4PHEA

Structure of human dna polymerase beta complexed with t in the template base paired with incoming non-hydrolyzable gtp
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
329
structure length
325
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The spontaneous base substitution mechanisms of human DNA polymerase beta
rcsb
source organism Homo sapiens
molecule tags Transferase,lyase/dna
molecule keywords DNA polymerase beta
total genus 107
structure length 325
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2014-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4pheA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4pheA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4pheA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4pheA03
4PHDA 4NLNA 4I2FA 3WFPA 4PH5A 1NK5A 2FLNA 3MFHA 4I2BA 4M04A 4O3SA 3AQMA 1JXEA 1ZQFA 1WOTA 4FHYA 4NKUA 4AT8B 8ICFA 4GC6A 3EPIA 4GXKA 5HRDA 4QZEA 3QZ8A 1ZQIA 1KLNA 2V4QA 1XS9D 3JPTA 4NLGA 1R8AA 7ICQA 4DWIA 4GXJA 2BCVA 4M9HA 5J2IA 3HX0A 2ZTEA 4J9PA 2W9CA 1ZQBA 4UD4A 3QEBZ 4J9MA 4NXZA 5BPCA 1RYRA 1QLNA 1ZQSA 3WFQE 8ICOA 3SV3A 9ICLA 1NJZA 1ZQCA 3OUYA 2F1HA 5KG4A 4F2SA 4RWQA 3G6YA 4IR9A 4DFPA 4RT2A 4UAZA 5KFCA 3PV8A 4ED1A 3TAQA 1ZQDA 1ZQZA 2JEJA 4KN7A 1X9WA 5HRHA 3UPQA 4DOAA 5KFUA 4F4ZA 3ISDA 2BCUA 3C18A 4TURA 1BPDA 8ICAA 2HHVA 2ZUDA 3TANA 1ZQJA 4DQRA 1D8LA 4XA5A 1Z00B 4KLIA 2IHNA 1Q79A 2W9CB 3GQCA 4I2GA 2ZH1A 4M9JA 2WTFA 2M2TA 4GXIA 1KDHA 4IQVA 4O0IA 5L9XA 1PZNA 5J2BA 1BVSA 1EXNA 3EWAA 3EZ5A 4E7XA 3K75D 4I28A 4YVZA 1U47A 1LV5A 1SZPA 4PGQA 4DL5A 1CUKA 1IXRA 3MR6A 5TZVA 1D9FA 3RR8A 4I2IA 1XWLA 3ZD8A 4FH5A 4R8UA 4KITB 5J2FA 4B9NA 3GILA 2ZJ8A 4I2DA 3JPSA 2PXIA 7ICRA 3H37A 3HJ1A 4DL6A 1DOQA 4KN4A 2ZUCA 7ICSA 4Z6EA 1COOA 8ICXA 4DSFA 5J0YA 2DVIA 4F2RA 5KFSA 1XSNA 2NRXA 1S0MA 3RJEA 4QZHA 1MQ3A 3UXNA 4YXJA 1S97A 5KT2A 3M8RA 1NOMA 5J2KA 9ICOA 8ICYA 4X0BA 2FMPA 3T5LA 4I2CA 3LWLA 3THVA 4UB1A 1NKBA 3PO5A 4FS1A 4DSEA 5L1LA 3PX0A 2O1PA 1NK7A 3BQ1A 2HHWA 3GFKB 4Q43A 4QZIA 3Q8QB 1QSLA 4JV1A 4DOCA 1SL1A 5L1KA 5IINA 2ALZA 3HPOA 4F92B 7ICPA 4NKTA 4AT9B 4NM2A 4J9RA 3V7KA 3T3FA 5CHGA 5C5JA 4DFMA 5DG7A 1ZJMA 4J9NA 1ZQHA 4MFCA 2NRTA 4DL7A 9ICCA 1BNPA 3EPGA 4UD5A 2HVIA 1NKCA 4RNOA 2XGQA 3GDXA 1ZQVA 2JEIA 2JZBB 1HUOA 3RJJA 2ZH3A 3MR2A 5DQGA 4TUSA 3GIJA 4HYKA 1JAJA 5KTQA 2KP7A 3JPNA 3SYZA 8ICQA 1U4BA 5DLFA 1LB2B 1L5UA 5L1IA 5HP4A 4FHWA 1BGXT 3NGDA 4IQUA 1N56A 2GWSA 4UB3A 3C2MA 3MABA 7ICJA 1NK9A 8ICEA 2AJQA 3HJ4A 5KT4A 3OVAA 3PR4A 2PI4A 5F2VO 5IIMA 8ICBA 5F9NA 2P66A 4DSKA 3KHRA 4M9GA 4AT9A 4QZAA 1T3NA 4IG8A 5KFEA 5J0TA 5BOLA 3AU6A 4KLSA 4O9MA 2BHNA 3PMLA 9ICJA 4X4VA 5KG6A 1T7PA 1K1QA 1RZTA 1UEVA 9ICGA 1KSPA 5KT3A 5HMMA 2ZJAA 5DB9A 1T8EA 1A77A 2BKEA 8ICIA 2DPIA 4JK1A 2C22A 4F4YA 4KMUA 3H7IA 1DK2A 3QE9Y 1ZQWA 3ISCA 2P6RA 3PMNA 4QZFA 4JV0A 1RYSA 4JWMA 4PPXA 4XUSA 4IR1A 3H40A 4EZ9A 4I2JA 2RDIA 1ZQRA 5KFQA 1ZQKA 4DL4A 4QZBA 1KTQA 2KFZA 8ICWA 2R8JA 3JZ0A 3WFOA 2LYHA 2ATLA 1JIHA 3KHHA 1B43A 2FPMA 3UPSA 7ICIA 3NTUA 9ICXA 3Q8LA 5J2HA 3MGHA 4BXOA 2P6UA 4RUAA 3RBDA 2BQ3A 2PFNA 1XO1A 4M0AA 4BWJA 2VA8A 2IMWP 8ICLA 3BQ0A 4WC5A 3G6XA 2KZZA 4JUZA 2ZH7A 2ZH2A 5J0UA 4UBCA 4QZDA 3KTQA 3AQNA 2ZJ5A 5KFKA 3C5GA 4YN4A 1KEJA 1WCLA 1X9SA 5J0SA 4DS4A 1NK8A 5HHIA 5HHHA 3V6JA 2W9BB 1X2IA 2HHQA 1ZYQA 1Z00A 3H8JA 7ICGA 5HRFA 4C8MA 3T5HA 5DBBA 2H5XA 3UQ2A 8ICRA 2VANA 3AQKA 4KLLA 4J9QA 1ZJNA 2IBKA 5CJ7A 2UVUA 2HHXA 1TK8A 4K4HA 4MFAA 4J9KA 3Q8KA 4XRHA 2R8HA 4ELVA 4M2YA 4FHPA 4XQ7A 2VA2A 4IQTA 4PGXA 1HJPA 2VA3A 1S0OA 5J2GA 2ASDA 2HW3A 9ICUA 4X4QA 3H8WA 3GV7B 4YMOA 3HP6A 5HRKA 2DR7A 4ZH4A 4B9MA 8ICSA 3GV5B 1JMSA 1KFDA 5KFXA 5DG9A 4ED8A 2ASLA 5EWGA 4JV2A 4KLTA 3AQLA 2JEFA 3QZ7A 3H8SA 4YD2A 3G6VA 3TAPA 4ELUA 1L3UA 2KTQA 4ED2A 7ICKA 4WBYA 2ZH9A 5KFOA 1L3SA 1B22A 3B0YA 4X4NA 4LT6A 1MIYA 5KT7A 2AQ4A 4RQ8A 2XCPA 3LWMA 4P4MA 2B21A 4NM1A 3C21A 3C1YA 4TQSA 5KFIA 4DLGA 4BWMA 5CA7A 5HRIA 4DO9A 8ICMA 3LK9A 3HW8A 2MUTB 4AT7A 2PFPA 2JZBA 3RRHA 2HHPA 4C8KA 1TK0A 1ZQNA 3GIIA 8ICPA 9ICAA 2NRVA 8ICUA 2ASJA 3V6KA 4JWNA 4EBJA 3N97B 4F8RA 3HIYA 3PW5A 1XC9A 4DQPA 4QZGA 4YMMA 3SZ2A 2BQRA 4I29A 2ID1A 4EYHB 8ICCA 5HC9A 1MIVA 3LDAA 4P4PA 3RB0A 4RWNA 2KZ3A 4YFKA 4LVSA 3BDPA 4KLDA 4S3NA 4DF4A 2BPGA 2HHTA 5CWRA 5J0OA 4LZGA 9ICSA 4RQ3A 4CCHA 9ICWA 5D4BA 4MF2A 2ZH4A 4F5NA 4KLFA 4Z6DA 4DSLA 1ZQEA 4YG2A 3H3AA 3TFRA 5KFTA 5EWFA 4RQ0A 4R65A 5KG5A 4RPXA 1BPEA 4DQIA 2DRAA 2Y1JA 4F4XA 4X4RA 5DGBA 4KLGA 4KLQA 4YP3A 9ICEA 4KLJA 4QWBA 1IM4A 3ZD9A 5DQIA 4Q45A 7ICTA 2UVRA 5IIIA 3ISBA 4ECQA 4E0DA 1KFTA 4RZRA 1UETA 1XSLA 2BCRA 4I27A 4ECUA 3MDCA 1L3VA 4FBUA 4M5DA 3T5KA 1TV9A 8ICTA 1KFSA 4DL2A 4WC0A 4RQ6A 5KFYA 2XO7A 3TI0A 2ZHAA 3MGIA 9ICNA 1SL0A 2A1JA 3PW7A 9ICHA 4YR0A 4DQQA 2ZH6A 2PBEA 5HNKA 3TARA 1OU5A 3M8SA 1H38A 2FPKA 5DB7A 3ZDAA 5KFDA 1NJXA 4F91B 5EOZA 1V4AA 1TFWA 1X9MA 4Z6CA 4YR2A 1NO5A 5J2JA 4P4OA 4ECZA 1ZQYA 2RDJA 1U48A 2F1JA 1S10A 1VFGA 3SV4A 2O5AA 2KN7A 2C2EA 5DGAA 5KG7A 4MFFA 1MIWA 1WCNA 2ZTDA 5KFGA 5JUMA 4O3RA 5KFRA 2KZMA 2NRKA 4DFJA 4Q8EA 4WC6A 2ZH5A 5KFMA 1MQ2A 8ICZA 1ZQXA 4DEZA 4FS2A 5DQHA 4IRDA 5DDYA 2ISPA 3C2LA 1BPYA 2W8KA 4PGYA 4DL3A 2PFOA 4B9SA 4X4SA 5KFAA 4DSIA 4ED3A 2BE3A 1RPLA 4KLHA 1TFYA 5DBAA 2Y1IA 2MAXA 7ICFA 8ICKA 5DB8A 3GIMA 2F1IA 4X4PA 1BPBA 5F9LA 8ICNA 1TVAA 5KFWA 3OGUA 1JQRA 5DECA 4WC7A 4C8OA 4RQ1A 3K4GA 4RQ5A 1BPXA 7ICMA 4AT8A 3RAQA 4I2HA 4WC1A 4FHXA 1ZQLA 2XY6A 4F4WA 1RXVA 2A1JB 5KT6A 2IHMA 1TAQA 5KFJA 4RPYA 2BR0A 5DEDA 1S76D 1UEUA 3RH5A 2NRWA 3RAXA 4O3NA 2FMQA 1JN3A 5HRLA 2BDPA 1MSWD 3RH6A 5J2AA 1ZQAA 2DR8A 3H4BA 4O5KA 4QWCA 2AGQA 2BCSA 4FO6A 2I9GA 3WFRE 3UXOA 3M9MB 4DF8A 3OSPA 2AU0A 1JXLA 2UVWA 1S0VA 3PW2A 1FA0A 2HVHA 4ATBB 1Z3EB 2C2RA 2C2DA 4XQ8A 1NJWA 3OJUA 2JEGA 4MF8A 4K4IA 4M47A 4RUCA 1U49A 5DKWA 2AGOA 1SKWA 4ECYA 3PW4A 4ECXA 3FYHA 5KFZA 9ICTA 5KFBA 5DLGA 3KHLA 1NKEA 3PX6A 4EZ6A 2XC9A 1ZQTA 4I2AA 4M9NA 5KG0A 3MR5A 3MR3A 5J0WA 1V9PA 3ZDBA 4DOBA 4I2EA 2DRBA 4O3QA 4ECRA 1Y88A 1BPZA 5HMLA 4QZCA 3EW9A 4WC4A 5IIJA 5KFLA 4KLUA 2UVVA 4RWPA 2PFQA 3JYYA 4UB4A 3RBEA 5KT5A 4F5RA 3JPOA 5IIKA 4B9TA 4YQWA 2W8LA 4IRKA 5KG3A 1ZQMA 5KFNA 4RNNA 3LQCB 2ISOA 2DFLA 3RB6A 2BPFA 4ELTA 9ICMA 9ICRA 1RXWA 4MEYA 1XU4A 4EBKA 4F50A 1S77D 4LZDA 5DDMA 3NYBA 1D9DA 5J2EA 2MUTA 2J6TA 2M2VA 3OJSA 1ZQOA 4EP7A 3JPQA 1ZQUA 4PHEA 1U9LA 4QWDA 1ZQQA 4TUPA 4TUQA 3HT3A 9ICVA 2ZHBA 4X4TA 1U45A 4K4GA 1N48A 1TKDA 2Q0ZX 2NRZA 4RPZA 2R8IA 1NJYA 4YXMA 4YD1A 3ZDEA 3GV8B 4FH3A 2BGWA 1HUZA 4KLOA 3PR5B 4RT3A 9ICKA 4UB2A 3UXPA 1F5AA 3N4MB 3JPPA 3OVBA 3B0XA 4QWAA 4FHVA 3C1ZA 1BNOA 2M2WA 3RJFA 8ICVA 4PHPA 2AGPA 2XY7A 4IRCA 9ICIA 4E80A 1KNYA 3BJYA 1UT8A 4M6WA 3PNCA 3JPRA 4UBBA 7ICOA 1NZPA 5HR9A 1UA1A 4R64A 3IM1A 1XSPA 2FLPA 1SKRA 4RU9A 3PW0A 2W9BA 3RB4A 2R8KA 1TAUA 8ICGA 4RNMA 4F4KA 9ICBA 2DR5A 4WC3A 4PHAA 7ICVA 1T4GA 3C23A 2AQ0A 4J9LA 5KFVA 9ICQA 4EBEA 3E2EA 5HRBA 1JX4A 3V72A 1YLQA 4X0AA 5IIOA 4DLEA 2KFNA 2XGPA 4DSJA 3AU2A 4KLMA 4WCWA 4O5EA 2ZTCA 4F5PA 3TFSA 4B9VA 3GIKA 5J0PA 4R8UB 4F5QA 4ECSA 4B9UA 3RH4A 3HWTA 1C7YA 3MFIA 1MC8A 1S0NA 2BPCA 1D8YA 3H39A 4J9OA 4AT7B 4F5OA 3OVSA 4YCXA 5EWEA 1K1SA 4GC7A 5D46A 3Q8RB 3QEAZ 1SL2A 4KLEA 4C8NA 8ICJA 3RB3A 2R8GA 4F3OA 4X5VA 4Z6FA 5J0QA 3H4DA 9ICFA 4WBZA 3OSNA 5J29A 1QTMA 4EBDA 5D49A 4ECWA 4BDPA 2PI5A 4X4UA 1DK3A 5J0XA 4C8LA 3C5FA 3IHQB 3Q8SB 3EYZA 2XCAA 4RQ4A 1L3TA 4EEYA 4UAWA 2HHUA 2IA6A 4R63A 5DG8A 1Q78A 4O5CA 7ICUA 7ICLA 4DQSA 1VJ7A 3RJIA 3AUOA 1ZQGA 5CR0A 4YMNA 4TQRA 4QZ9A 4MEXA 2HHSA 5KG1A 4FBTA 4QW9A 3ZDCA 7ICEA 4EBCA 3OUYB 4UQGA 3BQ2A 4QW8A 1KRPA 3OV7A 2V4RA 4QWEA 4IQWA 4NY8A 5J2CA 4NLZA 3H38A 3T5JA 5L1JA 7ICNA 3FDSA 4QZ8A 5DB6A 2RFFA 4DS5A 4E8FA 5DBCA 4UB5A 2BCQA 9ICPA 2ZUBA 1NK4A 1UT5A 3OHBA 1DGSA 3ETLA 4O3OA 8ICHA 1AROP 3SI8A 3L9DA 2DR9A 2XY5A 4P2HA 4M9LA 3RR7A 2BQUA 4ECVA 4WC2A 5CP2A 4RWOA 1CEZA 4G3IA 5KFFA 2ZH8A 3RJHA 3RJGA 5IILA 4X4OA 2C28A 1NK0A 2W9MA 3V7LA 2FMSA 1R89A 4F93B 4UAYA 3V6HA 3Q8MA 3M9NB 4ED7A 2Q66A 5HREA 4RQ2A 2OWOA 4EYIB 4O3PA 2M2UA 4BXOB 3C2KA 3PVXA 3ZDDA 4ECTA 4GLXA 1SKSA 1NK6A 3MBYA 1UA0A 1QSSA 5KFHA 3V7JA 3OHAA 4ED0A 2I1QA 7ICHA 3RTVA 2V9WA 3Q8PB 1ZQPA 4R66A 3ORYA 1QSYA 2DPJA 2W9AA 5HRGA 3PY8A 4DFKA 2J6UA 1PX5A 3KHGA 5J0RA 3TQ1A 3RRGA 1TK5A 5CB1A 4J9SA 1TFRA 2FLLA 4NLKA 1R8BA 4ED6A 4M6WB 4BGDA 5BOMA 2FPLA 3UQ0A 4KTQA 2M9NA 3MDAA 1S9FA 4YR3A 3C66A 4ATBA 3PX4A 3M9OB 4B9LA 2J6SA 1A76A 1R8CA 3RJKA 5J2DA 3PO4A 4Q8FA 5KFPA 4Q44A 3BQTA 4RQ7A 1ZETA 5KG2A 3WFSC
chains in the Genus database with same CATH superfamily
