4PHEA

Structure of human dna polymerase beta complexed with t in the template base paired with incoming non-hydrolyzable gtp
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
329
structure length
325
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The spontaneous base substitution mechanisms of human DNA polymerase beta
rcsb
source organism Homo sapiens
molecule tags Transferase,lyase/dna
molecule keywords DNA polymerase beta
total genus 107
structure length 325
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2014-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4pheA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4pheA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4pheA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4pheA03
4KLJA 4J9RA 5DG9A 8ICXA 4KN4A 4AT7B 4P4PA 7ICHA 4QW9A 4YG2A 4YFKA 4UAWA 1QTMA 3HPOA 4ECSA 4O0IA 3GDXA 5F2VO 4BXOA 3OVBA 4RNMA 5HHIA 9ICFA 3RB4A 5KFWA 4IG8A 3JZ0A 1T3NA 2I9GA 2XY7A 3SYZA 1NKEA 9ICTA 5J0PA 2XO7A 2J6SA 3GIJA 3RJEA 1R8CA 4E7XA 4UBCA 1V9PA 4RQ8A 1ZQPA 4NLZA 4J9PA 3C2MA 2ZJAA 3QZ8A 2KZ3A 4DSFA 2V9WA 2ZH5A 3M8RA 1SL1A 4WBZA 2DRBA 4ECQA 3V6JA 2BE3A 3C1YA 4RPZA 2XCPA 1NJYA 3OGUA 3HW8A 1JIHA 3JPRA 1ZETA 1ZQWA 3ZDAA 3RJJA 3Q8LA 5IINA 4I29A 4AT9B 5DQHA 3TQ1A 5J2KA 3N4MB 3HJ4A 3ZD9A 5KT4A 4ELUA 5KT6A 1COOA 5CWRA 4MFAA 5KT7A 4ECRA 1DK3A 3RRGA 4UD4A 4IR9A 1RPLA 4R63A 3C2LA 1PX5A 4R64A 2VANA 5EWEA 4DFJA 3RB0A 1JXLA 3TFSA 4QZDA 4TQRA 4BXOB 4I2AA 4MFCA 1UT5A 2NRZA 3TI0A 4JWMA 4MFFA 8ICRA 3EW9A 2BQRA 7ICEA 4RWOA 3PW0A 4LVSA 7ICKA 7ICOA 1R89A 1QLNA 4RWPA 2ZH9A 2FPMA 2R8KA 4KLLA 1TV9A 5KG4A 1RXWA 2DR8A 3WFPA 1MIYA 2BQ3A 1ZQIA 3UXPA 3K75D 2HHVA 4X4TA 2HHQA 4MF8A 3KHRA 4R66A 2ASJA 4I2JA 3PMNA 7ICJA 3GV5B 2M2TA 2ZH6A 4F92B 7ICVA 3H3AA 4P4MA 4AT9A 3JPQA 2ZUCA 5J0WA 2XCAA 1X9MA 1ZQRA 5IIJA 4QZAA 3HP6A 1NKCA 4R8UB 2NRVA 1U4BA 2FMPA 3WFOA 2R8JA 4FHYA 5D49A 3KHHA 3EPGA 1TFYA 5EOZA 2WTFA 2MAXA 3ORYA 4TQSA 8ICGA 1SKSA 1L3UA 2AQ4A 3QEBZ 7ICTA 1JQRA 3OUYA 9ICNA 4P2HA 3H8JA 1XC9A 