  1XSP A;  4KN7 A;  3PV8 A;  4WC7 A;  4X0B A;  3RR7 A;  4QZF A;  4DQQ A;  5KG7 A;  7ICM A;  4Z6F A;  3UXP A;  4QW9 A;  4DFM A;  2V4Q A;  3PW0 A;  4DF8 A;  2ZH5 A;  4DLE A;  3H4B A;  4EP7 A;  3ZDC A;  4M9J A;  3ISB A;  8ICA A;  5KFU A;  4RQ5 A;  3EZ5 A;  2DRB A;  4O3P A;  5C5J A;  4BDP A;  3UQ0 A;  4JWN A;  2IHM A;  3V6J A;  3OUY B;  3RAQ A;  4DL5 A;  1JQR A;  4RQ7 A;  2FPL A;  5D4B A;  2W9C B;  2W8K A;  2HHX A;  2JEJ A;  5DKW A;  1ZYQ A;  5DQI A;  5DQH A;  4FHY A;  3ZD8 A;  4KLO A;  4RWO A;  3GFK B;  2NRZ A;  5J0S A;  9ICI A;  9ICR A;  4AT7 B;  4C8O A;  1D9D A;  1ZQM A;  3PO5 A;  8ICJ A;  1KFS A;  1SL0 A;  2MUT A;  4NLZ A;  3G6Y A;  4PGY A;  5HHI A;  4M47 A;  4UAY A;  3G6X A;  5KFD A;  2W9M A;  3HT3 A;  4NKU A;  2P6R A;  4MFF A;  4RUC A;  3RR8 A;  3QZ7 A;  1UEU A;  4YCX A;  1UEV A;  5IIL A;  3WFR E;  3MR3 A;  1HUO A;  1KLN A;  1D9F A;  4F5O A;  5KFM A;  3FYH A;  2J6S A;  9ICL A;  1WCL A;  2HVI A;  2KP7 A;  4RWN A;  2BQR A;  3PMN A;  4FHW A;  1NO5 A;  1NJX A;  1ZQA A;  9ICN A;  3C66 A;  1X2I A;  4B9S A;  1VJ7 A;  3RB6 A;  3E2E A;  3UXO A;  4DOC A;  4PH5 A;  4UD4 A;  1S0O A;  4NLK A;  4O3N A;  4ED6 A;  2XY6 A;  4EEY A;  2JEI A;  4NM2 A;  2XCA A;  1K1Q A;  4M6W B;  4ELU A;  2UVU A;  8ICE A;  2M2T A;  1Q79 A;  4WC1 A;  4WC4 A;  4XUS A;  5J2F A;  3MFH A;  5J0O A;  2NRX A;  4X4U A;  2A1J A;  3GDX A;  3GV7 B;  5KFW A;  9ICW A;  2HHP A;  5JUM A;  4WC0 A;  4RQ8 A;  1DK3 A;  1ZQB A;  1SL1 A;  2JZB A;  4RQ6 A;  1UA1 A;  8ICU A;  5IIJ A;  2F1I A;  5J29 A;  4O3O A;  4UB1 A;  1JAJ A;  5KFP A;  4KLM A;  4F92 B;  1BVS A;  1NKC A;  3PVX A;  4DSE A;  2ZH8 A;  3TAQ A;  4AT9 A;  4RPY A;  2BGW A;  3KHR A;  2MUT B;  4QWE A;  4EYH B;  3TAN A;  1NK5 A;  4TQS A;  3JPP A;  1PZN A;  4O3Q A;  5KG2 A;  2PI4 A;  4FBU A;  4EZ6 A;  4KLT A;  2ZUB A;  3K4G A;  5KFS A;  5CA7 A;  4FO6 A;  4F5N A;  4EBJ A;  4DL7 A;  4ECW A;  3OSP A;  1JN3 A;  4RNO A;  4DSL A;  3V7J A;  4IQT A;  4O9M A;  1MIY A;  3SV4 A;  2RFF A;  1NZP A;  1UA0 