1M6YA 4PHDA 3WFPA 4PH5A 3CW2C 1WOTA 4AT8B 3EPIA 4GXKA 4QZEA 5AM2A 2VJ5A 2KIVA 7ICQA 4DWIA 4M9HA 5J2IA 2ZTEA 1ZQBA 1A6SA 1QLNA 1ED1A 1ZQSA 2HN2A 1ZQCA 2FCLA 4Y2TA 4NL9C 3G6YA 2ZIWA 4IR9A 3LVVA 3QUBA 4DFPA 5KFCA 1JRPA 1ZQDA 2JEJA 1X9WA 3TKAA 2BCUA 1BPDA 4FZMA 8ICAA 1S8OA 4EEKA 1ZQJA 2E8NA 4XA5A 2IHNA 2QARB 2WTFA 4NLBA 3NRZA 5J2BA 5CHEA 3EWAA 1U47A 2JR5A 1IXRA 1D9FA 4FH5A 4R8UA 5ALTA 2XIDA 1WG8A 1DOQA 2ZUCA 3NVYA 2XICA 1X6IA 5J0YA 4RQNA 1XSNA 1S0MA 4QZHA 4CDGA 3UXNA 3KOOA 4YXJA 1S97A 1NOMA 5J2KA 4X0BA 3D2SA 2FMPA 3T5LA 1GPJA 3LWLA 2DKZA 3TACB 2EH9A 3PO5A 2HDOA 4Y2PA 1ECWA 3BQ1A 2YMMA 1QSLA 2JHDA 1D8BA 5L1KA 4AT9B 7ICPA 5CHGA 4MFCA 5G5HA 4J9NA 2NRTA 1UPHA 4HAIA 1HIWA 4RNOA 2JEIA 3NWIA 4HYKA 4FZNA 1JAJA 8ICQA 2FJ6A 3MGVA 1U4BA 1VLBA 5HP4A 1X42A 1BGXT 1HEKA 2AJQA 4K98A 4PJ0U 2KNJA 5IIMA 5F9NA 3KHRA 4AT9A 3SAGA 9ICJA 1F44A 2HI0A 2YX8A 1K1QA 5DB9A 8ICIA 1A77A 2BKEA 1K5OA 4JK1A 4F4YA 1ZQWA 4JWMA 4XUSA 1ZQRA 8ICWA 3JZ0A 5EE1A 3UPSA 7ICIA 3WK8A 4Y2UA 2YN4A 2VA8A 2IMWP 3BQ0A 4WC5A 3G6XA 4OAIZ 4JUZA 2ZH7A 5J0UA 3KTQA 2K8BB 5B66U 4YN4A 1X9SA 1NK8A 4CE6A 1L6NA 3QU9A 5HRFA 2K4PA 3AQKA 4J9QA 2IBKA 2MRLA 5CJ7A 2UVUA 4MFAA 4XRHA 4ELVA 3L5KA 3PSPA 4XQ7A 4IQTA 1HJPA 1S0OA 2HW3A 5AM0A 4YMOA 5HRKA 2WAQC 8ICSA 4ED8A 1KFDA 4JV2A 3AQLA 3G6VA 1Z4NA 5AKGA 5ALYA 4WH5A 3EUB2 2VIXA 3B0YA 1Z1VA 5CFSA 2RRDA 4LT6A 1MIYA 5KT7A 4X4NA 5AKXA 4OCZA 3C21A 4DO9A 4ICAA 5AM4A 2RP5A 4AT7A 2JZBA 2D3DA 1TK0A 1SXDA 3SQIA 1L7NA 4NXWA 9ICAA 2IOFK 3V6KA 3H0RB 4YMMA 2ID1A 4EYHB 1MIVA 4P4PA 3NKUA 2G09A 4LVSA 4KLDA 4NXUA 4DF4A 2HHTA 9ICSA 3I28A 4MKPA 9ICWA 3UM9A 1QQ6A 3H3AA 4DSLA 3ZI4A 1QQ7A 4RQ0A 5KG5A 3KKAC 2DRAA 4X4RA 4F4XA 2QLTA 1ZD3A 5DGBA 4KLGA 4KLQA 4YP3A 3ZD9A 5DQIA 4NV0A 2YMQA 4ECQA 3MDCA 3QYPA 3SENA 4RQ6A 2D6FC 5AKLA 1SL0A 2PBEA 2JXJA 5HNKA 1OU5A 2FPKA 1NJXA 1X9MA 3C29A 4P4OA 1S10A 1UCVA 3SV4A 2DL0A 3FM9A 3F2CA 5AK3A 5DGAA 4MFFA 1MIWA 2KZMA 1MN8A 4WC6A 5KFMA 3PSTA 8ICZA 4FS2A 2JV3A 4IRDA 2E8PA 3H0MB 5DDYA 2W8KA 4DL3A 1KBUA 2PFOA 1QCKA 4NLCA 4P0PA 5DBAA 7ICFA 2MAXA 5DB8A 5DECA 4C8OA 3CK6A 3RAQA 4FHXA 2XY6A 4F4WA 5KT6A 3M6ZA 5FP0A 2BR0A 1S76D 3RH5A 3RAXA 3H4BA 2BCSA 2E3TA 3HILA 4DF8A 2YQEA 2I6XA 2UVWA 2HVHA 1PVRA 1OUQA 4NXXA 1SKWA 4ECYA 4UASA 1LKYB 2KHVA 3PX6A 2ZIUB 2HBKA 1ZQTA 5KG0A 4FZLA 3ZDBA 4DOBA 2OM6A 5HMLA 4WC4A 5KFLA 2UVVA 1N63A 4UB4A 2HBMA 4F5RA 4B9TA 5ALUA 5IIKA 1IG6A 1ZQMA 1ZXIA 5KFNA 5AKJA 2BPFA 4ELTA 4MEYA 3NUQA 4F50A 1S77D 3NYBA 2GAFD 2J6TA 4TUQA 2CRXA 4K4GA 2Q0ZX 4NXVA 4RPZA 4YXMA 5KL1B 4YD1A 4AP9A 4KLOA 1X6JA 9ICKA 4OJ5A 5KAFU 3UXPA 3JPPA 2M2WA 3RJFA 3I76A 3PSFA 4UW9A 3F2BA 2E5SA 4IRCA 9ICIA 4E80A 4UB8U 1TAUA 3PW0A 2W9BA 3SR6A 8ICGA 4BUGA 4WC3A 1T4GA 5HRBA 2KJ9A 4X0AA 2KFNA 3N7SC 3N7RC 2DUYA 3AU2A 4F72A 4KLMA 3E58A 5J0PA 4R8UB 2NO4A 1MC8A 4UAVA 4J9OA 4YCXA 1ZRMA 1PK1B 8ICJA 5ALZA 5J29A 1QTMA 4EBDA 5D49A 2JH1A 1DK3A 3IRUA 3IHQB 3Q8SB 3EYZA 2R18A 4RQ4A 1ZQ1C 4UAWA 2EWRA 4O5CA 7ICLA 3LVWA 2GLEA 2HHSA 2MU2A 7ICEA 1B4FA 4NJ8A 4UQGA 2V4RA 4QWEA 2GH1A 4NLZA 4QJFB 5L1JA 2RFFA 4UB5A 9ICPA 3SD7A 3BZKA 1AROP 4EX7A 3SI8A 2K8CB 4M9LA 2BQUA 5CP2A 4RWOA 2ZH8A 3OTQA 4OJPA 2C28A 1NK0A 1R89A 3Q8MA 2Y0SC 2K8AA 2PMZC 3SEIA 4ECTA 1NK6A 1N60A 5KFHA 2I1QA 2HSZA 3ORYA 5HRGA 2W9AA 3PY8A 5D62A 2J6UA 1SZHA 3KHGA 1TK5A 4J9SA 4M6WB 5ALMA 3UQ0A 3C66A 2M9NA 5EE9A 4EELA 2J6SA 1A76A 3THVA 5KG2A 4NLNA 2FLNA 3MFHA 1JXEA 1ZQFA 8ICFA 5HRDA 5ALGA 4UB6U 4J9PA 2W9CA 4WOYA 2XI9A 3QEBZ 1O08A 5BPCA 3WFQE 1FEZA 1TE2A 9ICLA 3OUYA 2F1HA 5KG4A 4RT2A 5J8YC 4OO1J 5HRHA 3UPQA 5KFUA 4F4ZA 3F2DA 2RHFA 2ZUDA 4DQRA 1SWWA 1Q79A 1ZD2P 2ZH1A 2Y9TA 1GO3F 4O0IA 5K4LA 1BVSA 1EXNA 2F76X 4I28A 5AI6A 1SZPA 4PGQA 1LV5A 2HOFA 3RR8A 3B9JA 5CRXA 5J2FA 4O6AA 5ALVA 4I2DA 3JPSA 1FFVA 2PXIA 7ICRA 3H37A 3HKZC 4DL6A 4KN4A 4Z6EA 5AK6A 4UAUA 4DSFA 2DVIA 4F2RA 5KFSA 2NRXA 4K96A 3M8RA 4O69A 1NKBA 5JRTA 3DEEA 3ALRA 2O1PA 2EZXA 2BBJA 4QZIA 4NM2A 4J9RA 5C5JA 1ZQHA 1ZJMA 9ICCA 4US8A 1NKCA 2XGQA 1ZQVA 1T94A 3ICXA 5DQGA 2G0AA 2KG5A 3JPNA 5EE3A 4FHWA 3NGDA 1N56A 2LPEA 3PHZA 3MABA 1NK9A 3VCBA 3HJ4A 5ALQA 4EEBA 5KT4A 3QUCA 2PI4A 2W11A 8ICBA 2KJ5A 3I1YA 4OJOA 1SV4A 2ODGA 1T3NA 4IG8A 3AU6A 4X4VA 1T7PA 5KT3A 5HMMA 2ZJAA 2LBOA 2DPIA 2C22A 2B4VA 4KMUA 1DK2A 3AL0B 2P6RA 4JV0A 4PPXA 4IR1A 3H40A 2RDIA 5KFQA 4DL4A 3WFOA 2ATLA 4O67A 1JIHA 5AHXA 3MGHA 2P6UA 1RYUA 3IN5A 4M0AA 4BWJA 4OAGA 3WU2U 2KZZA 2ZH2A 1WUDA 3NVZA 3AQNA 2ZJ5A 5KFKA 5J0SA 2F3NA 3NS1A 2H3FA 3V6JA 1CI4A 2HHQA 1Z00A 3O0FA 4C0ZA 1ZJNA 1KL9A 1RG6A 1KKXA 2VA2A 9ICUA 3H8WA 4LJXA 4USAA 3HP6A 2DR7A 4ZH4A 4B9MA 3GV5B 2HOQA 5KFXA 5DG9A 2ASLA 5EWGA 7ICKA 3H8SA 4ED2A 2ZH9A 2HBLA 5KFOA 1XO0A 2XCPA 4P4MA 4NM1A 4NXTA 5HRIA 3LK9A 3HW8A 2PFPA 5AI9A 2HHPA 1ZQNA 4Y2JA 4BX9C 1V38A 2NRVA 4JWNA 4EBJA 3N97B 3PW5A 1XC9A 4QZGA 4I29A 8ICCA 5HC9A 3RB0A 1WWVA 2KZ3A 4YFKA 5G5GA 3BDPA 4S3NA 3UMCA 2CN1A 2ZH4A 3QU4A 4KLFA 5KFTA 3H8MA 3WKCA 4OAFA 2F77X 9ICEA 4QWBA 2W54A 4E0DA 1JALA 1IIPA 4RZRA 1KFTA 1XSLA 1PVQA 2BCRA 4ECUA 4CNQA 8ICTA 3JCFA 2ZHAA 3MGIA 9ICNA 1N62A 3PW7A 3ER9B 3WK9A 4F91B 4ECZA 2RDJA 1U48A 2O5AA 2KN7A 5JUMA 4DFJA 3UMBA 5D61A 2ZXHA 1ZD5A 4DEZA 5DQHA 2ISPA 4PGYA 4FFDA 4ED3A 4KLHA 2YB4A 4C4TA 4RQ5A 1BPXA 4I2HA 3M7DA 5HR6A 3WKBA 5JTIA 3FAHA 2BDPA 2EZZA 1MSWD 5J2AA 3DDHA 4QWCA 3OSPA 2VKQA 5AKYA 3PW2A 4ATBB 1URJA 3QXGA 3FC4A 5AI5A 2LMRA 4CF5A 5DKWA 2ZXIA 4ECXA 3FYHA 5KFBA 1SIJA 1NKEA 3VC8A 2XC9A 2KKPA 4I2AA 2WB1F 1Q46A 4M9NA 2F8KA 3J81j 3MR3A 4K9AA 4I2EA 1BPZA 4KLUA 4KB6A 4RWPA 2PFQA 4US9A 4YQWA 2W8LA 4RNNA 3L3FX 2DFLA 4C7ZA 2ISOA 9ICMA 9ICRA 2WF9A 3GU3A 1XU4A 4ACOA 1OXJA 4LZDA 2HCFA 1D9DA 2WF7A 2M2VA 1ZQOA 3JPQA 1ZQUA 4QWDA 1U9LA 2K4EA 2XVTA 1ZQQA 9ICVA 2ZHBA 4X4TA 1TKDA 4QNLA 2NRZA 1NJYA 2BGWA 1PUZA 1F5AA 3B0XA 4FHVA 1BNOA 2KVSA 3IP4B 2XY7A 3PNCA 1VDVA 4M6WA 3JPRA 4UBBA 2Y9UA 3IG8A 7ICOA 1SGGA 2BBHA 4NL9A 2FLPA 4FO1A 2EQYA 2H3ZA 5D63A 4F4KA 9ICBA 4PHAA 2AQ0A 4J9LA 5KFVA 9ICQA 5AI0A 3V72A 1YLQA 5AICA 3NVOA 2XGPA 2D8CA 3WKDA 2KICA 1S5LU 4WCWA 4O5EA 3TFSA 3GIKA 4F5QA 3RH4A 1C7YA 3MFIA 1D8YA 4F5OA 3OVSA 4GC7A 5D46A 2ZIVA 3RB3A 4X5VA 5J0QA 3H4DA 9ICFA 1FIQA 2PI5A 1PVPA 2XCAA 1JROA 2IA6A 1Q78A 7ICUA 1ZQGA 4Y2YA 1FO4A 2H3IA 3ZDCA 2QB0A 4IQWA 5AKHA 4NY8A 5J2CA 3H38A 7ICNA 2AH5A 1NI3A 4QZ8A 2BCQA 2ZUBA 1PK1A 2AXTU 1P7DA 4P2HA 4ECVA 4WC2A 3ETRA 4X4OA 5IILA 2Q66A 3V6HA 3M9NB 4ED7A 2M2UA 1SKSA 4GLXA 3CRXA 3OHAA 2V9WA 3Q8PB 4EENA 1L8OA 3RRGA 5CB1A 1TFRA 2FLLA 3IDWA 4ED6A 5ALNA 3CP8A 5BOMA 2FPLA 4ATBA 3MDAA 3AEVA 1R8CA 3HKZF 3RJKA 5J2DA 4Q8FA 3R9KA 1ZETA 2KIWA 1ZOLA 1NK5A 4FHYA 1L7MA 3AQMA 1NNLA 4PL2A 1YZ7A 1KLNA 1XS9D 3JPTA 2KKVA 4GXJA 3MCRA 5ALEA 3OPXA 1X40A 5ALXA 3TAQA 3PV8A 2W3RA 1LVHA 1ZQZA 3DV9A 1Z19A 4KN7A 3QNMA 3C18A 2Y0SF 3ISDA 2KK0A 4TURA 3TANA 4KLIA 2W9CB 2N1RA 3UMGA 4I2GA 4M9JA 1KDHA 2DGZA 5L9XA 1PZNA 3EZ5A 2ZIXA 3C28A 4E7XA 4YVZA 2DKXA 7ICGA 1CUKA 2EAOA 3MR6A 5TZVA 4I2IA 4KITB 4B9NA 2IOHA 4EV6A 2K89A 2ZJ8A 4QIWC 2EDUA 1COOA 4GFJA 8ICXA 4DFDA 2KSOB 2WAQF 3ONNA 2E8MA 3NVWA 1UQVA 5GTIU 8ICYA 4FS1A 4DSEA 3RFAA 3PX0A 2A3VA 1NK7A 3GFKB 3Q8QB 4B6JA 2LM4A 3T3FA 3V7KA 2H3QA 1BNPA 1L7OA 2HVIA 3GDXA 5AM5A 2ZH3A 3MR2A 4TUSA 5KTQA 2KP7A 2ZG6A 3SYZA 1J2NA 5DLFA 1LB2B 1L5UA 3PZPA 4IC9A 3NRWA 3OVAA 4DSKA 1OW5A 4QZAA 2OH2A 5KFEA 5J0TA 5BOLA 2IHOA 5KG6A 1RZTA 1UEVA 2G06A 1T8EA 3KKAA 2KOBA 1JI7A 5CEHA 3H7IA 5AKKA 3ISCA 2M0NA 3AM9A 3PMNA 4I0UA 4EZ9A 4I2JA 1O03A 4QZBA 1CRXA 5AM1A 2R8JA 3F5EA 2LYHA 2KSOA 3BS7A 2FPMA 9ICXA 3Q8LA 2PFNA 1XO1A 2WF6A 4GIBA 8ICLA 2ZIXB 4QZDA 2KVCA 1KEJA 1WCLA 2O6KA 4DS4A 5HHIA 2W7PA 4OAHA 2W9BB 1ZYQA 4J03A 3T5HA 3UQ2A 5B3QA 4KLLA 2GOLA 3ERCC 1TK8A 4K4HA 4M2YA 2R8HA 4N7RA 4PGXA 1J2MA 2VA3A 5J2GA 2ASDA 4LEZA 2B6GA 2JEFA 3TAPA 4ELUA 2KTQA 2A1AA 3TADA 4C80A 1Q3UA 3L4PA 3OWGA 2AQ4A 4RQ8A 1RQLA 3LWMA 2B21A 4TQSA 4DLGA 2YB1A 4BWMA 2RLTA 2MUTB 5GTHU 3RRHA 4C8KA 2F44A 2OYYA 3GIIA 5ALRA 8ICPA 8ICUA 1KN5A 4KX3A 3HIYA 1NZBA 3BS5B 4DQPA 3SZ2A 1FFUA 4RWNA 2BPGA 2YMPA 5J0OA 2ZIUA 4RQ3A 4CCHA 2OXOA 4Z6DA 3TFRA 5EWFA 2HN1A 4RPXA 1BPEA 4MHVA 2WF8A 1IM4A 4Q45A 7ICTA 2UVRA 3ISBA 1UETA 1L3VA 3T5KA 3QU2A 4OJ6A 1VJ5A 3KZIU 3TI0A 1RQNA 9ICHA 4YR0A 2OEHA 2G08A 5ALKA 3ZDAA 2QARA 5DB7A 5KFDA 5EOZA 1NO5A 4Z6CA 5J2JA 3KBBA 5A0LA 2LI6A 5KG7A 4KM5A 4LEWA 2NRKA 1WCNA 2ZTDA 5AKIA 4FE3A 3NVVA 4Q8EA 2ZH5A 3AN1A 5AIAA 3C2LA 4X4SA 4DSIA 5F3XB 2BE3A 2DBYA 2JMGA 1TFYA 4O3MA 2F1IA 4X4PA 5F9LA 8ICNA 1TVAA 4WC7A 3QU5A 4RQ1A 1LKYA 2KV2A 2HOIA 4HX0A 5ALIA 4AT8A 3WKEA 1ZQLA 1RXVA 2A1JB 2IHMA 1TAQA 5KFJA 5DEDA 1UEUA 2CXYA 2NRWA 4O3NA 5HRLA 3RH6A 1ZQAA 2DR8A 5EE0A 4O5KA 1COKA 2PKEA 3UXOA 3M9MB 1S0VA 2DWQA 4WQLA 1Q8KA 4G9BA 1NJWA 1ZD4A 4MF8A 2KE7A 2W7OA 5AK5A 4RUCA 2AGOA 3PW4A 2WF5A 5KFZA 3KHLA 4EZ6A 1N5XA 4OJLA 3MR5A 5J0WA 2FDRA 3QUTA 2DRBA 3QUQA 4O3QA 3EW9A 1JUDA 4KMOB 5IIJA 3JYYA 3RBEA 5KT5A 3JPOA 3MC1A 2K4IA 5KG3A 3LQCB 3RB6A 1RXWA 3N7PD 4EBKA 2WFAA 2OHFA 5DDMA 2AHOB 3OJSA 4PHEA 4IL6U 4TUPA 3HT3A 4XJEA 1U45A 5AK4A 1N48A 4A8EA 4FH3A 3PR5B 2KHQA 1J97A 4UB2A 5AI4A 3N4MB 2GO7A 4QWAA 1N5WA 8ICVA 2CPRA 1KNYA 2KJ8A 3AQEA 1NZPA 4Y2XA 3HJEA 1UA1A 4R64A 5ALSA 1XSPA 1SKRA 2BDUA 4RU9A 4RNMA 1YT3A 2DR5A 5ALOA 7ICVA 3C23A 4EBEA 1V85A 2WB1C 3K1RB 4DSJA 2RQ5A 3AQFA 2ZTCA 4F5PA 2I5HA 4ECSA 3GZFA 5ALJA 3HWTA 2BPCA 5KL8B 4AT7B 1DXSA 3QEAZ 1K1SA 4KLEA 1SL2A 2K4HA 5KAIU 4F3OA 4WBZA 4ECWA 4BDPA 5J0XA 1RM6C 2P35A 1L3TA 4ZOHC 3WK5A 4R63A 5DG8A 