4RQ4A 2AQ0A 2ALZA 3B0YA 1XSLA 1N48A 3RAQA 4M6WB 2HVIA 5DB9A 3SV4A 1A77A 4F50A 4AT7A 2NRKA 2A1JB 1UT8A 2ZH4A 4DS5A 4F5RA 4J9MA 2DR9A 7ICUA 1HUOA 3Q8RB 2ZH3A 4I2DA 5KFUA 5J2HA 3V7JA 5D4BA 1BPYA 1TK8A 3RR7A 4F2SA 1CEZA 4UB3A 3AU6A 3T5LA 3MR3A 1L3TA 3HIYA 3ISDA 1WOTA 4X5VA 2HHUA 4RUCA 1UA1A 4J9QA 3PMLA 4FHXA 1UA0A 3PO4A 3PX4A 4I2EA 1ZQNA 2XY5A 1ZQOA 4CCHA 4RZRA 5DB6A 3GQCA 2BCVA 9ICQA 3AUOA 1SKWA 4QZHA 2H5XA 4P4OA 7ICMA 3NTUA 5DG8A 3ZDCA 5DDMA 3GILA 3H40A 4F2RA 4I27A 9ICIA 1H38A 4O3QA 2JEGA 3PW4A 4JWNA 4PHAA 4RU9A 4RWQA 5KG2A 1S0NA 3SI8A 4DLGA 2IHNA 3FYHA 2W9BA 1S77D 2KFZA 2PXIA 3G6VA 1KRPA 4F3OA 2XGQA 5HRKA 2ZJ5A 4FHVA 4WC4A 3Q8PB 3MR6A 5L1JA 8ICLA 5DGBA 1X9WA 1MQ3A 4C8MA 3E2EA 4WCWA 2DR7A 4M9LA 2W9CA 3UXNA 3HT3A 4KTQA 5J2FA 1VFGA 3MGHA 3GIKA 1KEJA 1UEVA 5J2JA 2ZUDA 2BQUA 4YMMA 1TK0A 4UQGA 5HRGA 2AJQA 2W8KA 4EBJA 4YXMA 4C8LA 1TVAA 2BPGA 1FA0A 1T4GA 5BOMA 4DS4A 4I2CA 4KLDA 4EYIB 3OSPA 4O3SA 8ICPA 2JZBB 4M5DA 3HX0A 4YVZA 4BDPA 4X4OA 1XS9D 2PI5A 1ZQJA 4XQ8A 1L3VA 4TUQA 5IILA 4M9HA 1L3SA 8ICNA 1F5AA 5DLGA 9ICMA 4GLXA 1KDHA 4X4QA 4M6WA 4KMUA 5DDYA 2IHMA 5CHGA 4ECZA 5KFOA 4DFKA 9ICHA 4LZDA 2LYHA 1MIWA 4NLGA 5IIIA 5C5JA 1NO5A 4QWDA 3M9NB 4E0DA 5J0TA 5KFPA 2AU0A 4DSKA 4RNOA 4DSIA 3LWMA 1U47A 5HRDA 4F4ZA 8ICUA 3GV8B 4EP7A 4RQ3A 4F5NA 2C22A 1T8EA 5HREA 4GXJA 1ZQFA 5IIMA 5EWFA 3TARA 4K4HA 9ICGA 3T5HA 3M9MB 5CR0A 2ASLA 2HHXA 3SZ2A 1BNOA 4YP3A 2W9MA 5J2IA 4YR2A 5KFKA 2V4QA 1S97A 3MDCA 3PW5A 5F9NA 4QZIA 3RRHA 4ECXA 5HRFA 1NK8A 4X4SA 9ICJA 2I1QA 2AGOA 3HJ1A 5J2DA 4EEYA 1NK6A 4QWAA 3M9OB 4K4IA 1ZQYA 3C2KA 2DFLA 1BPEA 4QZFA 4JUZA 4Z6DA 4DO9A 4O3OA 4GXKA 5HC9A 3H4DA 4X0BA 2IA6A 2FLPA 3OUYB 1TAQA 4IRCA 2KFNA 3G6YA 4PPXA 2BCUA 3BQTA 3UQ2A 2PFNA 1TFWA 5EWGA 3PW2A 5KG3A 2PFQA 3MDAA 2J6UA 5DKWA 3RAXA 2NRWA 4F4KA 4JV2A 8ICEA 3JPSA 3TFRA 1U45A 4RWNA 2F1JA 2VA8A 8ICJA 2F1HA 2XGPA 5HMMA 1S0OA 2BPCA 4J9OA 4DF4A 3RBEA 2BR0A 3PNCA 2W9CB 1U49A 3OV7A 5KG7A 4I2IA 5J0OA 4PGXA 3C66A 4QZEA 3PX6A 3ZDBA 4DSJA 2ZH7A 2DRAA 2ZTCA 3K4GA 4QZCA 4NXZA 3KHLA 3MGIA 4KLFA 