A;  4DS5 A;  4BXO B;  4NLG A;  3C2M A;  2FLL A;  4QW8 A;  8ICQ A;  3LWL A;  5L1J A;  4IR9 A;  1Q78 A;  1JXL A;  1ZQH A;  4C8M A;  2BQ3 A;  4QZH A;  4YFK A;  3Q8P B;  9ICS A;  1BNP A;  4RUA A;  1QSY A;  8ICC A;  2P6U A;  4RQ0 A;  2RDJ A;  9ICQ A;  4UD5 A;  1U45 A;  4DEZ A;  2ZH3 A;  5J2G A;  3WFP A;  4IG8 A;  1L5U A;  3H40 A;  3T5K A;  4M9L A;  3PY8 A;  4RU9 A;  4ECZ A;  3JPS A;  5KT5 A;  3UQ2 A;  4YVZ A;  3RJI A;  5J2K A;  2IA6 A;  7ICP A;  3OV7 A;  4ED1 A;  5J2I A;  1ZQT A;  9ICO A;  5J0Y A;  5DB8 A;  2ZJ8 A;  4RWQ A;  4ECY A;  5BOL A;  4ED2 A;  3GV5 B;  2XY7 A;  3RBE A;  5CP2 A;  2JZB B;  3OHB A;  4ECT A;  4X4P A;  4XQ8 A;  4RQ2 A;  1IM4 A;  3ORY A;  4TUS A;  2ISO A;  1L3T A;  4X4O A;  5J0U A;  3M8R A;  5J2A A;  1H38 A;  1ARO P;  4O3S A;  1U47 A;  4RNN A;  1N56 A;  1SKR A;  1KSP A;  4TUR A;  4GC6 A;  1KFD A;  1ZQG A;  4PHE A;  4J9P A;  2AGO A;  3MGH A;  3EPI A;  3TAP A;  2C28 A;  1LB2 B;  1XSN A;  1FA0 A;  4WC3 A;  2XY5 A;  4QZG A;  4P4P A;  3PX6 A;  2PFO A;  2ZHB A;  5HRE A;  3ISC A;  4MEX A;  5KFF A;  4P2H A;  2FMS A;  2HHQ A;  4C8L A;  3GIM A;  3TFR A;  1BPX A;  8ICH A;  4K4I A;  3H8W A;  5KG5 A;  5J2J A;  5J2D A;  4F5Q A;  3RTV A;  1TK5 A;  9ICM A;  1F5A A;  2FMP A;  1UT5 A;  5J2E A;  2ZH6 A;  4R8U A;  4UAZ A;  1IXR A;  4DOA A;  3BQT A;  1NJZ A;  3ZDB A;  3OVA A;  5F2V O;  3FDS A;  2ZH1 A;  1UT8 A;  1T3N A;  4KLG A;  1BPD A;  2BPC A;  5J0Q A;  1S77 D;  2M2U A;  4S3N A;  5KG0 A;  4YXJ A;  4Q8F A;  7ICS A;  4I2D A;  2J6T A;  3IM1 A;  4NKT A;  2HHS A;  4RPX A;  2VAN A;  2W9B A;  4LZD A;  1CUK A;  5DB6 A;  4IR1 A;  1Y88 A;  4ECS A;  2J6U A;  4RQ3 A;  5III A;  4J9M A;  4ED0 A;  7ICO A;  9ICJ A;  2BCS A;  2KZM A;  1PX5 A;  2XCP A;  1XU4 A;  3RJE A;  4ECQ A;  5KFH A;  3RAX A;  4DSJ A;  7ICG A;  4I29 A;  1Z00 B;  5DBC A;  2ATL A;  5HRL A;  4FH5 A;  4I2H A;  4PGQ A;  4ATB A;  3UXN A;  9ICT A;  5DED A;  7ICT A;  2KFN A;  2ZTC A;  4AT8 B;  1ZJN A;  3KHL A;  4UB3 A;  4WC5 A;  1TKD A;  2AJQ A;  