2W3SA 1VJ7A 4IS7A 4K97A 3AUOA 4TQRA 4QZ9A 2QB1A 4QW9A 2IUBA 4EBCA 3BQ2A 2IOFA 1KRPA 2DQNB 4RQMA 3T5JA 5DB6A 4E8FA 1N61A 2ES6A 2F8LA 2LYAA 1NK4A 3ETLA 4O3OA 8ICHA 2XY5A 1Z1BA 4KX5A 1CEZA 4G3IA 5KFFA 3RJGA 2FMSA 2BZFA 2W9MA 4F93B 4UAYA 2OWOA 4EYIB 3C2KA 3BQ7A 3MBYA 4ED0A 3V7JA 1QH9A 4C4RA 4CRXA 7ICHA 4R66A 2DPJA 1PX5A 5J0RA 1UHUA 4NLKA 1R8BA 4BGDA 1L7PA 2G5IB 4KTQA 4U7CA 1S9FA 4YR3A 3WKAA 5AM3A 3PX4A 3BS5A 3M9OB 4B9LA 5AKEA 2K60A 3T79A 2E1EA 3PO4A 5KFPA 4Q44A 4RQ7A 3WFSC 3F53A 4I2FA 4Y2SA 4O3SA 2MA1A 3CNHA 4I2BA 4M04A 1T3QA 4PZOA 4NKUA 4GC6A 3QZ8A 1ZQIA 4P0QB 2V4QA 1QQ5A 2NO5A 1SXEA 2EZYA 1MA7A 4NLGA 2BCVA 1R8AA 4EX6A 3HX0A 2YTUA 4UD4A 1RYRA 4J9MA 4NXZA 1N2XA 1TAMA 2JRZA 4P0PB 8ICOA 3SV3A 5CFTA 1NJZA 4F2SA 3HRDD 4UAZA 4ED1A 1SWVA 5ALWA 4DOAA 3KFUF 2EANA 2HHVA 1D8LA 1Z00B 3D6JA 5AIBA 3GQCA 3M1YA 2DF4B 2M2TA 4GXIA 4IQVA 3U26A 2ZIVB 3K75D 5B5EU 4DL5A 3ZD8A 1XWLA 1IV8A 3GILA 2G5HB 4PL1A 3SMVA 2QKQA 3HJ1A 4O68A 7ICSA 2KD1A 3RJEA 1MQ3A 3ER8C 5KT2A 2E8OA 9ICOA 4I2CA 4UB1A 5L1LA 5JU5A 5H2FU 2HHWA 2QB0B 4Q43A 4JV1A 4DOCA 4JLXA 1SL1A 2ALZA 5IINA 3HPOA 4F92B 4NKTA 4DFMA 5DG7A 1VFGA 4UD5A 4DL7A 3EPGA 2JZBB 1HUOA 3RJJA 3GIJA 1DGJA 5L1IA 4IQUA 2GWSA 4UB3A 3C2MA 7ICJA 8ICEA 3QX7A 3PR4A 2NYVA 5F2VO 2P66A 4M9GA 4KLSA 4O9MA 2BHNA 3PMLA 9ICGA 1KSPA 3WK6A 4QIWF 4CGZA 2VJ4A 3QE9Y 4QZFA 1RYSA 2OCEA 4JLZA 1L8LA 1ZQKA 1KTQA 2KFZA 3KHHA 1XNSA 1B43A 3NTUA 4BXOA 5J2HA 2LHTA 3WK4A 4RUAA 3RBDA 2BQ3A 2H3VA 3RF9A 1C20A 4NWIA 4UBCA 2B51A 3C5GA 5TISU 2LYBA 5HHHA 1X2IA 3LYSA 3H8JA 4C8MA 5DBBA 2H5XA 8ICRA 2VANA 2HHXA 5AI8A 4J9KA 3Q8KA 4FHPA 2W43A 5ALDA 4PZNA 4X4QA 3GV7B 1JMSA 2FE9A 4KLTA 3QZ7A 4YD2A 1L3UA 4WBYA 1L3SA 1B22A 2Q4TA 3C1YA 5KFIA 5CA7A 8ICMA 1A0PA 1SB3C 1Q3VA 1DRGA 2W55A 2ASJA 4WQKA 4F8RA 4LEVA 3E0FA 2BQRA 4LEYA 5AKZA 3LDAA 1ZRNA 3M6KA 5CWRA 4LZGA 5D4BA 4MF2A 3H0LB 2YY6A 4F5NA 5HR7A 3K7DA 1ZQEA 4YG2A 4R65A 4BJQA 4DQIA 2Y1JA 4KLJA 5IIIA 4K99A 4I27A 4M5DA 4FBUA 1TV9A 2B0CA 1KFSA 4DL2A 4WC0A 5KFYA 3NASA 2XO7A 5B3PA 2A1JA 5ALPA 2ZH6A 4DQQA 3TARA 3M8SA 1H38A 2W04A 1V4AA 1TFWA 4YR2A 1ZQYA 5ALHA 2F1JA 2C2EA 2GA9D 5KFGA 4O3RA 5KFRA 4U6PA 3IV6A 3A0BU 1MQ2A 1ZQXA 1BPYA 1Z4OA 4B9SA 5KFAA 1RPLA 2FI1A 2Y1IA 8ICKA 3GIMA 4EEDA 1BPBA 1JQRA 2JH7A 5KFWA 3OGUA 3K4GA 7ICMA 4WC1A 2YMLA 4RPYA 2WHEA 1F0MA 2FMQA 1JN3A 5C0YA 1KW4A 5J8YA 3QU7A 2AGQA 2I9GA 4FO6A 5T14A 3WFRE 5ALLA 2AU0A 2PMZF 1JXLA 1FA0A 1WWUA 1Z3EB 2C2RA 4XQ8A 2C2DA 1X66A 1F5SA 3OJUA 2JEGA 2EAMA 4F71A 4EGWA 4K4IA 4M47A 4CF4A 1U49A 9ICTA 5DLGA 1PK3A 1YZ6A 3AMZA 1V9PA 4UATA 2EAPA 4ECRA 1Y88A 2JGAA 4WJ3B 4QZCA 2B56A 4AYBC 4IRKA 3SAFA 5CFUA 2E1FA 3F5AA 5J2EA 2MUTA 3KD3A 4EP7A 1WYGA 4CF3A 4P0QA 2R8IA 3ZDEA 3GV8B 4C4SA 1HUZA 5KNIA 4RT3A 5JTGA 3OVBA 5E79U 1KQQA 3C1ZA 2HMXA 1X9XA 3EF2A 4PHPA 2AGPA 4K9BA 2KEYA 3BJYA 1UT8A 3N28A 5HR9A 3IM1A 3D2NA 3RB4A 3IG5A 5ALFA 4Y2RA 4JB3A 2F2AB 4Y2VA 2R8KA 3SAHA 2NV3A 3E2EA 1JX4A 5IIOA 4DLEA 2KMDA 4B9VA 4B9UA 4K8VA 1S0NA 1RDFA 3H39A 5EWEA 4RWQA 3Q8RB 3TADC 4C8NA 3BZCA 2R8GA 2LKYA 4Z6FA 3OSNA 4X4UA 2G07A 4C8LA 3C5FA 3PSIA 3CYMA 3KZXA 2HBJA 4EEYA 2HHUA 4C7YA 4DQSA 3RJIA 5CR0A 3A0HU 4YMNA 4MEXA 5KG1A 4FBTA 3OUYB 4QW8A 2LM1A 3OV7A 4Y2QA 2MSNA 4DCCA 2W03A 1SV0C 3FDSA 4DS5A 5DBCA 4AYBF 1UT5A 3OHBA 1DGSA 2DR9A 3L9DA 2A19A 3RR7A 3D2QA 3RJHA 3V7LA 5HREA 1B0XA 4RQ2A 4OD0A 4O3PA 3K1ZA 4BXOB 4UARA 2L5YA 3PVXA 3ZDDA 1QSSA 1UA0A 3ED5A 3RTVA 1ZQPA 5L1MA 1QSYA 2Z7JA 4DFKA 1V97A 3TQ1A 2ESEA 3S6JA 4JMUA 2ZIWB 1SV0A 3WK7A 3BQTA 1AQ6A
chains in the Genus database with same CATH topology
4PHDA 4NLNA 4I2FA 3WFPA 4PH5A 1NK5A 2FLNA 3MFHA 4I2BA 4M04A 4O3SA 3AQMA 1JXEA 1ZQFA 1WOTA 4FHYA 4NKUA 4AT8B 8ICFA 4GC6A 3EPIA 4GXKA 5HRDA 4QZEA 3QZ8A 1ZQIA 1KLNA 2V4QA 1XS9D 3JPTA 4NLGA 1R8AA 7ICQA 4DWIA 4GXJA 2BCVA 4M9HA 5J2IA 3HX0A 2ZTEA 4J9PA 2W9CA 1ZQBA 4UD4A 3QEBZ 4J9MA 4NXZA 5BPCA 1RYRA 1QLNA 1ZQSA 3WFQE 8ICOA 3SV3A 9ICLA 1NJZA 1ZQCA 3OUYA 2F1HA 5KG4A 4F2SA 4RWQA 3G6YA 4IR9A 4DFPA 4RT2A 4UAZA 5KFCA 3PV8A 4ED1A 3TAQA 1ZQDA 1ZQZA 2JEJA 4KN7A 1X9WA 5HRHA 3UPQA 4DOAA 5KFUA 4F4ZA 3ISDA 2BCUA 3C18A 4TURA 1BPDA 8ICAA 2HHVA 2ZUDA 3TANA 1ZQJA 4DQRA 1D8LA 4XA5A 1Z00B 4KLIA 2IHNA 1Q79A 2W9CB 3GQCA 4I2GA 2ZH1A 4M9JA 2WTFA 2M2TA 4GXIA 1KDHA 4IQVA 4O0IA 5L9XA 1PZNA 5J2BA 1BVSA 1EXNA 3EWAA 3EZ5A 4E7XA 3K75D 4I28A 4YVZA 1U47A 1LV5A 1SZPA 4PGQA 4DL5A 1CUKA 1IXRA 3MR6A 5TZVA 1D9FA 3RR8A 4I2IA 1XWLA 3ZD8A 4FH5A 4R8UA 4KITB 5J2FA 4B9NA 3GILA 2ZJ8A 4I2DA 3JPSA 2PXIA 7ICRA 3H37A 3HJ1A 4DL6A 1DOQA 4KN4A 2ZUCA 7ICSA 4Z6EA 1COOA 8ICXA 4DSFA 5J0YA 2DVIA 4F2RA 5KFSA 1XSNA 2NRXA 1S0MA 3RJEA 4QZHA 1MQ3A 3UXNA 4YXJA 1S97A 5KT2A 3M8RA 1NOMA 5J2KA 9ICOA 8ICYA 4X0BA 2FMPA 3T5LA 4I2CA 3LWLA 3THVA 4UB1A 1NKBA 3PO5A 4FS1A 4DSEA 5L1LA 3PX0A 2O1PA 1NK7A 3BQ1A 2HHWA 3GFKB 4Q43A 4QZIA 3Q8QB 1QSLA 4JV1A 4DOCA 1SL1A 5L1KA 5IINA 2ALZA 3HPOA 4F92B 7ICPA 4NKTA 4AT9B 4NM2A 4J9RA 3V7KA 3T3FA 5CHGA 5C5JA 4DFMA 5DG7A 1ZJMA 4J9NA 1ZQHA 4MFCA 2NRTA 4DL7A 9ICCA 1BNPA 3EPGA 4UD5A 2HVIA 1NKCA 4RNOA 2XGQA 3GDXA 1ZQVA 2JEIA 2JZBB 1HUOA 3RJJA 2ZH3A 3MR2A 5DQGA 4TUSA 3GIJA 4HYKA 1JAJA 5KTQA 2KP7A 3JPNA 3SYZA 8ICQA 1U4BA 5DLFA 1LB2B 1L5UA 5L1IA 5HP4A 4FHWA 1BGXT 3NGDA 4IQUA 1N56A 2GWSA 4UB3A 3C2MA 3MABA 7ICJA 1NK9A 8ICEA 2AJQA 3HJ4A 5KT4A 3OVAA 3PR4A 2PI4A 5F2VO 5IIMA 8ICBA 5F9NA 2P66A 4DSKA 3KHRA 4M9GA 4AT9A 4QZAA 1T3NA 4IG8A 5KFEA 5J0TA 5BOLA 3AU6A 4KLSA 4O9MA 2BHNA 3PMLA 9ICJA 4X4VA 5KG6A 1T7PA 1K1QA 1RZTA 1UEVA 9ICGA 1KSPA 5KT3A 5HMMA 2ZJAA 5DB9A 1T8EA 1A77A 2BKEA 8ICIA 2DPIA 4JK1A 2C22A 4F4YA 4KMUA 3H7IA 1DK2A 3QE9Y 1ZQWA 3ISCA 2P6RA 3PMNA 4QZFA 4JV0A 1RYSA 4JWMA 4PPXA 4XUSA 4IR1A 3H40A 4EZ9A 4I2JA 2RDIA 1ZQRA 5KFQA 1ZQKA 4DL4A 4QZBA 1KTQA 2KFZA 8ICWA 2R8JA 3JZ0A 3WFOA 2LYHA 2ATLA 1JIHA 3KHHA 1B43A 2FPMA 3UPSA 7ICIA 3NTUA 9ICXA 3Q8LA 5J2HA 3MGHA 4BXOA 2P6UA 4RUAA 3RBDA 2BQ3A 2PFNA 1XO1A 4M0AA 4BWJA 2VA8A 2IMWP 8ICLA 3BQ0A 4WC5A 3G6XA 2KZZA 4JUZA 2ZH7A 2ZH2A 5J0UA 4UBCA 4QZDA 3KTQA 3AQNA 2ZJ5A 5KFKA 3C5GA 4YN4A 1KEJA 1WCLA 1X9SA 5J0SA 4DS4A 1NK8A 5HHIA 5HHHA 3V6JA 2W9BB 1X2IA 2HHQA 1ZYQA 1Z00A 3H8JA 7ICGA 5HRFA 4C8MA 3T5HA 5DBBA 2H5XA 3UQ2A 8ICRA 2VANA 3AQKA 4KLLA 4J9QA 1ZJNA 2IBKA 5CJ7A 2UVUA 2HHXA 1TK8A 4K4HA 4MFAA 4J9KA 3Q8KA 4XRHA 2R8HA 4ELVA 4M2YA 4FHPA 4XQ7A 2VA2A 4IQTA 4PGXA 1HJPA 2VA3A 1S0OA 5J2GA 2ASDA 2HW3A 9ICUA 4X4QA 3H8WA 3GV7B 4YMOA 3HP6A 5HRKA 2DR7A 4ZH4A 4B9MA 8ICSA 3GV5B 1JMSA 1KFDA 5KFXA 5DG9A 4ED8A 2ASLA 5EWGA 4JV2A 4KLTA 3AQLA 2JEFA 3QZ7A 3H8SA 4YD2A 3G6VA 3TAPA 4ELUA 1L3UA 2KTQA 4ED2A 7ICKA 4WBYA 2ZH9A 5KFOA 1L3SA 1B22A 3B0YA 4X4NA 4LT6A 1MIYA 5KT7A 2AQ4A 4RQ8A 2XCPA 3LWMA 4P4MA 2B21A 4NM1A 3C21A 3C1YA 4TQSA 5KFIA 4DLGA 4BWMA 5CA7A 5HRIA 4DO9A 8ICMA 3LK9A 3HW8A 2MUTB 4AT7A 2PFPA 2JZBA 3RRHA 2HHPA 4C8KA 1TK0A 1ZQNA 3GIIA 8ICPA 9ICAA 2NRVA 8ICUA 2ASJA 3V6KA 4JWNA 4EBJA 3N97B 4F8RA 3HIYA 3PW5A 1XC9A 4DQPA 4QZGA 4YMMA 3SZ2A 2BQRA 4I29A 2ID1A 4EYHB 8ICCA 5HC9A 1MIVA 3LDAA 4P4PA 3RB0A 4RWNA 2KZ3A 4YFKA 4LVSA 3BDPA 4KLDA 4S3NA 4DF4A 2BPGA 2HHTA 5CWRA 5J0OA 4LZGA 9ICSA 4RQ3A 4CCHA 9ICWA 5D4BA 4MF2A 2ZH4A 4F5NA 4KLFA 4Z6DA 4DSLA 1ZQEA 4YG2A 3H3AA 3TFRA 5KFTA 5EWFA 4RQ0A 4R65A 5KG5A 4RPXA 1BPEA 4DQIA 2DRAA 2Y1JA 4F4XA 4X4RA 5DGBA 4KLGA 4KLQA 4YP3A 9ICEA 4KLJA 4QWBA 1IM4A 3ZD9A 5DQIA 4Q45A 7ICTA 2UVRA 5IIIA 3ISBA 4ECQA 4E0DA 1KFTA 4RZRA 1UETA 1XSLA 2BCRA 4I27A 4ECUA 3MDCA 1L3VA 4FBUA 4M5DA 3T5KA 1TV9A 8ICTA 1KFSA 4DL2A 4WC0A 4RQ6A 5KFYA 2XO7A 3TI0A 2ZHAA 3MGIA 9ICNA 1SL0A 2A1JA 3PW7A 9ICHA 4YR0A 4DQQA 2ZH6A 2PBEA 5HNKA 3TARA 1OU5A 3M8SA 1H38A 2FPKA 5DB7A 3ZDAA 5KFDA 1NJXA 4F91B 5EOZA 1V4AA 1TFWA 1X9MA 4Z6CA 4YR2A 1NO5A 5J2JA 4P4OA 4ECZA 1ZQYA 2RDJA 1U48A 2F1JA 1S10A 1VFGA 3SV4A 2O5AA 2KN7A 2C2EA 5DGAA 5KG7A 4MFFA 1MIWA 1WCNA 2ZTDA 5KFGA 5JUMA 4O3RA 5KFRA 2KZMA 2NRKA 4DFJA 4Q8EA 4WC6A 2ZH5A 5KFMA 1MQ2A 8ICZA 1ZQXA 4DEZA 4FS2A 5DQHA 4IRDA 5DDYA 2ISPA 3C2LA 1BPYA 2W8KA 4PGYA 4DL3A 2PFOA 4B9SA 4X4SA 5KFAA 4DSIA 4ED3A 2BE3A 1RPLA 4KLHA 1TFYA 5DBAA 2Y1IA 2MAXA 7ICFA 8ICKA 5DB8A 3GIMA 2F1IA 4X4PA 1BPBA 5F9LA 8ICNA 1TVAA 5KFWA 3OGUA 1JQRA 5DECA 4WC7A 4C8OA 4RQ1A 3K4GA 4RQ5A 1BPXA 7ICMA 4AT8A 3RAQA 4I2HA 4WC1A 4FHXA 1ZQLA 2XY6A 4F4WA 1RXVA 2A1JB 5KT6A 2IHMA 1TAQA 5KFJA 4RPYA 2BR0A 5DEDA 1S76D 1UEUA 3RH5A 2NRWA 3RAXA 4O3NA 2FMQA 1JN3A 5HRLA 2BDPA 1MSWD 3RH6A 5J2AA 1ZQAA 2DR8A 3H4BA 4O5KA 4QWCA 2AGQA 2BCSA 4FO6A 2I9GA 3WFRE 3UXOA 3M9MB 4DF8A 3OSPA 2AU0A 1JXLA 2UVWA 1S0VA 3PW2A 1FA0A 2HVHA 4ATBB 1Z3EB 2C2RA 2C2DA 4XQ8A 1NJWA 3OJUA 2JEGA 4MF8A 4K4IA 4M47A 4RUCA 1U49A 5DKWA 2AGOA 1SKWA 4ECYA 3PW4A 4ECXA 3FYHA 5KFZA 9ICTA 5KFBA 5DLGA 3KHLA 1NKEA 3PX6A 4EZ6A 2XC9A 1ZQTA 4I2AA 4M9NA 5KG0A 3MR5A 3MR3A 5J0WA 1V9PA 3ZDBA 4DOBA 4I2EA 2DRBA 4O3QA 4ECRA 1Y88A 1BPZA 5HMLA 4QZCA 3EW9A 4WC4A 5IIJA 5KFLA 4KLUA 2UVVA 4RWPA 2PFQA 3JYYA 4UB4A 3RBEA 5KT5A 4F5RA 3JPOA 5IIKA 4B9TA 4YQWA 2W8LA 4IRKA 5KG3A 1ZQMA 5KFNA 4RNNA 3LQCB 2ISOA 2DFLA 3RB6A 2BPFA 4ELTA 9ICMA 9ICRA 