9ICOA 5KFNA 5HRIA 4X0AA 1BPZA 2P6RA 4I2BA 4ED7A 4NM1A 3C23A 3OHAA 3EWAA 3BDPA 4I28A 4X4NA 4PHPA 4M47A 2IMWP 1RYSA 2ASDA 9ICAA 8ICHA 4DL5A 4K4GA 4X4VA 1ZQLA 8ICWA 4Z6FA 1ZQMA 3ISBA 5KFCA 3THVA 3LDAA 5TZVA 4RQ1A 7ICRA 4EBEA 1ZQZA 4RT3A 1Z3EB 3C21A 5KT2A 3QZ7A 3JPTA 8ICYA 4YXJA 1BVSA 5J2AA 3UPSA 4O5CA 2IBKA 1YLQA 3JPNA 4RQ7A 4XRHA 5DG7A 5HRLA 8ICTA 4O5KA 1ZQQA 5KTQA 9ICKA 1S76D 3TAPA 1Y88A 5KG5A 4F4YA 4MF2A 1KNYA 8ICOA 2P66A 4DLEA 3AQMA 1ZQDA 5KG1A 5DLFA 4O5EA 4ATBB 1RXVA 4XUSA 2JEJA 4UB4A 1U48A 2J6TA 1BNPA 1N56A 1ZQVA 4ECVA 2HHPA 4B9UA 3LWLA 8ICBA 3PY8A 4DOAA 4KITB 3UPQA 4DQPA 4DFPA 2JEIA 4I2FA 4Q43A 4ECUA 4QWCA 3LK9A 2R8GA 8ICMA 1KFTA 4NLKA 4QW8A 3AQNA 2ZH2A 4M9GA 7ICPA 9ICVA 4Q44A 1LB2B 1WCNA 4UAYA 1S9FA 1ZQSA 2BCQA 5KFMA 4IQWA 1X2IA 4FS2A 1ZQEA 5F9LA 2HVHA 4O3NA 4EYHB 4FBTA 4DQSA 4S3NA 4TUSA 2R8HA 4QZ9A 3HWTA 4DL4A 9ICEA 5HNKA 3V6HA 2ZTDA 4AT8B 4RT2A 4UBBA 2FLLA 2DPJA 2PFPA 1DGSA 1MQ2A 5DQGA 4O9MA 5J29A 4Q8FA 3H37A 4FS1A 4AT8A 2A1JA 5KFDA 4F4XA 2KZZA 2F1IA 5KFSA 3ISCA 1KLNA 1XO1A 4F8RA 4BGDA 5DQIA 1ZQBA 2DR5A 3RJFA 4X4PA 5KFZA 1JAJA 5J0RA 5KFJA 4LT6A 3QE9Y 3NGDA 4PH5A 2FPLA 4YMOA 5L1LA 3ZDDA 2PBEA 3RJIA 1JX4A 1ZJMA 2C28A 4RPXA 1ZQKA 2UVVA 4Z6CA 4F93B 5HHHA 2XC9A 5L1IA 1ZJNA 7ICQA 1JMSA 4X4UA 8ICSA 1B22A 2KN7A 4Q8EA 4G3IA 1SL0A 1S0MA 2BCSA 1JXEA 4I2GA 1ZYQA 2BGWA 4QZBA 3M8SA 1SL2A 5KFIA 1BPXA 8ICIA 2ZJ8A 4DSEA 4WC5A 5KFXA 4DOBA 4KLIA 4J9NA 1ZQCA 5HMLA 4GC7A 3Q8MA 2VA2A 1D9DA 2HHSA 5DEDA 1T7PA 4DL6A 4KLGA 4I2HA 2M9NA 1AROP 1XWLA 1ZQXA 7ICGA 4TURA 4FBUA 1NKBA 4ED1A 4KLEA 4J9KA 1NK0A 2NRXA 3QEAZ 3Q8KA 2HHWA 3GFKB 3OHBA 4YD1A 4KLHA 3Q8QB 9ICLA 1R8BA 5KT3A 9ICWA 3EZ5A 2BHNA 1TKDA 4F5OA 3T3FA 5HP4A 3IHQB 3GIIA 1NK9A 5J0YA 4KLTA 5KFVA 2ID1A 4B9VA 1V4AA 1IXRA 4BWJA 3T5JA 1S10A 3H8WA 3MFHA 4FO6A 1KFSA 4ATBA 2ATLA 4EBDA 2FPKA 1SKRA 3OSNA 3N97B 3RJGA 1U9LA 3V7LA 4ED2A 2KZMA 4F5QA 3LQCB 3B0XA 1ZQTA 2C2RA 2RDJA 1NJZA 4YN4A 4EZ6A 3KHGA 3RB3A 1NK5A 4M0AA 4DQQA 4UB2A 4RUAA 4DEZA 2XY6A 9ICCA 4KLQA 4ZH4A 4O3RA 4Q45A 1CUKA 9ICUA 2M2WA 