9ICA A;  4LVS A;  2O1P A;  2ZJ5 A;  2R8K A;  1R8C A;  9ICF A;  3HJ4 A;  2ZH2 A;  8ICV A;  2KZ3 A;  4YN4 A;  2O5A A;  1HJP A;  3PR4 A;  1RPL A;  3OVS A;  4F50 A;  1QSL A;  4DF4 A;  4RQ1 A;  1EXN A;  5IIO A;  5J2C A;  3PX4 A;  2R8G A;  1RXV A;  4KIT B;  2AQ4 A;  5IIN A;  5D46 A;  2R8I A;  4NY8 A;  3V6K A;  1ZQN A;  5KFL A;  5DG8 A;  8ICR A;  4F5R A;  4Q44 A;  1S97 A;  1U48 A;  3N97 B;  2FLP A;  4M0A A;  4FHP A;  3QZ8 A;  1JMS A;  3H8J A;  3PO4 A;  4K4G A;  4I2C A;  4Z6E A;  4JWM A;  7ICU A;  4X4N A;  1NK8 A;  5L1K A;  4DSF A;  1SKS A;  3HIY A;  2ZH9 A;  3PR5 B;  3HJ1 A;  1KDH A;  8ICL A;  3H7I A;  5HRK A;  1R8B A;  4E80 A;  5J0P A;  7ICV A;  3MBY A;  1KNY A;  1N48 A;  2NRW A;  4DO9 A;  3TAR A;  3Q8L A;  3RH5 A;  3Q8S B;  5KT6 A;  3PW7 A;  1SKW A;  5CR0 A;  2I9G A;  2AU0 A;  4F3O A;  4RWP A;  3C5F A;  5IIM A;  1ZJM A;  4DQP A;  5HHH A;  4MF2 A;  1TV9 A;  4RZR A;  1ZQZ A;  4I2A A;  1T8E A;  3M9O B;  4F91 B;  8ICN A;  1R8A A;  4G3I A;  3M8S A;  3ZDA A;  4KLI A;  4X4Q A;  4X4V A;  2KZZ A;  5CJ7 A;  4DLG A;  3MR6 A;  2ASL A;  4YXM A;  4M9G A;  4I2I A;  3GII A;  4KLJ A;  4DS4 A;  2ZHA A;  2UVW A;  3RRG A;  5DGA A;  4O5K A;  2ZUC A;  1MIV A;  5HRF A;  4QZI A;  4NLN A;  2ZUD A;  4WC2 A;  9ICB A;  4GXJ A;  5HMM A;  2WTF A;  3L9D A;  4X4S A;  2DR5 A;  1BPY A;  5KFY A;  4YG2 A;  4KN4 A;  3RB3 A;  1ZQQ A;  4DQS A;  1RYR A;  2OWO A;  4B9L A;  4RQ4 A;  1X9W A;  3JPO A;  3RJF A;  1RZT A;  8ICO A;  2M2V A;  1YLQ A;  2NRK A;  1T4G A;  1HUZ A;  2BCU A;  1NKE A;  5KFG A;  8ICG A;  2AGP A;  2AGQ A;  4Q43 A;  2BDP A;  4J9L A;  4ED7 A;  8ICI A;  4X0A A;  1V9P A;  2KTQ A;  5DB9 A;  2RDI A;  4EBK A;  3JZ0 A;  5EWF A;  4I2J A;  5DBA A;  4JV2 A;  1TK0 A;  2MAX A;  4MFC A;  4YD1 A;  4MEY A;  1ZQD A;  4F8R A;  1NOM A;  1BPE A;  1DGS A;  3ZDE A;  3H3A A;  1ZQS A;  4X4T A;  4J9O A;  4UBB A;  4TUP A;  4GXK A;  4FBT A;  1S0V A;  4F4X A;  2FMQ A;  4J9S A;  2UVR A;  4QZC A;  5HR9 A;  3V72 A;  4ECR A;  5HRI A;  4RPZ A;  3SV3 A;  