1RXWA 4MEYA 1XU4A 4EBKA 4F50A 1S77D 4LZDA 5DDMA 3NYBA 1D9DA 5J2EA 2MUTA 2J6TA 2M2VA 3OJSA 1ZQOA 4EP7A 3JPQA 1ZQUA 4PHEA 1U9LA 4QWDA 1ZQQA 4TUPA 4TUQA 3HT3A 9ICVA 2ZHBA 4X4TA 1U45A 4K4GA 1N48A 1TKDA 2Q0ZX 2NRZA 4RPZA 2R8IA 1NJYA 4YXMA 4YD1A 3ZDEA 3GV8B 4FH3A 2BGWA 1HUZA 4KLOA 3PR5B 4RT3A 9ICKA 4UB2A 3UXPA 1F5AA 3N4MB 3JPPA 3OVBA 3B0XA 4QWAA 4FHVA 3C1ZA 1BNOA 2M2WA 3RJFA 8ICVA 4PHPA 2AGPA 2XY7A 4IRCA 9ICIA 4E80A 1KNYA 3BJYA 1UT8A 4M6WA 3PNCA 3JPRA 4UBBA 7ICOA 1NZPA 5HR9A 1UA1A 4R64A 3IM1A 1XSPA 2FLPA 1SKRA 4RU9A 3PW0A 2W9BA 3RB4A 2R8KA 1TAUA 8ICGA 4RNMA 4F4KA 9ICBA 2DR5A 4WC3A 4PHAA 7ICVA 1T4GA 3C23A 2AQ0A 4J9LA 5KFVA 9ICQA 4EBEA 3E2EA 5HRBA 1JX4A 3V72A 1YLQA 4X0AA 5IIOA 4DLEA 2KFNA 2XGPA 4DSJA 3AU2A 4KLMA 4WCWA 4O5EA 2ZTCA 4F5PA 3TFSA 4B9VA 3GIKA 5J0PA 4R8UB 4F5QA 4ECSA 4B9UA 3RH4A 3HWTA 1C7YA 3MFIA 1MC8A 1S0NA 2BPCA 1D8YA 3H39A 4J9OA 4AT7B 4F5OA 3OVSA 4YCXA 5EWEA 1K1SA 4GC7A 5D46A 3Q8RB 3QEAZ 1SL2A 4KLEA 4C8NA 8ICJA 3RB3A 2R8GA 4F3OA 4X5VA 4Z6FA 5J0QA 3H4DA 9ICFA 4WBZA 3OSNA 5J29A 1QTMA 4EBDA 5D49A 4ECWA 4BDPA 2PI5A 4X4UA 1DK3A 5J0XA 4C8LA 3C5FA 3IHQB 3Q8SB 3EYZA 2XCAA 4RQ4A 1L3TA 4EEYA 4UAWA 2HHUA 2IA6A 4R63A 5DG8A 1Q78A 4O5CA 7ICUA 7ICLA 4DQSA 1VJ7A 3RJIA 3AUOA 1ZQGA 5CR0A 4YMNA 4TQRA 4QZ9A 4MEXA 2HHSA 5KG1A 4FBTA 4QW9A 3ZDCA 7ICEA 4EBCA 3OUYB 4UQGA 3BQ2A 4QW8A 1KRPA 3OV7A 2V4RA 4QWEA 4IQWA 4NY8A 5J2CA 4NLZA 3H38A 3T5JA 5L1JA 7ICNA 3FDSA 4QZ8A 5DB6A 2RFFA 4DS5A 4E8FA 5DBCA 4UB5A 2BCQA 9ICPA 2ZUBA 1NK4A 1UT5A 3OHBA 1DGSA 3ETLA 4O3OA 8ICHA 1AROP 3SI8A 3L9DA 2DR9A 2XY5A 4P2HA 4M9LA 3RR7A 2BQUA 4ECVA 4WC2A 5CP2A 4RWOA 1CEZA 4G3IA 5KFFA 2ZH8A 3RJHA 3RJGA 5IILA 4X4OA 2C28A 1NK0A 2W9MA 3V7LA 2FMSA 1R89A 4F93B 4UAYA 3V6HA 3Q8MA 3M9NB 4ED7A 2Q66A 5HREA 4RQ2A 2OWOA 4EYIB 4O3PA 2M2UA 4BXOB 3C2KA 3PVXA 3ZDDA 4ECTA 4GLXA 1SKSA 1NK6A 3MBYA 1UA0A 1QSSA 5KFHA 3V7JA 3OHAA 4ED0A 2I1QA 7ICHA 3RTVA 2V9WA 3Q8PB 1ZQPA 4R66A 3ORYA 1QSYA 2DPJA 2W9AA 5HRGA 3PY8A 4DFKA 2J6UA 1PX5A 3KHGA 5J0RA 3TQ1A 3RRGA 1TK5A 5CB1A 4J9SA 1TFRA 2FLLA 4NLKA 1R8BA 4ED6A 4M6WB 4BGDA 5BOMA 2FPLA 3UQ0A 4KTQA 2M9NA 3MDAA 1S9FA 4YR3A 3C66A 4ATBA 3PX4A 3M9OB 4B9LA 2J6SA 1A76A 1R8CA 3RJKA 5J2DA 3PO4A 4Q8FA 5KFPA 4Q44A 3BQTA 4RQ7A 1ZETA 5KG2A 3WFSC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PHD A;  4NLN A;  4I2F A;  3WFP A;  4PH5 A;  1NK5 A;  2FLN A;  3MFH A;  4I2B A;  4M04 A;  4O3S A;  3AQM A;  1JXE A;  1ZQF A;  1WOT A;  4FHY A;  4NKU A;  4AT8 B;  8ICF A;  4GC6 A;  3EPI A;  4GXK A;  5HRD A;  4QZE A;  3QZ8 A;  1ZQI A;  1KLN A;  2V4Q A;  1XS9 D;  3JPT A;  4NLG A;  1R8A A;  7ICQ A;  4DWI A;  4GXJ A;  2BCV A;  4M9H A;  5J2I A;  3HX0 A;  2ZTE A;  4J9P A;  2W9C A;  1ZQB A;  4UD4 A;  3QEB Z;  4J9M A;  4NXZ A;  5BPC A;  1RYR A;  1QLN A;  1ZQS A;  3WFQ E;  8ICO A;  3SV3 A;  9ICL A;  1NJZ A;  1ZQC A;  3OUY A;  2F1H A;  5KG4 A;  4F2S A;  4RWQ A;  3G6Y A;  4IR9 A;  4DFP A;  4RT2 A;  4UAZ A;  5KFC A;  3PV8 A;  4ED1 A;  3TAQ A;  1ZQD A;  1ZQZ A;  2JEJ A;  4KN7 A;  1X9W A;  5HRH A;  3UPQ A;  4DOA A;  5KFU A;  4F4Z A;  3ISD A;  2BCU A;  3C18 A;  4TUR A;  1BPD A;  8ICA A;  2HHV A;  2ZUD A;  3TAN A;  1ZQJ A;  4DQR A;  1D8L A;  4XA5 A;  1Z00 B;  4KLI A;  2IHN A;  1Q79 A;  2W9C B;  3GQC A;  4I2G A;  2ZH1 A;  4M9J A;  2WTF A;  2M2T A;  4GXI A;  1KDH A;  4IQV A;  4O0I A;  5L9X A;  1PZN A;  5J2B A;  1BVS A;  1EXN A;  3EWA A;  3EZ5 A;  4E7X A;  3K75 D;  4I28 A;  4YVZ A;  1U47 A;  1LV5 A;  1SZP A;  4PGQ A;  4DL5 A;  1CUK A;  1IXR A;  3MR6 A;  5TZV A;  1D9F A;  3RR8 A;  4I2I A;  1XWL A;  3ZD8 A;  4FH5 A;  4R8U A;  4KIT B;  5J2F A;  4B9N A;  3GIL A;  2ZJ8 A;  4I2D A;  3JPS A;  2PXI A;  7ICR A;  3H37 A;  3HJ1 A;  4DL6 A;  1DOQ A;  4KN4 A;  2ZUC A;  7ICS A;  4Z6E A;  1COO A;  8ICX A;  4DSF A;  5J0Y A;  2DVI A;  4F2R A;  5KFS A;  1XSN A;  2NRX A;  1S0M A;  3RJE A;  4QZH A;  1MQ3 A;  3UXN A;  4YXJ A;  1S97 A;  5KT2 A;  3M8R A;  1NOM A;  5J2K A;  9ICO A;  8ICY A;  4X0B A;  2FMP A;  3T5L A;  4I2C A;  3LWL A;  3THV A;  4UB1 A;  1NKB A;  3PO5 A;  4FS1 A;  4DSE A;  5L1L A;  3PX0 A;  2O1P A;  1NK7 A;  3BQ1 A;  2HHW A;  3GFK B;  4Q43 A;  4QZI A;  3Q8Q B;  1QSL A;  4JV1 A;  4DOC A;  1SL1 A;  5L1K A;  5IIN A;  2ALZ A;  3HPO A;  4F92 B;  7ICP A;  4NKT A;  4AT9 B;  4NM2 A;  4J9R A;  3V7K A;  3T3F A;  5CHG A;  5C5J A;  4DFM A;  5DG7 A;  1ZJM A;  4J9N A;  1ZQH A;  4MFC A;  2NRT A;  4DL7 A;  9ICC A;  1BNP A;  3EPG A;  4UD5 A;  2HVI A;  1NKC A;  4RNO A;  2XGQ A;  3GDX A;  1ZQV A;  2JEI A;  2JZB B;  1HUO A;  3RJJ A;  2ZH3 A;  3MR2 A;  5DQG A;  4TUS A;  3GIJ A;  4HYK A;  1JAJ A;  5KTQ A;  2KP7 A;  3JPN A;  3SYZ A;  8ICQ A;  1U4B A;  5DLF A;  1LB2 B;  1L5U A;  5L1I A;  5HP4 A;  4FHW A;  1BGX T;  3NGD A;  4IQU A;  1N56 A;  2GWS A;  4UB3 A;  3C2M A;  3MAB A;  7ICJ A;  1NK9 A;  8ICE A;  2AJQ A;  3HJ4 A;  5KT4 A;  3OVA A;  3PR4 A;  2PI4 A;  5F2V O;  5IIM A;  8ICB A;  5F9N A;  2P66 A;  4DSK A;  3KHR A;  4M9G A;  4AT9 A;  4QZA A;  1T3N A;  4IG8 A;  5KFE A;  5J0T A;  5BOL A;  3AU6 A;  4KLS A;  4O9M A;  2BHN A;  3PML A;  9ICJ A;  4X4V A;  5KG6 A;  1T7P A;  1K1Q A;  1RZT A;  1UEV A;  9ICG A;  1KSP A;  5KT3 A;  5HMM A;  2ZJA A;  5DB9 A;  1T8E A;  1A77 A;  2BKE A;  8ICI A;  2DPI A;  4JK1 A;  2C22 A;  4F4Y A;  4KMU A;  3H7I A;  1DK2 A;  3QE9 Y;  1ZQW A;  3ISC A;  2P6R A;  3PMN A;  4QZF A;  4JV0 A;  1RYS A;  4JWM A;  4PPX A;  4XUS A;  4IR1 A;  3H40 A;  4EZ9 A;  4I2J A;  2RDI A;  1ZQR A;  5KFQ A;  1ZQK A;  4DL4 A;  4QZB A;  1KTQ A;  2KFZ A;  8ICW A;  2R8J A;  3JZ0 A;  3WFO A;  2LYH A;  2ATL A;  1JIH A;  3KHH A;  1B43 A;  2FPM A;  3UPS A;  7ICI A;  3NTU A;  9ICX A;  3Q8L A;  5J2H A;  3MGH A;  4BXO A;  2P6U A;  4RUA A;  3RBD A;  2BQ3 A;  2PFN A;  1XO1 A;  4M0A A;  4BWJ A;  2VA8 A;  2IMW P;  8ICL A;  3BQ0 A;  4WC5 A;  3G6X A;  2KZZ A;  4JUZ A;  2ZH7 A;  2ZH2 A;  5J0U A;  4UBC A;  4QZD A;  3KTQ A;  3AQN A;  2ZJ5 A;  5KFK A;  3C5G A;  4YN4 A;  1KEJ A;  1WCL A;  1X9S A;  5J0S A;  4DS4 A;  1NK8 A;  5HHI A;  5HHH A;  3V6J A;  2W9B B;  1X2I A;  2HHQ A;  1ZYQ A;  1Z00 A;  3H8J A;  7ICG A;  5HRF A;  4C8M A;  3T5H A;  5DBB A;  2H5X A;  3UQ2 A;  8ICR A;  2VAN A;  3AQK A;  4KLL A;  4J9Q A;  1ZJN A;  2IBK A;  5CJ7 A;  2UVU A;  2HHX A;  1TK8 A;  4K4H A;  4MFA A;  4J9K A;  3Q8K A;  4XRH A;  2R8H A;  4ELV A;  4M2Y A;  4FHP A;  4XQ7 A;  2VA2 A;  4IQT A;  4PGX A;  1HJP A;  2VA3 A;  1S0O A;  5J2G A;  2ASD A;  2HW3 A;  9ICU A;  4X4Q A;  3H8W A;  3GV7 B;  4YMO A;  3HP6 A;  5HRK A;  2DR7 A;  4ZH4 A;  4B9M A;  8ICS A;  3GV5 B;  1JMS A;  1KFD A;  5KFX A;  5DG9 A;  4ED8 A;  2ASL A;  5EWG A;  4JV2 A;  4KLT A;  3AQL A;  2JEF A;  3QZ7 A;  3H8S A;  4YD2 A;  3G6V A;  3TAP A;  4ELU A;  1L3U A;  2KTQ A;  4ED2 A;  7ICK A;  4WBY A;  2ZH9 A;  5KFO A;  1L3S A;  1B22 A;  3B0Y A;  4X4N A;  4LT6 A;  1MIY A;  5KT7 A;  2AQ4 A;  4RQ8 A;  2XCP A;  3LWM A;  4P4M A;  2B21 A;  4NM1 A;  3C21 A;  3C1Y A;  4TQS A;  5KFI A;  4DLG A;  4BWM A;  5CA7 A;  5HRI A;  4DO9 A;  8ICM A;  3LK9 A;  3HW8 A;  2MUT B;  4AT7 A;  2PFP A;  2JZB A;  3RRH A;  2HHP A;  4C8K A;  1TK0 A;  1ZQN A;  3GII A;  8ICP A;  9ICA A;  2NRV A;  8ICU A;  2ASJ A;  3V6K A;  4JWN A;  4EBJ A;  3N97 B;  4F8R A;  3HIY A;  3PW5 A;  1XC9 A;  4DQP A;  4QZG A;  4YMM A;  3SZ2 A;  2BQR A;  4I29 A;  2ID1 A;  4EYH B;  8ICC A;  5HC9 A;  1MIV A;  3LDA A;  4P4P A;  3RB0 A;  4RWN A;  2KZ3 A;  4YFK A;  4LVS A;  3BDP A;  4KLD A;  4S3N A;  4DF4 A;  2BPG A;  2HHT A;  5CWR A;  5J0O A;  4LZG A;  9ICS A;  4RQ3 A;  4CCH A;  9ICW A;  5D4B A;  4MF2 A;  2ZH4 A;  4F5N A;  4KLF A;  4Z6D A;  4DSL A;  1ZQE A;  4YG2 A;  3H3A A;  3TFR A;  5KFT A;  5EWF A;  4RQ0 A;  4R65 A;  5KG5 A;  4RPX A;  1BPE A;  4DQI A;  2DRA A;  2Y1J A;  4F4X A;  4X4R A;  5DGB A;  4KLG A;  4KLQ A;  4YP3 A;  9ICE A;  4KLJ A;  4QWB A;  1IM4 A;  3ZD9 A;  5DQI A;  4Q45 A;  7ICT A;  2UVR A;  5III A;  3ISB A;  4ECQ A;  4E0D A;  1KFT A;  4RZR A;  1UET A;  1XSL A;  2BCR A;  4I27 A;  4ECU A;  3MDC A;  1L3V A;  4FBU A;  4M5D A;  3T5K A;  1TV9 A;  8ICT A;  1KFS A;  4DL2 A;  4WC0 A;  4RQ6 A;  5KFY A;  2XO7 A;  3TI0 A;  2ZHA A;  3MGI A;  9ICN A;  1SL0 A;  2A1J A;  3PW7 A;  9ICH A;  4YR0 A;  4DQQ A;  2ZH6 A;  2PBE A;  5HNK A;  3TAR A;  1OU5 A;  3M8S A;  1H38 A;  2FPK A;  5DB7 A;  3ZDA A;  5KFD A;  1NJX A;  4F91 B;  5EOZ A;  1V4A A;  1TFW A;  1X9M A;  4Z6C A;  4YR2 A;  1NO5 A;  5J2J A;  4P4O A;  4ECZ A;  1ZQY A;  2RDJ A;  1U48 A;  2F1J A;  1S10 A;  1VFG A;  3SV4 A;  2O5A A;  2KN7 A;  2C2E A;  5DGA A;  5KG7 A;  4MFF A;  1MIW A;  1WCN A;  2ZTD A;  5KFG A;  5JUM A;  4O3R A;  5KFR A;  2KZM A;  2NRK A;  4DFJ A;  4Q8E A;  4WC6 A;  2ZH5 A;  5KFM A;  1MQ2 A;  8ICZ A;  1ZQX A;  4DEZ A;  4FS2 A;  5DQH A;  4IRD A;  5DDY A;  2ISP A;  3C2L A;  1BPY A;  2W8K A;  4PGY A;  4DL3 A;  2PFO A;  4B9S A;  4X4S A;  5KFA A;  4DSI A;  4ED3 A;  2BE3 A;  1RPL A;  4KLH A;  1TFY A;  5DBA A;  2Y1I