4IQTA 4FHWA 5HRBA 4QWBA 3RTVA 2FMSA 2HW3A 4YCXA 5KFQA 1RZTA 7ICNA 4DL7A 1XSNA 4EBKA 4QWEA 4TUPA 4B9NA 8ICCA 2HHTA 4WC0A 4KLMA 4DQRA 4RQ5A 5L9XA 3RR8A 3RH4A 8ICQA 2PI4A 1NZPA 3FDSA 3Q8SB 1ZQAA 5CP2A 1UETA 4WC2A 5CJ7A 2FMQA 3C18A 4ED3A 5J0UA 3RBDA 2UVWA 3C1ZA 4WC6A 2B21A 2M2VA 1DK2A 1SZPA 2RFFA 3NYBA 3ZDEA 4KLUA 3C5FA 4IQVA 1TK5A 3WFQE 2RDIA 3RH6A 4B9MA 4DSLA 4NKUA 4ECYA 4WC3A 3H4BA 2AGPA 4IR1A 4EBCA 4NY8A 1K1SA 4PGQA 3V6KA 3PW7A 2OWOA 4E8FA 4UD5A 1NK7A 1WCLA 1EXNA 5KG6A 2ZH1A 5J0XA 1LV5A 4J9SA 2UVRA 5JUMA 3H8SA 3PVXA 1BPBA 1ZQUA 1R8AA 4R65A 1XSPA 4B9TA 3GV7B 5J2BA 3BQ1A 3JPOA 2FLNA 4B9SA 1A76A 4RPYA 4ECTA 1MSWD 8ICAA 2BPFA 4JV0A 1B43A 4EZ9A 8ICVA 5KT5A 3ZD8A 4UB5A 4F91B 3C5GA 1PZNA 4ECWA 3AQKA 3SV3A 4F5PA 4UB1A 1BPDA 4XQ7A 3AQLA 5CA7A 5KFEA 1C7YA 3IM1A 2R8IA 5HR9A 9ICXA 3MBYA 5KFHA 4QZ8A 7ICSA 4B9LA 3L9DA 7ICLA 1KFDA 3PX0A 3PO5A 1ZQGA 1HJPA 2NRTA 3T5KA 2KP7A 3H7IA 5KFLA 5KFRA 4WC1A 4RNNA 1Q78A 4NM2A 4GC6A 4M2YA 4J9LA 2DVIA 1QSSA 1TFRA 4JK1A 4PHDA 3MR5A 1D9FA 4LZGA 1JN3A 2W8LA 3KTQA 1Q79A 5DB7A 1XU4A 1OU5A 3OVSA 4YMNA 4YD2A 3MFIA 3TAQA 4DWIA 1TAUA 4IRDA 5KFYA 4DQIA 4E80A 4FH3A 1S0VA 1VJ7A 4GXIA 9ICRA 9ICSA 2KTQA 2W9AA 4YR3A 1X9SA 4HYKA 1QSYA 4XA5A 3RJKA 4ED6A 5KFTA 3BQ2A 3BQ0A 4C8KA 3V72A 1MIVA 1MC8A 3JPPA 4FH5A 3PR4A 3TANA 2MUTA 4WBYA 1K1QA 2JZBA 4C8NA 4M04A 5KG0A 5DBCA 5IIOA 4MEXA 3RH5A 2O1PA 5L1KA 2ISOA 2Q0ZX 1HUZA 2PFOA 7ICIA 4ELVA 1Z00B 2ZUBA 3ETLA 4MEYA 4YR0A 1D8YA 2GWSA 4RQ2A 1NJXA 1QSLA 2C2EA 5KFFA 4RQ6A 4DOCA 9ICPA 1IM4A 3WFSC 5KFBA 4PHEA 5IIKA 1BGXT 4QZGA 5BPCA 4ED0A 3UQ0A 4UAZA 1D8LA 1L5UA 2BKEA 2ZTEA 5J0SA 3EYZA 3UXOA 2VA3A 4WC7A 3OVAA 2Y1IA 3EPIA 8ICFA 4IRKA 2DPIA 4M9JA 5KFAA 2M2UA 3V7KA 4KLSA 7ICFA 4NKTA 5BOLA 5DGAA 2ZHBA 2O5AA 1UEUA 2V4RA 4O3PA 4YQWA 1KTQA 4DL3A 3JYYA 2W9BB 3WFRE 2ISPA 4BWMA 4PGYA 3PV8A 4DFMA 3GIMA 2C2DA 1RYRA 3H39A 5DECA 4X4RA 1DOQA 2ZHAA 5CB1A 2Y1JA 4Z6EA 3AU2A 2BCRA 2MUTB 4RQ0A 4JV1A 4KN7A 4DF8A 3MABA 5DBAA 3OJUA 2Q66A 3RB6A 4NLNA 3RJHA 2P6UA 2AGQA 1ZQHA 4IQUA 3MR2A 4DL2A 1NK4A 2BDPA 2UVUA 1Z00A 4R8UA 5DBBA 1NOMA 3OJSA 4F4WA 2JEFA 3BJYA 3G6XA 5J2CA 4C8OA 5J2GA 5J0QA 4KLOA 4FHPA 9ICBA 3H38A 5DB8A 1KSPA 5D46A 8ICKA 2ZH8A 5J2EA 4ED8A 4M9NA 1NJWA 8ICZA 4ELTA 5HRHA 5KFGA 3PR5B