5DEC A;  3H39 A;  4M9H A;  1JIH A;  3RH4 A;  1MIW A;  4F4Z A;  1U9L A;  4C8K A;  1KTQ A;  3BDP A;  3AU2 A;  5KFI A;  3GIL A;  3GQC A;  1NK4 A;  1TVA A;  2A1J B;  4QZD A;  2C2R A;  1SL2 A;  4X4R A;  7ICF A;  3LK9 A;  2KFZ A;  1NJW A;  7ICJ A;  4P4M A;  4QZE A;  1DOQ A;  1BNO A;  3AQK A;  1JXE A;  2ASD A;  1ZQX A;  4F5P A;  4M5D A;  4WBZ A;  1DK2 A;  2B21 A;  4QWB A;  3C2L A;  4JK1 A;  4P4O A;  4Z6D A;  1XWL A;  5EOZ A;  4TQR A;  4ED8 A;  3T5H A;  1RXW A;  1L3U A;  4KLH A;  1QTM A;  4UB5 A;  5J2B A;  4O5C A;  5KG6 A;  1MQ3 A;  4DWI A;  1TAQ A;  2Q0Z X;  4DL6 A;  8ICZ A;  2PFP A;  3ZDD A;  4ZH4 A;  5KT7 A;  5BOM A;  2XC9 A;  3KHG A;  5L9X A;  4DFJ A;  4AT9 B;  3PML A;  3ETL A;  5KFX A;  1K1S A;  5KFN A;  3JPN A;  3C2K A;  3RH6 A;  1UET A;  4KLQ A;  2PBE A;  5KT4 A;  3AU6 A;  4EZ9 A;  4EBC A;  4C8N A;  4O5E A;  2W9C A;  4IQU A;  5KG1 A;  3V6H A;  1BPB A;  4DQI A;  4O0I A;  1R89 A;  2BCR A;  2DR7 A;  1ZQC A;  3PW2 A;  4R66 A;  4FS2 A;  4BWJ A;  9ICH A;  2BHN A;  2HHT A;  1NK9 A;  7ICI A;  4AT7 A;  4KLL A;  3JPR A;  2ID1 A;  3H4D A;  2PI5 A;  4ELT A;  1X9M A;  3WFO A;  5KT2 A;  4BGD A;  5KFO A;  3SI8 A;  2DR8 A;  2C22 A;  3Q8R B;  4DSK A;  4F93 B;  5CWR A;  3PX0 A;  2BPG A;  2PFQ A;  4TUQ A;  5DG7 A;  2BKE A;  4JV0 A;  4ECX A;  1D8Y A;  7ICL A;  2ZTD A;  2H5X A;  5DQG A;  4DL4 A;  3JYY A;  4QWC A;  4WCW A;  3UPS A;  3EYZ A;  4HYK A;  1OU5 A;  3JPT A;  3PNC A;  7ICH A;  3NYB A;  5KG3 A;  1KRP A;  1ZQL A;  2R8J A;  3ISD A;  3AQN A;  3Q8K A;  4B9M A;  4QWA A;  3Q8M A;  3N4M B;  1BPZ A;  3B0Y A;  1MQ2 A;  4UBC A;  5L1L A;  5DDY A;  4EYI B;  4DOB A;  4ECV A;  2UVV A;  4B9U A;  1COO A;  4MFA A;  4J9K A;  2DVI A;  1RYS A;  4QZ9 A;  3HWT A;  1ZET A;  2JEG A;  4B9N A;  4M9N A;  1NK6 A;  2ZH4 A;  1ZQO A;  4M6W A;  4KLU A;  5J2H A;  4E0D A;  3HP6 A;  3V7L A;  3LWM A;  1XS9 D;  8ICK A;  8ICP A;  1U49 A;  1V4A A;  5HP4 A;  4YQW A;  8ICT A;  3EW9 A;  3KTQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...