A;  2MAX A;  7ICF A;  8ICK A;  5DB8 A;  3GIM A;  2F1I A;  4X4P A;  1BPB A;  5F9L A;  8ICN A;  1TVA A;  5KFW A;  3OGU A;  1JQR A;  5DEC A;  4WC7 A;  4C8O A;  4RQ1 A;  3K4G A;  4RQ5 A;  1BPX A;  7ICM A;  4AT8 A;  3RAQ A;  4I2H A;  4WC1 A;  4FHX A;  1ZQL A;  2XY6 A;  4F4W A;  1RXV A;  2A1J B;  5KT6 A;  2IHM A;  1TAQ A;  5KFJ A;  4RPY A;  2BR0 A;  5DED A;  1S76 D;  1UEU A;  3RH5 A;  2NRW A;  3RAX A;  4O3N A;  2FMQ A;  1JN3 A;  5HRL A;  2BDP A;  1MSW D;  3RH6 A;  5J2A A;  1ZQA A;  2DR8 A;  3H4B A;  4O5K A;  4QWC A;  2AGQ A;  2BCS A;  4FO6 A;  2I9G A;  3WFR E;  3UXO A;  3M9M B;  4DF8 A;  3OSP A;  2AU0 A;  1JXL A;  2UVW A;  1S0V A;  3PW2 A;  1FA0 A;  2HVH A;  4ATB B;  1Z3E B;  2C2R A;  2C2D A;  4XQ8 A;  1NJW A;  3OJU A;  2JEG A;  4MF8 A;  4K4I A;  4M47 A;  4RUC A;  1U49 A;  5DKW A;  2AGO A;  1SKW A;  4ECY A;  3PW4 A;  4ECX A;  3FYH A;  5KFZ A;  9ICT A;  5KFB A;  5DLG A;  3KHL A;  1NKE A;  3PX6 A;  4EZ6 A;  2XC9 A;  1ZQT A;  4I2A A;  4M9N A;  5KG0 A;  3MR5 A;  3MR3 A;  5J0W A;  1V9P A;  3ZDB A;  4DOB A;  4I2E A;  2DRB A;  4O3Q A;  4ECR A;  1Y88 A;  1BPZ A;  5HML A;  4QZC A;  3EW9 A;  4WC4 A;  5IIJ A;  5KFL A;  4KLU A;  2UVV A;  4RWP A;  2PFQ A;  3JYY A;  4UB4 A;  3RBE A;  5KT5 A;  4F5R A;  3JPO A;  5IIK A;  4B9T A;  4YQW A;  2W8L A;  4IRK A;  5KG3 A;  1ZQM A;  5KFN A;  4RNN A;  3LQC B;  2ISO A;  2DFL A;  3RB6 A;  2BPF A;  4ELT A;  9ICM A;  9ICR A;  1RXW A;  4MEY A;  1XU4 A;  4EBK A;  4F50 A;  1S77 D;  4LZD A;  5DDM A;  3NYB A;  1D9D A;  5J2E A;  2MUT A;  2J6T A;  2M2V A;  3OJS A;  1ZQO A;  4EP7 A;  3JPQ A;  1ZQU A;  4PHE A;  1U9L A;  4QWD A;  1ZQQ A;  4TUP A;  4TUQ A;  3HT3 A;  9ICV A;  2ZHB A;  4X4T A;  1U45 A;  4K4G A;  1N48 A;  1TKD A;  2Q0Z X;  2NRZ A;  4RPZ A;  2R8I A;  1NJY A;  4YXM A;  4YD1 A;  3ZDE A;  3GV8 B;  4FH3 A;  2BGW A;  1HUZ A;  4KLO A;  3PR5 B;  4RT3 A;  9ICK A;  4UB2 A;  3UXP A;  1F5A A;  3N4M B;  3JPP A;  3OVB A;  3B0X A;  4QWA A;  4FHV A;  3C1Z A;  1BNO A;  2M2W A;  3RJF A;  8ICV A;  4PHP A;  2AGP A;  2XY7 A;  4IRC A;  9ICI A;  4E80 A;  1KNY A;  3BJY A;  1UT8 A;  4M6W A;  3PNC A;  3JPR A;  4UBB A;  7ICO A;  1NZP A;  5HR9 A;  1UA1 A;  4R64 A;  3IM1 A;  1XSP A;  2FLP A;  1SKR A;  4RU9 A;  3PW0 A;  2W9B A;  3RB4 A;  2R8K A;  1TAU A;  8ICG A;  4RNM A;  4F4K A;  9ICB A;  2DR5 A;  4WC3 A;  4PHA A;  7ICV A;  1T4G A;  3C23 A;  2AQ0 A;  4J9L A;  5KFV A;  9ICQ A;  4EBE A;  3E2E A;  5HRB A;  1JX4 A;  3V72 A;  1YLQ A;  4X0A A;  5IIO A;  4DLE A;  2KFN A;  2XGP A;  4DSJ A;  3AU2 A;  4KLM A;  4WCW A;  4O5E A;  2ZTC A;  4F5P A;  3TFS A;  4B9V A;  3GIK A;  5J0P A;  4R8U B;  4F5Q A;  4ECS A;  4B9U A;  3RH4 A;  3HWT A;  1C7Y A;  3MFI A;  1MC8 A;  1S0N A;  2BPC A;  1D8Y A;  3H39 A;  4J9O A;  4AT7 B;  4F5O A;  3OVS A;  4YCX A;  5EWE A;  1K1S A;  4GC7 A;  5D46 A;  3Q8R B;  3QEA Z;  1SL2 A;  4KLE A;  4C8N A;  8ICJ A;  3RB3 A;  2R8G A;  4F3O A;  4X5V A;  4Z6F A;  5J0Q A;  3H4D A;  9ICF A;  4WBZ A;  3OSN A;  5J29 A;  1QTM A;  4EBD A;  5D49 A;  4ECW A;  4BDP A;  2PI5 A;  4X4U A;  1DK3 A;  5J0X A;  4C8L A;  3C5F A;  3IHQ B;  3Q8S B;  3EYZ A;  2XCA A;  4RQ4 A;  1L3T A;  4EEY A;  4UAW A;  2HHU A;  2IA6 A;  4R63 A;  5DG8 A;  1Q78 A;  4O5C A;  7ICU A;  7ICL A;  4DQS A;  1VJ7 A;  3RJI A;  3AUO A;  1ZQG A;  5CR0 A;  4YMN A;  4TQR A;  4QZ9 A;  4MEX A;  2HHS A;  5KG1 A;  4FBT A;  4QW9 A;  3ZDC A;  7ICE A;  4EBC A;  3OUY B;  4UQG A;  3BQ2 A;  4QW8 A;  1KRP A;  3OV7 A;  2V4R A;  4QWE A;  4IQW A;  4NY8 A;  5J2C A;  4NLZ A;  3H38 A;  3T5J A;  5L1J A;  7ICN A;  3FDS A;  4QZ8 A;  5DB6 A;  2RFF A;  4DS5 A;  4E8F A;  5DBC A;  4UB5 A;  2BCQ A;  9ICP A;  2ZUB A;  1NK4 A;  1UT5 A;  3OHB A;  1DGS A;  3ETL A;  4O3O A;  8ICH A;  1ARO P;  3SI8 A;  3L9D A;  2DR9 A;  2XY5 A;  4P2H A;  4M9L A;  3RR7 A;  2BQU A;  4ECV A;  4WC2 A;  5CP2 A;  4RWO A;  1CEZ A;  4G3I A;  5KFF A;  2ZH8 A;  3RJH A;  3RJG A;  5IIL A;  4X4O A;  2C28 A;  1NK0 A;  2W9M A;  3V7L A;  2FMS A;  1R89 A;  4F93 B;  4UAY A;  3V6H A;  3Q8M A;  3M9N B;  4ED7 A;  2Q66 A;  5HRE A;  4RQ2 A;  2OWO A;  4EYI B;  4O3P A;  2M2U A;  4BXO B;  3C2K A;  3PVX A;  3ZDD A;  4ECT A;  4GLX A;  1SKS A;  1NK6 A;  3MBY A;  1UA0 A;  1QSS A;  5KFH A;  3V7J A;  3OHA A;  4ED0 A;  2I1Q A;  7ICH A;  3RTV A;  2V9W A;  3Q8P B;  1ZQP A;  4R66 A;  3ORY A;  1QSY A;  2DPJ A;  2W9A A;  5HRG A;  3PY8 A;  4DFK A;  2J6U A;  1PX5 A;  3KHG A;  5J0R A;  3TQ1 A;  3RRG A;  1TK5 A;  5CB1 A;  4J9S A;  1TFR A;  2FLL A;  4NLK A;  1R8B A;  4ED6 A;  4M6W B;  4BGD A;  5BOM A;  2FPL A;  3UQ0 A;  4KTQ A;  2M9N A;  3MDA A;  1S9F A;  4YR3 A;  3C66 A;  4ATB A;  3PX4 A;  3M9O B;  4B9L A;  2J6S A;  1A76 A;  1R8C A;  3RJK A;  5J2D A;  3PO4 A;  4Q8F A;  5KFP A;  4Q44 A;  3BQT A;  4RQ7 A;  1ZET A;  5KG2 A;  3WFS C; 
#chains in the Genus database with same CATH topology
 1M6Y A;  4PHD A;  3WFP A;  4PH5 A;  3CW2 C;  1WOT A;  4AT8 B;  3EPI A;  4GXK A;  4QZE A;  5AM2 A;  2VJ5 A;  2KIV A;  7ICQ A;  4DWI A;  4M9H A;  5J2I A;  2ZTE A;  1ZQB A;  1A6S A;  1QLN A;  1ED1 A;  1ZQS A;  2HN2 A;  1ZQC A;  2FCL A;  4Y2T A;  4NL9 C;  3G6Y A;  2ZIW A;  4IR9 A;  3LVV A;  3QUB A;  4DFP A;  5KFC A;  1JRP A;  1ZQD A;  2JEJ A;  1X9W A;  3TKA A;  2BCU A;  1BPD A;  4FZM A;  8ICA A;  1S8O A;  4EEK A;  1ZQJ A;  2E8N A;  4XA5 A;  2IHN A;  2QAR B;  2WTF A;  4NLB A;  3NRZ A;  5J2B A;  5CHE A;  3EWA A;  1U47 A;  2JR5 A;  1IXR A;  1D9F A;  4FH5 A;  4R8U A;  5ALT A;  2XID A;  1WG8 A;  1DOQ A;  2ZUC A;  3NVY A;  2XIC A;  1X6I A;  5J0Y A;  4RQN A;  1XSN A;  1S0M A;  4QZH A;  4CDG A;  3UXN A;  3KOO A;  4YXJ A;  1S97 A;  1NOM A;  5J2K A;  4X0B A;  3D2S A;  2FMP A;  3T5L A;  1GPJ A;  3LWL A;  2DKZ A;  3TAC B;  2EH9 A;  3PO5 A;  2HDO A;  4Y2P A;  1ECW A;  3BQ1 A;  2YMM A;  1QSL A;  2JHD A;  1D8B A;  5L1K A;  4AT9 B;  7ICP A;  5CHG A;  4MFC A;  5G5H A;  4J9N A;  2NRT A;  1UPH A;  4HAI A;  1HIW A;  4RNO A;  2JEI A;  3NWI A;  4HYK A;  4FZN A;  1JAJ A;  8ICQ A;  2FJ6 A;  3MGV A;  1U4B A;  1VLB A;  5HP4 A;  1X42 A;  1BGX T;  1HEK A;  2AJQ A;  4K98 A;  4PJ0 U;  2KNJ A;  5IIM A;  5F9N A;  3KHR A;  4AT9 A;  3SAG A;  9ICJ A;  1F44 A;  2HI0 A;  2YX8 A;  1K1Q A;  5DB9 A;  8ICI A;  1A77 A;  2BKE A;  1K5O A;  4JK1 A;  4F4Y A;  1ZQW A;  4JWM A;  4XUS A;  1ZQR A;  8ICW A;  3JZ0 A;  5EE1 A;  3UPS A;  7ICI A;  3WK8 A;  4Y2U A;  2YN4 A;  2VA8 A;  2IMW P;  3BQ0 A;  4WC5 A;  3G6X A;  4OAI Z;  4JUZ A;  2ZH7 A;  5J0U A;  3KTQ A;  2K8B B;  5B66 U;  4YN4 A;  1X9S A;  1NK8 A;  4CE6 A;  1L6N A;  3QU9 A;  5HRF A;  2K4P A;  3AQK A;  4J9Q A;  2IBK A;  2MRL A;  5CJ7 A;  2UVU A;  4MFA A;  4XRH A;  4ELV A;  3L5K A;  3PSP A;  4XQ7 A;  4IQT A;  1HJP A;  1S0O A;  2HW3 A;  5AM0 A;  4YMO A;  5HRK A;  2WAQ C;  8ICS A;  4ED8 A;  1KFD A;  4JV2 A;  3AQL A;  3G6V A;  1Z4N A;  5AKG A;  5ALY A;  4WH5 A;  3EUB 2;  2VIX A;  3B0Y A;  1Z1V A;  5CFS A;  2RRD A;  4LT6 A;  1MIY A;  5KT7 A;  4X4N A;  5AKX A;  4OCZ A;  3C21 A;  4DO9 A;  4ICA A;  5AM4 A;  2RP5 A;  4AT7 A;  2JZB A;  2D3D A;  1TK0 A;  1SXD A;  3SQI A;  1L7N A;  4NXW A;  9ICA A;  2IOF K;  3V6K A;  3H0R B;  4YMM A;  2ID1 A;  4EYH B;  1MIV A;  4P4P A;  3NKU A;  2G09 A;  4LVS A;  4KLD A;  4NXU A;  4DF4 A;  2HHT A;  9ICS A;  3I28 A;  4MKP A;  9ICW A;  3UM9 A;  1QQ6 A;  3H3A A;  4DSL A;  3ZI4 A;  1QQ7 A;  4RQ0 A;  5KG5 A;  3KKA C;  2DRA A;  4X4R A;  4F4X A;  2QLT A;  1ZD3 A;  5DGB A;  4KLG A;  4KLQ A;  4YP3 A;  3ZD9 A;  5DQI A;  4NV0 A;  2YMQ A;  4ECQ A;  3MDC A;  3QYP A;  3SEN A;  4RQ6 A;  2D6F C;  5AKL A;  1SL0 A;  2PBE A;  2JXJ A;  5HNK A;  1OU5 A;  2FPK A;  1NJX A;  1X9M A;  3C29 A;  4P4O A;  1S10 A;  1UCV A;  3SV4 A;  2DL0 A;  3FM9 A;  3F2C A;  5AK3 A;  5DGA A;  4MFF A;  1MIW A;  2KZM A;  1MN8 A;  4WC6 A;  5KFM A;  3PST A;  8ICZ A;  4FS2 A;  2JV3 A;  4IRD A;  2E8P A;  3H0M B;  5DDY A;  2W8K A;  4DL3 A;  1KBU A;  2PFO A;  1QCK A;  4NLC A;  4P0P A;  5DBA A;  7ICF A;  2MAX A;  5DB8 A;  5DEC A;  4C8O A;  3CK6 A;  3RAQ A;  4FHX A;  2XY6 A;  4F4W A;  5KT6 A;  3M6Z A;  5FP0 A;  2BR0 A;  1S76 D;  3RH5 A;  3RAX A;  3H4B A;  2BCS A;  2E3T A;  3HIL A;  4DF8 A;  2YQE A;  2I6X A;  2UVW A;  2HVH A;  1PVR A;  1OUQ A;  4NXX A;  1SKW A;  4ECY A;  4UAS A;  1LKY B;  2KHV A;  3PX6 A;  2ZIU B;  2HBK A;  1ZQT A;  5KG0 A;  4FZL A;  3ZDB A;  4DOB A;  2OM6 A;  5HML A;  4WC4 A;  5KFL A;  2UVV A;  1N63 A;  4UB4 A;  2HBM A;  4F5R A;  4B9T A;  5ALU A;  5IIK A;  1IG6 A;  1ZQM A;  1ZXI A;  5KFN A;  5AKJ A;  2BPF A;  4ELT A;  4MEY A;  3NUQ A;  4F50 A;  1S77 D;  3NYB A;  2GAF D;  2J6T A;  4TUQ A;  2CRX A;  4K4G A;  2Q0Z X;  4NXV A;  4RPZ A;  4YXM A;  5KL1 B;  4YD1 A;  4AP9 A;  4KLO A;  1X6J A;  9ICK A;  4OJ5 A;  5KAF U;  3UXP A;  3JPP A;  2M2W A;  3RJF A;  3I76 A;  3PSF A;  4UW9 A;  3F2B A;  2E5S A;  4IRC A;  9ICI A;  4E80 A;  4UB8 U;  1TAU A;  3PW0 A;  2W9B A;  3SR6 A;  8ICG A;  4BUG A;  4WC3 A;  