chains in the Genus database with same CATH superfamily
1TE2A 5GTHU 5AM0A 4ECSA 4O0IA 5ALOA 4IG8A 4UB6U 5AM1A 1Z4OA 2XY7A 2OEHA 1FFUA 3RJEA 1R8CA 1V9PA 4J9PA 2V9WA 2IOFA 2DRBA 2WB1C 4RPZA 1NJYA 4NXWA 1ZETA 1ZQWA 2W11A 3ZDAA 2W55A 5IINA 5AKZA 2NV3A 5J2KA 2WFAA 2WB1F 4UAUA 5CWRA 1DK3A 4HAIA 4R63A 2GAFD 4CDGA 4G9BA 1PX5A 5ALIA 1JXLA 4TQRA 4X4NA 1X42A 2NRZA 8ICRA 3EW9A 4RWOA 2E8OA 5KL1B 4RWPA 3HILA 4KLLA 1TV9A 3AQEA 5AI6A 3OTQA 2LHTA 1L8OA 1X66A 2HHQA 4MF8A 4I2JA 1L7PA 3GV5B 5J0WA 3HP6A 4QZAA 3NVWA 2KJ5A 3NUQA 4FHYA 5AKHA 1L3UA 7ICTA 4P2HA 3L4PA 1N48A 1XSLA 3RAQA 1A77A 4EGWA 3F2BA 5ALVA 4F5RA 4J9MA 1F44A 4WJ3B 1HIWA 1SV0C 4PJ0U 3V7JA 4F2SA 5EE0A 2OHFA 1SGGA 1WOTA 4X5VA 2HHUA 3H0LB 4J9QA 4Y2RA 1UA0A 3PO4A 3PX4A 4I2EA 2F2AB 2XY5A 1ZQOA 3LYSA 1AQ6A 3GQCA 3AUOA 1SKWA 4P4OA 4OAFA 3TADC 3H40A 2JEGA 1PVRA 3SI8A 2IHNA 4UW9A 2FJ6A 3G6VA 1KRPA 1COKA 5HRKA 2Y9UA 3ETRA 5L1JA 1VFGA 4FZMA 2YY6A 4C4SA 4YMMA 2LYBA 1D8BA 2ODGA 1T4GA 4EYIB 3OSPA 3GU3A 3HX0A 1XS9D 1ZQJA 4TUQA 4PZNA 5IILA 1F5AA 4X4QA 4GLXA 4M6WA 3QX7A 5DDYA 5KFOA 1VJ5A 1NO5A 3M9NB 4DSKA 5AHXA 2EWRA 2IOHA 5CFTA 3TARA 1RDFA 5GTIU 3M9MB 2HHXA 5J2IA 3NVZA 2I1QA 4EEYA 4K4IA 1ZQYA 2FLPA 3OUYB 3UQ2A 1TFWA 5ALPA 3MDAA 5AKEA 5DKWA 4F4KA 8ICEA 3TFRA 2XIDA 2CPRA 2F1JA 2XGPA 2RLTA 5ALDA 3VC8A 4CE6A 4J9OA 2BR0A 2K8AA 5KG7A 4BJQA 1JUDA 4QZEA 5C0YA 3K4GA 9ICOA 4KLFA 3MGIA 5ALKA 1BPZA 5A0LA 4NM1A 3C23A 3OHAA 3BDPA 4M47A 1RYSA 4DL5A 4NWIA 4CNQA 1RQNA 2HOFA 4Y2VA 3ISBA 3LDAA 4EBEA 4RT3A 3SEIA 3JPTA 1BVSA 4C7YA 5J2AA 4OAHA 2EAMA 2IBKA 1P7DA 4RQ7A 1SZHA 2RRDA 4O5KA 1OUQA 5KG5A 4MF2A 1IG6A 5AKXA 4UB4A 3LWLA 4C80A 3PY8A 4DQPA 2JEIA 4QWCA 2A1AA 4NLKA 9ICVA 3CW2C 1LB2B 4UAYA 2D6FC 5KFMA 3BQ7A 4FS2A 4FBTA 2R8HA 4DL4A 9ICEA 5HNKA 2ZTDA 2VIXA 3WKAA 4U6PA 4UBBA 1DGSA 4O9MA 3WKDA 3AQFA 3IDWA 4Y2JA 2KZZA 1UQVA 2KE7A 3QNMA 