1T4G A;  5HRB A;  2KJ9 A;  4X0A A;  2KFN A;  3N7S C;  3N7R C;  2DUY A;  3AU2 A;  4F72 A;  4KLM A;  3E58 A;  5J0P A;  4R8U B;  2NO4 A;  1MC8 A;  4UAV A;  4J9O A;  4YCX A;  1ZRM A;  1PK1 B;  8ICJ A;  5ALZ A;  5J29 A;  1QTM A;  4EBD A;  5D49 A;  2JH1 A;  1DK3 A;  3IRU A;  3IHQ B;  3Q8S B;  3EYZ A;  2R18 A;  4RQ4 A;  1ZQ1 C;  4UAW A;  2EWR A;  4O5C A;  7ICL A;  3LVW A;  2GLE A;  2HHS A;  2MU2 A;  7ICE A;  1B4F A;  4NJ8 A;  4UQG A;  2V4R A;  4QWE A;  2GH1 A;  4NLZ A;  4QJF B;  5L1J A;  2RFF A;  4UB5 A;  9ICP A;  3SD7 A;  3BZK A;  1ARO P;  4EX7 A;  3SI8 A;  2K8C B;  4M9L A;  2BQU A;  5CP2 A;  4RWO A;  2ZH8 A;  3OTQ A;  4OJP A;  2C28 A;  1NK0 A;  1R89 A;  3Q8M A;  2Y0S C;  2K8A A;  2PMZ C;  3SEI A;  4ECT A;  1NK6 A;  1N60 A;  5KFH A;  2I1Q A;  2HSZ A;  3ORY A;  5HRG A;  2W9A A;  3PY8 A;  5D62 A;  2J6U A;  1SZH A;  3KHG A;  1TK5 A;  4J9S A;  4M6W B;  5ALM A;  3UQ0 A;  3C66 A;  2M9N A;  5EE9 A;  4EEL A;  2J6S A;  1A76 A;  3THV A;  5KG2 A;  4NLN A;  2FLN A;  3MFH A;  1JXE A;  1ZQF A;  8ICF A;  5HRD A;  5ALG A;  4UB6 U;  4J9P A;  2W9C A;  4WOY A;  2XI9 A;  3QEB Z;  1O08 A;  5BPC A;  3WFQ E;  1FEZ A;  1TE2 A;  9ICL A;  3OUY A;  2F1H A;  5KG4 A;  4RT2 A;  5J8Y C;  4OO1 J;  5HRH A;  3UPQ A;  5KFU A;  4F4Z A;  3F2D A;  2RHF A;  2ZUD A;  4DQR A;  1SWW A;  1Q79 A;  1ZD2 P;  2ZH1 A;  2Y9T A;  1GO3 F;  4O0I A;  5K4L A;  1BVS A;  1EXN A;  2F76 X;  4I28 A;  5AI6 A;  1SZP A;  4PGQ A;  1LV5 A;  2HOF A;  3RR8 A;  3B9J A;  5CRX A;  5J2F A;  4O6A A;  5ALV A;  4I2D A;  3JPS A;  1FFV A;  2PXI A;  7ICR A;  3H37 A;  3HKZ C;  4DL6 A;  4KN4 A;  4Z6E A;  5AK6 A;  4UAU A;  4DSF A;  2DVI A;  4F2R A;  5KFS A;  2NRX A;  4K96 A;  3M8R A;  4O69 A;  1NKB A;  5JRT A;  3DEE A;  3ALR A;  2O1P A;  2EZX A;  2BBJ A;  4QZI A;  4NM2 A;  4J9R A;  5C5J A;  1ZQH A;  1ZJM A;  9ICC A;  4US8 A;  1NKC A;  2XGQ A;  1ZQV A;  1T94 A;  3ICX A;  5DQG A;  2G0A A;  2KG5 A;  3JPN A;  5EE3 A;  4FHW A;  3NGD A;  1N56 A;  2LPE A;  3PHZ A;  3MAB A;  1NK9 A;  3VCB A;  3HJ4 A;  5ALQ A;  4EEB A;  5KT4 A;  3QUC A;  2PI4 A;  2W11 A;  8ICB A;  2KJ5 A;  3I1Y A;  4OJO A;  1SV4 A;  2ODG A;  1T3N A;  4IG8 A;  3AU6 A;  4X4V A;  1T7P A;  5KT3 A;  5HMM A;  2ZJA A;  2LBO A;  2DPI A;  2C22 A;  2B4V A;  4KMU A;  1DK2 A;  3AL0 B;  2P6R A;  4JV0 A;  4PPX A;  4IR1 A;  3H40 A;  2RDI A;  5KFQ A;  4DL4 A;  3WFO A;  2ATL A;  4O67 A;  1JIH A;  5AHX A;  3MGH A;  2P6U A;  1RYU A;  3IN5 A;  4M0A A;  4BWJ A;  4OAG A;  3WU2 U;  2KZZ A;  2ZH2 A;  1WUD A;  3NVZ A;  3AQN A;  2ZJ5 A;  5KFK A;  5J0S A;  2F3N A;  3NS1 A;  2H3F A;  3V6J A;  1CI4 A;  2HHQ A;  1Z00 A;  3O0F A;  4C0Z A;  1ZJN A;  1KL9 A;  1RG6 A;  1KKX A;  2VA2 A;  9ICU A;  3H8W A;  4LJX A;  4USA A;  3HP6 A;  2DR7 A;  4ZH4 A;  4B9M A;  3GV5 B;  2HOQ A;  5KFX A;  5DG9 A;  2ASL A;  5EWG A;  7ICK A;  3H8S A;  4ED2 A;  2ZH9 A;  2HBL A;  5KFO A;  1XO0 A;  2XCP A;  4P4M A;  4NM1 A;  4NXT A;  5HRI A;  3LK9 A;  3HW8 A;  2PFP A;  5AI9 A;  2HHP A;  1ZQN A;  4Y2J A;  4BX9 C;  1V38 A;  2NRV A;  4JWN A;  4EBJ A;  3N97 B;  3PW5 A;  1XC9 A;  4QZG A;  4I29 A;  8ICC A;  5HC9 A;  3RB0 A;  1WWV A;  2KZ3 A;  4YFK A;  5G5G A;  3BDP A;  4S3N A;  3UMC A;  2CN1 A;  2ZH4 A;  3QU4 A;  4KLF A;  5KFT A;  3H8M A;  3WKC A;  4OAF A;  2F77 X;  9ICE A;  4QWB A;  2W54 A;  4E0D A;  1JAL A;  1IIP A;  4RZR A;  1KFT A;  1XSL A;  1PVQ A;  2BCR A;  4ECU A;  4CNQ A;  8ICT A;  3JCF A;  2ZHA A;  3MGI A;  9ICN A;  1N62 A;  3PW7 A;  3ER9 B;  3WK9 A;  4F91 B;  4ECZ A;  2RDJ A;  1U48 A;  2O5A A;  2KN7 A;  5JUM A;  4DFJ A;  3UMB A;  5D61 A;  2ZXH A;  1ZD5 A;  4DEZ A;  5DQH A;  2ISP A;  4PGY A;  4FFD A;  4ED3 A;  4KLH A;  2YB4 A;  4C4T A;  4RQ5 A;  1BPX A;  4I2H A;  3M7D A;  5HR6 A;  3WKB A;  5JTI A;  3FAH A;  2BDP A;  2EZZ A;  1MSW D;  5J2A A;  3DDH A;  4QWC A;  3OSP A;  2VKQ A;  5AKY A;  3PW2 A;  4ATB B;  1URJ A;  3QXG A;  3FC4 A;  5AI5 A;  2LMR A;  4CF5 A;  5DKW A;  2ZXI A;  4ECX A;  3FYH A;  5KFB A;  1SIJ A;  1NKE A;  3VC8 A;  2XC9 A;  2KKP A;  4I2A A;  2WB1 F;  1Q46 A;  4M9N A;  2F8K A;  3J81 j;  3MR3 A;  4K9A A;  4I2E A;  1BPZ A;  4KLU A;  4KB6 A;  4RWP A;  2PFQ A;  4US9 A;  4YQW A;  2W8L A;  4RNN A;  3L3F X;  2DFL A;  4C7Z A;  2ISO A;  9ICM A;  9ICR A;  2WF9 A;  3GU3 A;  1XU4 A;  4ACO A;  1OXJ A;  4LZD A;  2HCF A;  1D9D A;  2WF7 A;  2M2V A;  1ZQO A;  3JPQ A;  1ZQU A;  4QWD A;  1U9L A;  2K4E A;  2XVT A;  1ZQQ A;  9ICV A;  2ZHB A;  4X4T A;  1TKD A;  4QNL A;  2NRZ A;  1NJY A;  2BGW A;  1PUZ A;  1F5A A;  3B0X A;  4FHV A;  1BNO A;  2KVS A;  3IP4 B;  2XY7 A;  3PNC A;  1VDV A;  4M6W A;  3JPR A;  4UBB A;  2Y9U A;  3IG8 A;  7ICO A;  1SGG A;  2BBH A;  4NL9 A;  2FLP A;  4FO1 A;  2EQY A;  2H3Z A;  5D63 A;  4F4K A;  9ICB A;  4PHA A;  2AQ0 A;  4J9L A;  5KFV A;  9ICQ A;  5AI0 A;  3V72 A;  1YLQ A;  5AIC A;  3NVO A;  2XGP A;  2D8C A;  3WKD A;  2KIC A;  1S5L U;  4WCW A;  4O5E A;  3TFS A;  3GIK A;  4F5Q A;  3RH4 A;  1C7Y A;  3MFI A;  1D8Y A;  4F5O A;  3OVS A;  4GC7 A;  5D46 A;  2ZIV A;  3RB3 A;  4X5V A;  5J0Q A;  3H4D A;  9ICF A;  1FIQ A;  2PI5 A;  1PVP A;  2XCA A;  1JRO A;  2IA6 A;  1Q78 A;  7ICU A;  1ZQG A;  4Y2Y A;  1FO4 A;  2H3I A;  3ZDC A;  2QB0 A;  4IQW A;  5AKH A;  4NY8 A;  5J2C A;  3H38 A;  7ICN A;  2AH5 A;  1NI3 A;  4QZ8 A;  2BCQ A;  2ZUB A;  1PK1 A;  2AXT U;  1P7D A;  4P2H A;  4ECV A;  4WC2 A;  3ETR A;  4X4O A;  5IIL A;  2Q66 A;  3V6H A;  3M9N B;  4ED7 A;  2M2U A;  1SKS A;  4GLX A;  3CRX A;  3OHA A;  2V9W A;  3Q8P B;  4EEN A;  1L8O A;  3RRG A;  5CB1 A;  1TFR A;  2FLL A;  3IDW A;  4ED6 A;  5ALN A;  3CP8 A;  5BOM A;  2FPL A;  4ATB A;  3MDA A;  3AEV A;  1R8C A;  3HKZ F;  3RJK A;  5J2D A;  4Q8F A;  3R9K A;  1ZET A;  2KIW A;  1ZOL A;  1NK5 A;  4FHY A;  1L7M A;  3AQM A;  1NNL A;  4PL2 A;  1YZ7 A;  1KLN A;  1XS9 D;  3JPT A;  2KKV A;  4GXJ A;  3MCR A;  5ALE A;  3OPX A;  1X40 A;  5ALX A;  3TAQ A;  3PV8 A;  2W3R A;  1LVH A;  1ZQZ A;  3DV9 A;  1Z19 A;  4KN7 A;  3QNM A;  3C18 A;  2Y0S F;  3ISD A;  2KK0 A;  4TUR A;  3TAN A;  4KLI A;  2W9C B;  2N1R A;  3UMG A;  4I2G A;  4M9J A;  1KDH A;  2DGZ A;  5L9X A;  1PZN A;  3EZ5 A;  2ZIX A;  3C28 A;  4E7X A;  4YVZ A;  2DKX A;  7ICG A;  1CUK A;  2EAO A;  3MR6 A;  5TZV A;  4I2I A;  4KIT B;  4B9N A;  2IOH A;  4EV6 A;  2K89 A;  2ZJ8 A;  4QIW C;  2EDU A;  1COO A;  4GFJ A;  8ICX A;  4DFD A;  2KSO B;  2WAQ F;  3ONN A;  2E8M A;  3NVW A;  1UQV A;  5GTI U;  8ICY A;  4FS1 A;  4DSE A;  3RFA A;  3PX0 A;  2A3V A;  1NK7 A;  3GFK B;  3Q8Q B;  4B6J A;  2LM4 A;  3T3F A;  3V7K A;  2H3Q A;  1BNP A;  1L7O A;  2HVI A;  3GDX A;  5AM5 A;  2ZH3 A;  3MR2 A;  4TUS A;  5KTQ A;  2KP7 A;  2ZG6 A;  3SYZ A;  1J2N A;  5DLF A;  1LB2 B;  1L5U A;  3PZP A;  4IC9 A;  3NRW A;  3OVA A;  4DSK A;  1OW5 A;  4QZA A;  2OH2 A;  5KFE A;  5J0T A;  5BOL A;  2IHO A;  5KG6 A;  1RZT A;  1UEV A;  2G06 A;  1T8E A;  3KKA A;  2KOB A;  1JI7 A;  5CEH A;  3H7I A;  5AKK A;  3ISC A;  2M0N A;  3AM9 A;  3PMN A;  4I0U A;  4EZ9 A;  4I2J A;  1O03 A;  4QZB A;  1CRX A;  5AM1 A;  2R8J A;  3F5E A;  2LYH A;  2KSO A;  3BS7 A;  2FPM A;  9ICX A;  3Q8L A;  2PFN A;  1XO1 A;  2WF6 A;  4GIB A;  8ICL A;  2ZIX B;  4QZD A;  2KVC A;  1KEJ A;  1WCL A;  2O6K A;  4DS4 A;  5HHI A;  2W7P A;  4OAH A;  2W9B B;  1ZYQ A;  4J03 A;  3T5H A;  3UQ2 A;  5B3Q A;  4KLL A;  2GOL A;  3ERC C;  1TK8 A;  4K4H A;  4M2Y A;  2R8H A;  4N7R A;  4PGX A;  1J2M A;  2VA3 A;  5J2G A;  2ASD A;  4LEZ A;  2B6G A;  2JEF A;  3TAP A;  4ELU A;  2KTQ A;  2A1A A;  3TAD A;  4C80 A;  1Q3U A;  3L4P A;  3OWG A;  2AQ4 A;  4RQ8 A;  1RQL A;  3LWM A;  2B21 A;  4TQS A;  4DLG A;  2YB1 A;  4BWM A;  2RLT A;  2MUT B;  5GTH U;  3RRH A;  4C8K A;  2F44 A;  2OYY A;  3GII A;  5ALR A;  8ICP A;  8ICU A;  1KN5 A;  4KX3 A;  3HIY A;  1NZB A;  3BS5 B;  4DQP A;  3SZ2 A;  1FFU A;  4RWN A;  2BPG A;  2YMP A;  5J0O A;  2ZIU A;  4RQ3 A;  4CCH A;  2OXO A;  4Z6D A;  3TFR A;  5EWF A;  2HN1 A;  4RPX A;  1BPE A;  4MHV A;  2WF8 A;  1IM4 A;  4Q45 A;  7ICT A;  2UVR A;  3ISB A;  1UET A;  1L3V A;  3T5K A;  3QU2 A;  4OJ6 A;  1VJ5 A;  3KZI U;  3TI0 A;  1RQN A;  9ICH A;  4YR0 A;  2OEH A;  2G08 A;  5ALK A;  3ZDA A;  2QAR A;  5DB7 A;  5KFD A;  5EOZ A;  1NO5 A;  4Z6C A;  5J2J A;  3KBB A;  5A0L A;  2LI6 A;  5KG7 A;  4KM5 A;  4LEW A;  2NRK A;  1WCN A;  2ZTD A;  5AKI A;  4FE3 A;  3NVV A;  4Q8E A;  2ZH5 A;  3AN1 A;  5AIA A;  3C2L A;  4X4S A;  4DSI A;  5F3X B;  2BE3 A;  2DBY A;  2JMG A;  1TFY A;  4O3M A;  2F1I A;  4X4P A;  5F9L A;  8ICN A;  1TVA A;  4WC7 A;  3QU5 A;  4RQ1 A;  1LKY A;  2KV2 A;  2HOI A;  4HX0 A;  5ALI A;  4AT8 A;  3WKE A;  1ZQL A;  1RXV A;  2A1J B;  2IHM A;  1TAQ A;  5KFJ A;  5DED A;  1UEU A;  2CXY A;  2NRW A;  4O3N A;  5HRL A;  3RH6 A;  1ZQA A;  2DR8 A;  5EE0 A;  4O5K A;  1COK A;  2PKE A;  3UXO A;  3M9M B;  1S0V A;  2DWQ A;  4WQL A;  1Q8K A;  4G9B A;  1NJW A;  1ZD4 A;  4MF8 A;  2KE7 A;  2W7O A;  5AK5 A;  4RUC A;  2AGO A;  3PW4 A;  2WF5 A;  5KFZ A;  3KHL A;  4EZ6 A;  1N5X A;  4OJL A;  3MR5 A;  5J0W A;  2FDR A;  3QUT A;  2DRB A;  3QUQ A;  4O3Q A;  3EW9 A;  1JUD A;  4KMO B;  5IIJ A;  3JYY A;  3RBE A;  5KT5 A;  3JPO A;  3MC1 A;  2K4I A;  5KG3 A;  3LQC B;  3RB6 A;  1RXW A;  3N7P D;  4EBK A;  2WFA A;  2OHF A;  5DDM A;  2AHO B;  3OJS A;  4PHE A;  4IL6 U;  4TUP A;  3HT3 A;  4XJE A;  1U45 A;  5AK4 A;  1N48 A;  4A8E A;  4FH3 A;  3PR5 B;  2KHQ A;  1J97 A;  4UB2 A;  5AI4 A;  3N4M B;  2GO7 A;  4QWA A;  1N5W A;  8ICV A;  2CPR A;  1KNY A;  2KJ8 A;  3AQE A;  1NZP A;  4Y2X A;  3HJE A;  1UA1 A;  4R64 A;  5ALS A;  1XSP A;  1SKR A;  2BDU A;  4RU9 A;  4RNM A;  1YT3 A;  2DR5 A;  5ALO A;  7ICV A;  3C23 A;  4EBE A;  1V85 A;  2WB1 C;  3K1R B;  4DSJ A;  2RQ5 A;  3AQF A;  2ZTC A;  4F5P A;  2I5H A;  4ECS A;  3GZF A;  5ALJ A;  3HWT A;  2BPC A;  5KL8 B;  4AT7 B;  1DXS A;  3QEA Z;  1K1S A;  4KLE A;  1SL2 A;  2K4H A;  5KAI U;  4F3O A;  4WBZ A;  4ECW A;  4BDP A;  5J0X A;  1RM6 C;  2P35 A;  1L3T A;  4ZOH C;  3WK5 A;  4R63 A;  5DG8 A;  2W3S A;  1VJ7 A;  4IS7 A;  4K97 A;  3AUO A;  4TQR A;  4QZ9 A;  2QB1 A;  4QW9 A;  2IUB A;  4EBC A;  3BQ2 A;  2IOF A;  1KRP A;  2DQN B;  4RQM A;  3T5J A;  5DB6 A;  4E8F A;  1N61 A;  2ES6 A;  2F8L A;  2LYA A;  1NK4 A;  3ETL A;  4O3O A;  8ICH A;  2XY5 A;  1Z1B A;  4KX5 A;  1CEZ A;  4G3I A;  5KFF A;  3RJG A;  2FMS A;  2BZF A;  2W9M A;  4F93 B;  4UAY A;  2OWO A;  4EYI B;  3C2K A;  3BQ7 A;  3MBY A;  4ED0 A;  3V7J A;  1QH9 A;  4C4R A;  4CRX A;  7ICH A;  4R66 A;  2DPJ A;  1PX5 A;  5J0R A;  1UHU A;  4NLK A;  1R8B A;  4BGD A;  1L7P A;  2G5I B;  4KTQ A;  4U7C A;  1S9F A;  4YR3 A;  3WKA A;  5AM3 A;  3PX4 A;  3BS5 A;  3M9O B;  4B9L A;  5AKE A;  2K60 A;  3T79 A;  2E1E A;  3PO4 A;  5KFP A;  4Q44 A;  4RQ7 A;  3WFS C;  3F53 A;  4I2F A;  4Y2S A;  4O3S A;  2MA1 A;  3CNH A;  4I2B A;  4M04 A;  1T3Q A;  4PZO A;  4NKU A;  4GC6 A;  3QZ8 A;  1ZQI A;  4P0Q B;  2V4Q A;  1QQ5 A;  2NO5 A;  1SXE A;  2EZY A;  1MA7 A;  4NLG A;  2BCV A;  1R8A A;  4EX6 A;  3HX0 A;  2YTU A;  4UD4 A;  1RYR A;  4J9M A;  4NXZ A;  1N2X A;  1TAM A;  2JRZ A;  4P0P B;  8ICO A;  3SV3 A;  5CFT A;  1NJZ A;  4F2S A;  3HRD D;  4UAZ A;  4ED1 A;  1SWV A;  5ALW A;  4DOA A;  3KFU F;  2EAN A;  2HHV A;  1D8L A;  1Z00 B;  3D6J A;  5AIB A;  3GQC A;  3M1Y A;  2DF4 B;  2M2T A;  4GXI A;  4IQV A;  3U26 A;  2ZIV B;  3K75 D;  5B5E U;  4DL5 A;  3ZD8 A;  1XWL A;  1IV8 A;  3GIL A;  2G5H B;  4PL1 A;  3SMV A;  2QKQ A;  3HJ1 A;  4O68 A;  7ICS A;  2KD1 A;  3RJE A;  1MQ3 A;  3ER8 C;  5KT2 A;  2E8O A;  9ICO A;  4I2C A;  4UB1 A;  5L1L A;  5JU5 A;  5H2F U;  2HHW A;  2QB0 B;  4Q43 A;  4JV1 A;  4DOC A;  4JLX A;  1SL1 A;  2ALZ A;  5IIN A;  3HPO A;  4F92 B;  4NKT A;  4DFM A;  5DG7 A;  1VFG A;  4UD5 A;  4DL7 A;  3EPG A;  2JZB B;  1HUO A;  3RJJ A;  3GIJ A;  1DGJ A;  5L1I A;  4IQU A;  2GWS A;  4UB3 A;  3C2M A;  7ICJ A;  8ICE A;  3QX7 A;  3PR4 A;  2NYV A;  5F2V O;  2P66 A;  4M9G A;  4KLS A;  4O9M A;  2BHN A;  3PML A;  9ICG A;  1KSP A;  3WK6 A;  4QIW F;  4CGZ A;  2VJ4 A;  3QE9 Y;  4QZF A;  1RYS A;  2OCE A;  4JLZ A;  1L8L A;  1ZQK A;  1KTQ A;  2KFZ A;  3KHH A;  1XNS A;  1B43 A;  3NTU A;  4BXO A;  5J2H A;  2LHT A;  3WK4 A;  4RUA A;  3RBD A;  2BQ3 A;  2H3V A;  3RF9 A;  1C20 A;  4NWI A;  4UBC A;  2B51 A;  3C5G A;  5TIS U;  2LYB A;  5HHH A;  1X2I A;  3LYS A;  3H8J A;  4C8M A;  5DBB A;  2H5X A;  8ICR A;  2VAN A;  2HHX A;  5AI8 A;  4J9K A;  3Q8K A;  4FHP A;  2W43 A;  5ALD A;  4PZN A;  4X4Q A;  3GV7 B;  1JMS A;  2FE9 A;  4KLT A;  3QZ7 A;  4YD2 A;  1L3U A;  4WBY A;  1L3S A;  1B22 A;  2Q4T A;  3C1Y A;  5KFI A;  5CA7 A;  8ICM A;  1A0P A;  1SB3 C;  1Q3V A;  1DRG A;  2W55 A;  2ASJ A;  4WQK A;  4F8R A;  4LEV A;  3E0F A;  2BQR A;  4LEY A;  5AKZ A;  3LDA A;  1ZRN A;  3M6K A;  5CWR A;  4LZG A;  5D4B A;  4MF2 A;  3H0L B;  2YY6 A;  4F5N A;  5HR7 A;  3K7D A;  1ZQE A;  4YG2 A;  4R65 A;  4BJQ A;  4DQI A;  2Y1J A;  4KLJ A;  5III A;  4K99 A;  4I27 A;  4M5D A;  4FBU A;  1TV9 A;  2B0C A;  1KFS A;  4DL2 A;  4WC0 A;  5KFY A;  3NAS A;  2XO7 A;  5B3P A;  2A1J A;  5ALP A;  2ZH6 A;  4DQQ A;  3TAR A;  3M8S A;  1H38 A;  2W04 A;  1V4A A;  1TFW A;  4YR2 A;  1ZQY A;  5ALH A;  2F1J A;  2C2E A;  2GA9 D;  5KFG A;  4O3R A;  5KFR A;  4U6P A;  3IV6 A;  3A0B U;  1MQ2 A;  1ZQX A;  1BPY A;  1Z4O A;  4B9S A;  5KFA A;  1RPL A;  2FI1 A;  2Y1I A;  8ICK A;  3GIM A;  4EED A;  1BPB A;  1JQR A;  2JH7 A;  5KFW A;  3OGU A;  3K4G A;  7ICM A;  4WC1 A;  2YML A;  4RPY A;  2WHE A;  1F0M A;  2FMQ A;  1JN3 A;  5C0Y A;  1KW4 A;  5J8Y A;  3QU7 A;  2AGQ A;  2I9G A;  4FO6 A;  5T14 A;  3WFR E;  5ALL A;  2AU0 A;  2PMZ F;  1JXL A;  1FA0 A;  1WWU A;  1Z3E B;  2C2R A;  4XQ8 A;  2C2D A;  1X66 A;  1F5S A;  3OJU A;  2JEG A;  2EAM A;  4F71 A;  4EGW A;  4K4I A;  4M47 A;  4CF4 A;  1U49 A;  9ICT A;  5DLG A;  1PK3 A;  1YZ6 A;  3AMZ A;  1V9P A;  4UAT A;  2EAP A;  4ECR A;  1Y88 A;  2JGA A;  4WJ3 B;  4QZC A;  2B56 A;  4AYB C;  4IRK A;  3SAF A;  5CFU A;  2E1F A;  3F5A A;  5J2E A;  2MUT A;  3KD3 A;  4EP7 A;  1WYG A;  4CF3 A;  4P0Q A;  2R8I A;  3ZDE A;  3GV8 B;  4C4S A;  1HUZ A;  5KNI A;  4RT3 A;  5JTG A;  3OVB A;  5E79 U;  1KQQ A;  3C1Z A;  2HMX A;  1X9X A;  3EF2 A;  4PHP A;  2AGP A;  4K9B A;  2KEY A;  3BJY A;  1UT8 A;  3N28 A;  5HR9 A;  3IM1 A;  3D2N A;  3RB4 A;  3IG5 A;  5ALF A;  4Y2R A;  4JB3 A;  2F2A B;  4Y2V A;  2R8K A;  3SAH A;  2NV3 A;  3E2E A;  1JX4 A;  5IIO A;  4DLE A;  2KMD A;  4B9V A;  4B9U A;  4K8V A;  1S0N A;  1RDF A;  3H39 A;  5EWE A;  4RWQ A;  3Q8R B;  3TAD C;  4C8N A;  3BZC A;  2R8G A;  2LKY A;  4Z6F A;  3OSN A;  4X4U A;  2G07 A;  4C8L A;  3C5F A;  3PSI A;  3CYM A;  3KZX A;  2HBJ A;  4EEY A;  2HHU A;  4C7Y A;  4DQS A;  3RJI A;  5CR0 A;  3A0H U;  4YMN A;  4MEX A;  5KG1 A;  4FBT A;  3OUY B;  4QW8 A;  2LM1 A;  3OV7 A;  4Y2Q A;  2MSN A;  4DCC A;  2W03 A;  1SV0 C;  3FDS A;  4DS5 A;  5DBC A;  4AYB F;  1UT5 A;  3OHB A;  1DGS A;  2DR9 A;  3L9D A;  2A19 A;  3RR7 A;  3D2Q A;  3RJH A;  3V7L A;  5HRE A;  1B0X A;  4RQ2 A;  4OD0 A;  4O3P A;  3K1Z A;  4BXO B;  4UAR A;  2L5Y A;  3PVX A;  3ZDD A;  1QSS A;  1UA0 A;  3ED5 A;  3RTV A;  1ZQP A;  5L1M A;  1QSY A;  2Z7J A;  4DFK A;  1V97 A;  3TQ1 A;  2ESE A;  3S6J A;  4JMU A;  2ZIW B;  1SV0 A;  3WK7 A;  3BQT A;  1AQ6 A; 
#chains in the Genus database with same CATH homology
 4PHD A;  4NLN A;  4I2F A;  3WFP A;  4PH5 A;  1NK5 A;  2FLN A;  3MFH A;  4I2B A;  4M04 A;  4O3S A;  3AQM A;  1JXE A;  1ZQF A;  1WOT A;  4FHY A;  4NKU A;  4AT8 B;  8ICF A;  4GC6 A;  3EPI A;  4GXK A;  5HRD A;  4QZE A;  3QZ8 A;  1ZQI A;  1KLN A;  2V4Q A;  1XS9 D;  3JPT A;  4NLG A;  1R8A A;  7ICQ A;  4DWI A;  4GXJ A;  2BCV A;  4M9H A;  5J2I A;  3HX0 A;  2ZTE A;  4J9P A;  2W9C A;  1ZQB A;  4UD4 A;  3QEB Z;  4J9M A;  4NXZ A;  5BPC A;  1RYR A;  1QLN A;  1ZQS A;  3WFQ E;  8ICO A;  3SV3 A;  9ICL A;  1NJZ A;  1ZQC A;  3OUY A;  2F1H A;  5KG4 A;  4F2S A;  4RWQ A;  3G6Y A;  4IR9 A;  4DFP A;  4RT2 A;  4UAZ A;  5KFC A;  3PV8 A;  4ED1 A;  3TAQ A;  1ZQD A;  1ZQZ A;  2JEJ A;  4KN7 A;  1X9W A;  5HRH A;  3UPQ A;  4DOA A;  5KFU A;  4F4Z A;  3ISD A;  2BCU A;  3C18 A;  4TUR A;  1BPD A;  8ICA A;  2HHV A;  2ZUD A;  3TAN A;  1ZQJ A;  4DQR A;  1D8L A;  4XA5 A;  1Z00 B;  4KLI A;  2IHN A;  1Q79 A;  2W9C B;  3GQC A;  4I2G A;  2ZH1 A;  4M9J A;  2WTF A;  2M2T A;  4GXI A;  1KDH A;  4IQV A;  4O0I A;  5L9X A;  1PZN A;  5J2B A;  1BVS A;  1EXN A;  3EWA A;  3EZ5 A;  4E7X A;  3K75 D;  4I28 A;  4YVZ A;  1U47 A;  1LV5 A;  1SZP A;  4PGQ A;  4DL5 A;  1CUK A;  1IXR A;  3MR6 A;  5TZV A;  1D9F A;  3RR8 A;  4I2I A;  1XWL A;  3ZD8 A;  4FH5 A;  4R8U A;  4KIT B;  5J2F A;  4B9N A;  3GIL A;  2ZJ8 A;  4I2D A;  3JPS A;  2PXI A;  7ICR A;  3H37 A;  3HJ1 A;  4DL6 A;  1DOQ A;  4KN4 A;  2ZUC A;  7ICS A;  4Z6E A;  1COO A;  8ICX A;  4DSF A;  5J0Y A;  2DVI A;  4F2R A;  5KFS A;  1XSN A;  2NRX A;  1S0M A;  3RJE A;  4QZH A;  1MQ3 A;  3UXN A;  4YXJ A;  1S97 A;  5KT2 A;  3M8R A;  1NOM A;  5J2K A;  9ICO A;  8ICY A;  4X0B A;  2FMP A;  3T5L A;  4I2C A;  3LWL A;  3THV A;  4UB1 A;  1NKB A;  3PO5 A;  4FS1 A;  4DSE A;  5L1L A;  3PX0 A;  2O1P A;  1NK7 A;  3BQ1 A;  2HHW A;  3GFK B;  4Q43 A;  4QZI A;  3Q8Q B;  1QSL A;  4JV1 A;  4DOC A;  1SL1 A;  5L1K A;  5IIN A;  2ALZ A;  3HPO A;  4F92 B;  7ICP A;  4NKT A;  4AT9 B;  4NM2 A;  4J9R A;  3V7K A;  3T3F A;  5CHG A;  5C5J A;  4DFM A;  5DG7 A;  1ZJM A;  4J9N A;  1ZQH A;  4MFC A;  2NRT A;  4DL7 A;  9ICC A;  1BNP A;  3EPG A;  4UD5 A;  2HVI A;  1NKC A;  4RNO A;  2XGQ A;  3GDX A;  1ZQV A;  2JEI A;  2JZB B;  1HUO A;  3RJJ A;  2ZH3 A;  3MR2 A;  5DQG A;  4TUS A;  3GIJ A;  4HYK A;  1JAJ A;  5KTQ A;  2KP7 A;  3JPN A;  3SYZ A;  8ICQ A;  1U4B A;  5DLF A;  1LB2 B;  1L5U A;  5L1I A;  5HP4 A;  4FHW A;  1BGX T;  3NGD A;  4IQU A;  1N56 A;  2GWS A;  4UB3 A;  3C2M A;  3MAB A;  7ICJ A;  1NK9 A;  8ICE A;  2AJQ A;  3HJ4 A;  5KT4 A;  3OVA A;  3PR4 