2KIVA 5D62A 3IP4B 1ZQBA 2DR5A 3RJFA 4X4PA 1MA7A 4PH5A 4P0PB 4Z6CA 4F93B 5HHHA 5L1IA 2RQ5A 4X4UA 2G09A 2OM6A 4G3IA 4JMUA 2GO7A 1SL2A 2MSNA 8ICIA 4DSEA 4WOYA 2M2UA 1ZQCA 1FO4A 1B0XA 4DL6A 4KLGA 2M9NA 1ZQXA 4TURA 2B56A 2EAPA 3GFKB 3OHBA 5AICA 1NZBA 1Z4NA 2BBHA 4F5OA 2MA1A 5JTIA 2KMDA 5JU5A 5KFVA 4KLTA 4BWJA 4ATBA 1N2XA 3H8WA 4FO6A 2AHOB 2R18A 3RJGA 4JLXA 2L5YA 3NWIA 3F5EA 2RDJA 4EZ6A 4OO1J 3KHGA 3RB3A 4M0AA 2JXJA 9ICCA 4WC5A 2XY6A 4DEZA 4Q45A 9ICUA 4FHWA 3RTVA 4EENA 5KFQA 4EBKA 1XSNA 4QWEA 4TUPA 4B9NA 4KLMA 2F8KA 5AK6A 5AI9A 3RH4A 3NRWA 3FDSA 1UETA 5CP2A 5CJ7A 5J0UA 2ZG6A 1FEZA 2RFFA 3FM9A 4OJOA 4DSLA 3ER8C 4OJ5A 4ECYA 1PVPA 3H4BA 2D3DA 2ZIXA 3E58A 1K1SA 3GZFA 4ZOHC 2VJ4A 4B6JA 5KAFU 4I0UA 5J0XA 2BZFA 5F3XB 4B9TA 4B9SA 2KG5A 4JV0A 4UB1A 5CA7A 1C7YA 5HR9A 2XVTA 4OJPA 4P0PA 3PO5A 5KFRA 4OD0A 2EQYA 1QSSA 3VCBA 2QARB 2W8LA 5AI4A 1XU4A 5ALQA 4YMNA 3MFIA 2HOIA 2FDRA 1X9SA 4HYKA 4ED6A 3BQ0A 4C8KA 1MC8A 1ZRNA 4M04A 5ALXA 3M6KA 3O0FA 3RH5A 1PVQA 3FAHA 1HUZA 1Z00B 4MEYA 1D8YA 3ZI4A 1NJXA 1QSLA 2E8MA 4DOCA 4Y2SA 2YMPA 5ALLA 5BPCA 5HR6A 4QZGA 3UQ0A 4UAZA 3EYZA 2Y1IA 8ICFA 4M9JA 3V7KA 1X6IA 4KLSA 2F76X 4O3PA 5DECA 4DFMA 3GIMA 3H39A 3KD3A 3AU2A 2BCRA 4JV1A 2Q66A 3OJUA 3RB6A 4CF4A 1NK4A 2BDPA 1Z19A 2EZXA 3KZIU 5J2CA 2OXOA 4FHPA 3H38A 2QB0A 2WF6A 8ICZA 2YMLA 2QB0B 5KFGA 4DCCA 4J9RA 4P4PA 1GO3F 7ICHA 4OJ6A 3HKZC 4UAWA 3GDXA 3OVBA 4RNMA 9ICFA 3RB4A 5KFWA 3SYZA 9ICTA 1Q3VA 2J6SA 1ZQPA 4EEDA 2KZ3A 2YTUA 4LJXA 4CF5A 2BE3A 2XCPA 3OGUA 4XJEA 2GH1A 4I29A 4AT9B 3TQ1A 1ZD5A 4ECRA 2KEYA 3RRGA 4UD4A 4R64A 1XO0A 4QZDA 3TI0A 2BQRA 2KVCA 2G07A 7ICKA 2ZIVA 7ICOA 1R89A 2DQNB 4JLZA 1ZQ1C 2ZH9A 3L5KA 1MIYA 4J03A 2BQ3A 1ZQIA 2LI6A 2Q4TA 3N7RC 1QQ7A 3PMNA 2M2TA 7ICVA 3H3AA 3WKCA 2ZUCA 5IIJA 2GLEA 4R8UB 2NRVA 2FMPA 2HDOA 5ALFA 5D49A 2KHQA 4TQSA 2AQ4A 5AK3A 1T94A 1XC9A 2ALZA 5DB9A 4F50A 2ZH4A 2W7PA 4DS5A 2E3TA 2DR9A 1UHUA 5KFUA 1BPYA 1TK8A 3AU6A 2VKQA 3MR3A 4NV0A 4RUCA 4FHXA 3ONNA 5ALRA 1PK1B 3H8MA 2BCVA 5DB6A 2NYVA 2H5XA 7ICMA 3NTUA 3BS5B 4F2RA 5ALUA 1H38A 2BDUA 