A;  2PI4 A;  5F2V O;  5IIM A;  8ICB A;  5F9N A;  2P66 A;  4DSK A;  3KHR A;  4M9G A;  4AT9 A;  4QZA A;  1T3N A;  4IG8 A;  5KFE A;  5J0T A;  5BOL A;  3AU6 A;  4KLS A;  4O9M A;  2BHN A;  3PML A;  9ICJ A;  4X4V A;  5KG6 A;  1T7P A;  1K1Q A;  1RZT A;  1UEV A;  9ICG A;  1KSP A;  5KT3 A;  5HMM A;  2ZJA A;  5DB9 A;  1T8E A;  1A77 A;  2BKE A;  8ICI A;  2DPI A;  4JK1 A;  2C22 A;  4F4Y A;  4KMU A;  3H7I A;  1DK2 A;  3QE9 Y;  1ZQW A;  3ISC A;  2P6R A;  3PMN A;  4QZF A;  4JV0 A;  1RYS A;  4JWM A;  4PPX A;  4XUS A;  4IR1 A;  3H40 A;  4EZ9 A;  4I2J A;  2RDI A;  1ZQR A;  5KFQ A;  1ZQK A;  4DL4 A;  4QZB A;  1KTQ A;  2KFZ A;  8ICW A;  2R8J A;  3JZ0 A;  3WFO A;  2LYH A;  2ATL A;  1JIH A;  3KHH A;  1B43 A;  2FPM A;  3UPS A;  7ICI A;  3NTU A;  9ICX A;  3Q8L A;  5J2H A;  3MGH A;  4BXO A;  2P6U A;  4RUA A;  3RBD A;  2BQ3 A;  2PFN A;  1XO1 A;  4M0A A;  4BWJ A;  2VA8 A;  2IMW P;  8ICL A;  3BQ0 A;  4WC5 A;  3G6X A;  2KZZ A;  4JUZ A;  2ZH7 A;  2ZH2 A;  5J0U A;  4UBC A;  4QZD A;  3KTQ A;  3AQN A;  2ZJ5 A;  5KFK A;  3C5G A;  4YN4 A;  1KEJ A;  1WCL A;  1X9S A;  5J0S A;  4DS4 A;  1NK8 A;  5HHI A;  5HHH A;  3V6J A;  2W9B B;  1X2I A;  2HHQ A;  1ZYQ A;  1Z00 A;  3H8J A;  7ICG A;  5HRF A;  4C8M A;  3T5H A;  5DBB A;  2H5X A;  3UQ2 A;  8ICR A;  2VAN A;  3AQK A;  4KLL A;  4J9Q A;  1ZJN A;  2IBK A;  5CJ7 A;  2UVU A;  2HHX A;  1TK8 A;  4K4H A;  4MFA A;  4J9K A;  3Q8K A;  4XRH A;  2R8H A;  4ELV A;  4M2Y A;  4FHP A;  4XQ7 A;  2VA2 A;  4IQT A;  4PGX A;  1HJP A;  2VA3 A;  1S0O A;  5J2G A;  2ASD A;  2HW3 A;  9ICU A;  4X4Q A;  3H8W A;  3GV7 B;  4YMO A;  3HP6 A;  5HRK A;  2DR7 A;  4ZH4 A;  4B9M A;  8ICS A;  3GV5 B;  1JMS A;  1KFD A;  5KFX A;  5DG9 A;  4ED8 A;  2ASL A;  5EWG A;  4JV2 A;  4KLT A;  3AQL A;  2JEF A;  3QZ7 A;  3H8S A;  4YD2 A;  3G6V A;  3TAP A;  4ELU A;  1L3U A;  2KTQ A;  4ED2 A;  7ICK A;  4WBY A;  2ZH9 A;  5KFO A;  1L3S A;  1B22 A;  3B0Y A;  4X4N A;  4LT6 A;  1MIY A;  5KT7 A;  2AQ4 A;  4RQ8 A;  2XCP A;  3LWM A;  4P4M A;  2B21 A;  4NM1 A;  3C21 A;  3C1Y A;  4TQS A;  5KFI A;  4DLG A;  4BWM A;  5CA7 A;  5HRI A;  4DO9 A;  8ICM A;  3LK9 A;  3HW8 A;  2MUT B;  4AT7 A;  2PFP A;  2JZB A;  3RRH A;  2HHP A;  4C8K A;  1TK0 A;  1ZQN A;  3GII A;  8ICP A;  9ICA A;  2NRV A;  8ICU A;  2ASJ A;  3V6K A;  4JWN A;  4EBJ A;  3N97 B;  4F8R A;  3HIY A;  3PW5 A;  1XC9 A;  4DQP A;  4QZG A;  4YMM A;  3SZ2 A;  2BQR A;  4I29 A;  2ID1 A;  4EYH B;  8ICC A;  5HC9 A;  1MIV A;  3LDA A;  4P4P A;  3RB0 A;  4RWN A;  2KZ3 A;  4YFK A;  4LVS A;  3BDP A;  4KLD A;  4S3N A;  4DF4 A;  2BPG A;  2HHT A;  5CWR A;  5J0O A;  4LZG A;  9ICS A;  4RQ3 A;  4CCH A;  9ICW A;  5D4B A;  4MF2 A;  2ZH4 A;  4F5N A;  4KLF A;  4Z6D A;  4DSL A;  1ZQE A;  4YG2 A;  3H3A A;  3TFR A;  5KFT A;  5EWF A;  4RQ0 A;  4R65 A;  5KG5 A;  4RPX A;  1BPE A;  4DQI A;  2DRA A;  2Y1J A;  4F4X A;  4X4R A;  5DGB A;  4KLG A;  4KLQ A;  4YP3 A;  9ICE A;  4KLJ A;  4QWB A;  1IM4 A;  3ZD9 A;  5DQI A;  4Q45 A;  7ICT A;  2UVR A;  5III A;  3ISB A;  4ECQ A;  4E0D A;  1KFT A;  4RZR A;  1UET A;  1XSL A;  2BCR A;  4I27 A;  4ECU A;  3MDC A;  1L3V A;  4FBU A;  4M5D A;  3T5K A;  1TV9 A;  8ICT A;  1KFS A;  4DL2 A;  4WC0 A;  4RQ6 A;  5KFY A;  2XO7 A;  3TI0 A;  2ZHA A;  3MGI A;  9ICN A;  1SL0 A;  2A1J A;  3PW7 A;  9ICH A;  4YR0 A;  4DQQ A;  2ZH6 A;  2PBE A;  5HNK A;  3TAR A;  1OU5 A;  3M8S A;  1H38 A;  2FPK A;  5DB7 A;  3ZDA A;  5KFD A;  1NJX A;  4F91 B;  5EOZ A;  1V4A A;  1TFW A;  1X9M A;  4Z6C A;  4YR2 A;  1NO5 A;  5J2J A;  4P4O A;  4ECZ A;  1ZQY A;  2RDJ A;  1U48 A;  2F1J A;  1S10 A;  1VFG A;  3SV4 A;  2O5A A;  2KN7 A;  2C2E A;  5DGA A;  5KG7 A;  4MFF A;  1MIW A;  1WCN A;  2ZTD A;  5KFG A;  5JUM A;  4O3R A;  5KFR A;  2KZM A;  2NRK A;  4DFJ A;  4Q8E A;  4WC6 A;  2ZH5 A;  5KFM A;  1MQ2 A;  8ICZ A;  1ZQX A;  4DEZ A;  4FS2 A;  5DQH A;  4IRD A;  5DDY A;  2ISP A;  3C2L A;  1BPY A;  2W8K A;  4PGY A;  4DL3 A;  2PFO A;  4B9S A;  4X4S A;  5KFA A;  4DSI A;  4ED3 A;  2BE3 A;  1RPL A;  4KLH A;  1TFY A;  5DBA A;  2Y1I A;  2MAX A;  7ICF A;  8ICK A;  5DB8 A;  3GIM A;  2F1I A;  4X4P A;  1BPB A;  5F9L A;  8ICN A;  1TVA A;  5KFW A;  3OGU A;  1JQR A;  5DEC A;  4WC7 A;  4C8O A;  4RQ1 A;  3K4G A;  4RQ5 A;  1BPX A;  7ICM A;  4AT8 A;  3RAQ A;  4I2H A;  4WC1 A;  4FHX A;  1ZQL A;  2XY6 A;  4F4W A;  1RXV A;  2A1J B;  5KT6 A;  2IHM A;  1TAQ A;  5KFJ A;  4RPY A;  2BR0 A;  5DED A;  1S76 D;  1UEU A;  3RH5 A;  2NRW A;  3RAX A;  4O3N A;  2FMQ A;  1JN3 A;  5HRL A;  2BDP A;  1MSW D;  3RH6 A;  5J2A A;  1ZQA A;  2DR8 A;  3H4B A;  4O5K A;  4QWC A;  2AGQ A;  2BCS A;  4FO6 A;  2I9G A;  3WFR E;  3UXO A;  3M9M B;  4DF8 A;  3OSP A;  2AU0 A;  1JXL A;  2UVW A;  1S0V A;  3PW2 A;  1FA0 A;  2HVH A;  4ATB B;  1Z3E B;  2C2R A;  2C2D A;  4XQ8 A;  1NJW A;  3OJU A;  2JEG A;  4MF8 A;  4K4I A;  4M47 A;  4RUC A;  1U49 A;  5DKW A;  2AGO A;  1SKW A;  4ECY A;  3PW4 A;  4ECX A;  3FYH A;  5KFZ A;  9ICT A;  5KFB A;  5DLG A;  3KHL A;  1NKE A;  3PX6 A;  4EZ6 A;  2XC9 A;  1ZQT A;  4I2A A;  4M9N A;  5KG0 A;  3MR5 A;  3MR3 A;  5J0W A;  1V9P A;  3ZDB A;  4DOB A;  4I2E A;  2DRB A;  4O3Q A;  4ECR A;  1Y88 A;  1BPZ A;  5HML A;  4QZC A;  3EW9 A;  4WC4 A;  5IIJ A;  5KFL A;  4KLU A;  2UVV A;  4RWP A;  2PFQ A;  3JYY A;  4UB4 A;  3RBE A;  5KT5 A;  4F5R A;  3JPO A;  5IIK A;  4B9T A;  4YQW A;  2W8L A;  4IRK A;  5KG3 A;  1ZQM A;  5KFN A;  4RNN A;  3LQC B;  2ISO A;  2DFL A;  3RB6 A;  2BPF A;  4ELT A;  9ICM A;  9ICR A;  1RXW A;  4MEY A;  1XU4 A;  4EBK A;  4F50 A;  1S77 D;  4LZD A;  5DDM A;  3NYB A;  1D9D A;  5J2E A;  2MUT A;  2J6T A;  2M2V A;  3OJS A;  1ZQO A;  4EP7 A;  3JPQ A;  1ZQU A;  4PHE A;  1U9L A;  4QWD A;  1ZQQ A;  4TUP A;  4TUQ A;  3HT3 A;  9ICV A;  2ZHB A;  4X4T A;  1U45 A;  4K4G A;  1N48 A;  1TKD A;  2Q0Z X;  2NRZ A;  4RPZ A;  2R8I A;  1NJY A;  4YXM A;  4YD1 A;  3ZDE A;  3GV8 B;  4FH3 A;  2BGW A;  1HUZ A;  4KLO A;  3PR5 B;  4RT3 A;  9ICK A;  4UB2 A;  3UXP A;  1F5A A;  3N4M B;  3JPP A;  3OVB A;  3B0X A;  4QWA A;  4FHV A;  3C1Z A;  1BNO A;  2M2W A;  3RJF A;  8ICV A;  4PHP A;  2AGP A;  2XY7 A;  4IRC A;  9ICI A;  4E80 A;  1KNY A;  3BJY A;  1UT8 A;  4M6W A;  3PNC A;  3JPR A;  4UBB A;  7ICO A;  1NZP A;  5HR9 A;  1UA1 A;  4R64 A;  3IM1 A;  1XSP A;  2FLP A;  1SKR A;  4RU9 A;  3PW0 A;  2W9B A;  3RB4 A;  2R8K A;  1TAU A;  8ICG A;  4RNM A;  4F4K A;  9ICB A;  2DR5 A;  4WC3 A;  4PHA A;  7ICV A;  1T4G A;  3C23 A;  2AQ0 A;  4J9L A;  5KFV A;  9ICQ A;  4EBE A;  3E2E A;  5HRB A;  1JX4 A;  3V72 A;  1YLQ A;  4X0A A;  5IIO A;  4DLE A;  2KFN A;  2XGP A;  4DSJ A;  3AU2 A;  4KLM A;  4WCW A;  4O5E A;  2ZTC A;  4F5P A;  3TFS A;  4B9V A;  3GIK A;  5J0P A;  4R8U B;  4F5Q A;  4ECS A;  4B9U A;  3RH4 A;  3HWT A;  1C7Y A;  3MFI A;  1MC8 A;  1S0N A;  2BPC A;  1D8Y A;  3H39 A;  4J9O A;  4AT7 B;  4F5O A;  3OVS A;  4YCX A;  5EWE A;  1K1S A;  4GC7 A;  5D46 A;  3Q8R B;  3QEA Z;  1SL2 A;  4KLE A;  4C8N A;  8ICJ A;  3RB3 A;  2R8G A;  4F3O A;  4X5V A;  4Z6F A;  5J0Q A;  3H4D A;  9ICF A;  4WBZ A;  3OSN A;  5J29 A;  1QTM A;  4EBD A;  5D49 A;  4ECW A;  4BDP A;  2PI5 A;  4X4U A;  1DK3 A;  5J0X A;  4C8L A;  3C5F A;  3IHQ B;  3Q8S B;  3EYZ A;  2XCA A;  4RQ4 A;  1L3T A;  4EEY A;  4UAW A;  2HHU A;  2IA6 A;  4R63 A;  5DG8 A;  1Q78 A;  4O5C A;  7ICU A;  7ICL A;  4DQS A;  1VJ7 A;  3RJI A;  3AUO A;  1ZQG A;  5CR0 A;  4YMN A;  4TQR A;  4QZ9 A;  4MEX A;  2HHS A;  5KG1 A;  4FBT A;  4QW9 A;  3ZDC A;  7ICE A;  4EBC A;  3OUY B;  4UQG A;  3BQ2 A;  4QW8 A;  1KRP A;  3OV7 A;  2V4R A;  4QWE A;  4IQW A;  4NY8 A;  5J2C A;  4NLZ A;  3H38 A;  3T5J A;  5L1J A;  7ICN A;  3FDS A;  4QZ8 A;  5DB6 A;  2RFF A;  4DS5 A;  4E8F A;  5DBC A;  4UB5 A;  2BCQ A;  9ICP A;  2ZUB A;  1NK4 A;  1UT5 A;  3OHB A;  1DGS A;  3ETL A;  4O3O A;  8ICH A;  1ARO P;  3SI8 A;  3L9D A;  2DR9 A;  2XY5 A;  4P2H A;  4M9L A;  3RR7 A;  2BQU A;  4ECV A;  4WC2 A;  5CP2 A;  4RWO A;  1CEZ A;  4G3I A;  5KFF A;  2ZH8 A;  3RJH A;  3RJG A;  5IIL A;  4X4O A;  2C28 A;  1NK0 A;  2W9M A;  3V7L A;  2FMS A;  1R89 A;  4F93 B;  4UAY A;  3V6H A;  3Q8M A;  3M9N B;  4ED7 A;  2Q66 A;  5HRE A;  4RQ2 A;  2OWO A;  4EYI B;  4O3P A;  2M2U A;  4BXO B;  3C2K A;  3PVX A;  3ZDD A;  4ECT A;  4GLX A;  1SKS A;  1NK6 A;  3MBY A;  1UA0 A;  1QSS A;  5KFH A;  3V7J A;  3OHA A;  4ED0 A;  2I1Q A;  7ICH A;  3RTV A;  2V9W A;  3Q8P B;  1ZQP A;  4R66 A;  3ORY A;  1QSY A;  2DPJ A;  2W9A A;  5HRG A;  3PY8 A;  4DFK A;  2J6U A;  1PX5 A;  3KHG A;  5J0R A;  3TQ1 A;  3RRG A;  1TK5 A;  5CB1 A;  4J9S A;  1TFR A;  2FLL A;  4NLK A;  1R8B A;  4ED6 A;  4M6W B;  4BGD A;  5BOM A;  2FPL A;  3UQ0 A;  4KTQ A;  2M9N A;  3MDA A;  1S9F A;  4YR3 A;  3C66 A;  4ATB A;  3PX4 A;  3M9O B;  4B9L A;  2J6S A;  1A76 A;  1R8C A;  3RJK A;  5J2D A;  3PO4 A;  4Q8F A;  5KFP A;  4Q44 A;  3BQT A;  4RQ7 A;  1ZET A;  5KG2 A;  3WFS C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...