2KJ9A 4MKPA 1WUDA 1S0NA 4DLGA 3FYHA 2Y9TA 2W9BA 1S77D 4FHVA 2XGQA 2ZJ5A 3KFUF 2YQEA 3MR6A 1X9WA 4C8MA 4M9LA 4KTQA 3UXNA 3HT3A 2I6XA 5J2FA 5J2JA 2ZUDA 2W3RA 5HRGA 4EBJA 4C8LA 1TVAA 1FA0A 4I2CA 3TADA 4KLDA 2F77X 4O3SA 4IS7A 4DFDA 4X4OA 2PI5A 4UB8U 8ICNA 2IOFK 2LPEA 4K9AA 2G06A 9ICHA 4Y2YA 1MIWA 4NLGA 5IIIA 1S8OA 4DSIA 1QQ6A 1GPJA 3LWMA 5HRDA 3GV8B 4EP7A 1T8EA 5CR0A 1HEKA 4LEZA 3D2SA 1S97A 3PW5A 5F9NA 4ECXA 9ICJA 1X6JA 4QWAA 1UCVA 4KMOB 4JUZA 1VDVA 4Z6DA 4DO9A 3H4DA 4X0BA 3BQTA 5EWGA 5KG3A 2A3VA 2J6UA 5J8YA 3NKUA 3JPSA 1QCKA 5HMMA 4DF4A 1U49A 4NLCA 3PNCA 5AK5A 5J0OA 3KZXA 3KHLA 4QZCA 4NXZA 4ED7A 2EZZA 2F44A 1ZQLA 8ICWA 1QQ5A 2HI0A 1ZQMA 2ZIUA 3THVA 5TZVA 3QZ7A 1ECWA 8ICYA 4C4RA 4YXJA 1S5LU 3UPSA 1SV0A 4US8A 3JPNA 4AYBF 4FZLA 3M6ZA 5FP0A 1S76D 3TAPA 1IV8A 2ZIWA 5ALJA 1K5OA 1KNYA 8ICOA 2H3FA 5CFUA 2KKPA 1ZQDA 5KG1A 1RXVA 1U48A 3CRXA 1BNPA 2DBYA 3ER9B 4Q43A 4ECUA 2OH2A 2R8GA 8ICMA 1KFTA 1C20A 2HN1A 2WF8A 7ICPA 4Q44A 4ICAA 4WQLA 2EH9A 1ZQSA 1X2IA 4EYHB 1YT3A 4DQSA 3PSIA 3V6HA 2EANA 4RT2A 2FLLA 2PFPA 5ALSA 5DQGA 1ZD3A 5J29A 3H37A 3OPXA 4AT8A 2F1IA 1KLNA 2WF7A 1XO1A 1WYGA 4BGDA 4K9BA 5KFJA 2LYAA 5L1LA 5B3QA 3ZDDA 1SWVA 4RPXA 1ZJNA 4IL6U 4Y2TA 7ICQA 5B3PA 8ICSA 4Q8EA 2OCEA 1S0MA 1JXEA 3N7PD 4I2GA 2BGWA 4QZBA 4KLIA 4J9NA 4GC7A 3QU5A 3Q8MA 1T7PA 3UMCA 3NVVA 1XWLA 1SB3C 1NKBA 4J9KA 3IN5A 2NRXA 3Q8KA 2B51A 3F5AA 3Q8QB 1R8BA 3EZ5A 3QUQA 1LVHA 3C28A 4PL2A 4B9VA 3T5JA 1S10A 3N7SC 3MFHA 3UMBA 3V7LA 1SXDA 2CXYA 3LQCB 1ZQTA 2C2RA 4YN4A 1L7OA 3I28A 3CYMA 4RUAA 2B6GA 2FMSA 5ALWA 1RZTA 1SV4A 2HHTA 5ALYA 2A19A 3Q8SB 3RBDA 2B21A 2D8CA 1DK2A 1SZPA 2MRLA 4FFDA 5AKIA 3ZDEA 3S6JA 1DGJA 1TK5A 3WFQE 2RDIA 3RH6A 4NKUA 1JALA 4UASA 2JH7A 4WC3A 2IHOA 2CN1A 2E5SA 4E8FA 1NK7A 2ZH1A 2UVRA 4NJ8A 1ZQUA 1R8AA 8ICAA 3JPOA 1A76A 8ICVA 4UB5A 3ZD8A 3SV3A 1BPDA 3AQLA 1N61A 2R8IA 9ICXA 3MBYA 7ICSA 2CRXA 5CEHA 3L9DA 1WWVA 4Y2QA 5AM5A 2JRZA 3T5KA 3WKEA 3D6JA 3H7IA 5KFLA 4WC1A 4NXXA 1ZD2P 4RNNA 1Q78A 4M2YA 2DVIA 4PZOA 1OU5A 2HBMA 2E8NA 3TAQA 3NVYA 1TAUA 4IRDA 5KFYA 4DQIA 2HOQA 3C29A 2W9AA 4XA5A 3IV6A 5KFTA 3BQ2A 5D61A 3V72A 3TANA 4WBYA 4F71A 2JZBA 4C8NA 2EAOA 5KG0A 3QUTA 1OXJA 2Q0ZX 2MU2A 2GWSA 2K60A 4RQ2A 3IG8A 4PHEA 3QYPA 3UXOA 2AXTU 2DPIA 3SAGA 5BOLA 5KAIU 5DGAA 1UEUA 4C7ZA 5ALHA 1KTQA 2W9BB 1LKYB 4BWMA 4PGYA 3PV8A 2ZHAA 2Y1JA 5CB1A 3LVVA 1DRGA 3H0RB 2AGQA 4IQUA 3MR2A 1Z00A 5DBBA 5ALEA 5ALZA 1Z1VA 3EF2A 3G6XA 2P35A 4C8OA 4QIWF 4K99A 4US9A 9ICBA 2W04A 2XICA 2ZH8A 5J2EA 3BS5A 4O67A 4ELTA 3PR5B 1RYUA 4Y2PA 5DG9A 4AT7B 4KN4A 3SQIA 1KQQA 1XNSA 4YG2A 4YFKA 5F2VO 4BXOA 2KNJA 5HHIA 5G5GA 1T3NA 2I9GA 3GIJA 4RQ8A 3WK5A 4NLZA 2ZH5A 3C2MA 2ZJAA 3M8RA 2AH5A 4ECQA 3V6JA 3I76A 4ACOA 3JPRA 5DQHA 2KVSA 3HJ4A 5KT4A 4O6AA 4ELUA 2HBJA 2JV3A 5KT6A 5KT7A 4DFJA 3AL0B 4I2AA 4MFFA 1NI3A 3PW0A 1YZ6A 1N5XA 1L7MA 2FPMA 1CRXA 2DR8A 5L1MA 1M6YA 3UXPA 2HHVA 4R66A 2ZH6A 4F92B 4AT9A 3JPQA 1X9MA 1ZQRA 1U4BA 3KOOA 3EPGA 2HN2A 1TFYA 2WTFA 2MAXA 3ORYA 8ICGA 3WFSC 1SKSA 3QEBZ 9ICNA 3H8JA 4RQ4A 2AQ0A 1X40A 2FI1A 3B0YA 2HVIA 3K7DA 4M6WB 3SV4A 4AT7A 2A1JB 1V38A 3KBBA 7ICUA 2ZH3A 4I2DA 3OVSA 3RR7A 5D4BA 4EEBA 4UB3A 2HBKA 1L3TA 3ISDA 3PHZA 2DKZA 3PMLA 1Q46A 1ZQNA 4CCHA 4RZRA 5AIAA 4NL9A 1KKXA 2KOBA 5DG8A 3ZDCA 3JCFA 3ED5A 9ICIA 4I27A 4O3QA 3PW4A 4PHAA 4RU9A 5KG2A 2K4PA 1L6NA 2FCLA 2PXIA 3Q8PB 8ICLA 5DGBA 3E2EA 2W9CA 1J2MA 3WK6A 3MGHA 1KEJA 2ZIVB 1UEVA 4UQGA 2AJQA 2W8KA 4YXMA 2BPGA 1N5WA 4DS4A 8ICPA 4CGZA 4M5DA 2GA9D 4EX7A 4XQ8A 1L3VA 2WAQC 4M9HA 1L3SA 5DLGA 9ICMA 1KDHA 1SWWA 5CHGA 2EDUA 5HR7A 4LZDA 3AM9A 1X9XA 2LYHA 4WQKA 2Z7JA 5C5JA 2O6KA 4K96A 5J0TA 5KFPA 2AU0A 3DEEA 1U47A 4F4ZA 4RQ3A 4F5NA 4GXJA 1ZQFA 5T14A 4K4HA 9ICGA 3T5HA 4CRXA 3SZ2A 2W9MA 4YR2A 5KFKA 3MDCA 4QZIA 3RRHA 5HRFA 2KD1A 1NK8A 2KKVA 3HJ1A 2PMZC 3M9OB 2K8CB 5TISU 2DFLA 1BPEA 4QIWC 2K4EA 1PK1A 5HC9A 5AKJA 4GXKA 5AI8A 1TAQA 2KFNA 2WHEA 3WK9A 2ESEA 3PZPA 2ZXIA 3PW2A 1PUZA 3MC1A 4JV2A 2VA8A 5H2FU 8ICJA 4LEYA 1S0OA 2BPCA 3OV7A 4I2IA 2DRAA 4PGXA 3PX6A 4DSJA 2ZTCA 4KM5A 5HRIA 3QU9A 4X0AA 2P6RA 4PHPA 2IMWP 8ICHA 3SD7A 5AM2A 4K4GA 5KNIA 2QKQA 5KFCA 4RQ1A 1CI4A 1ZQZA 5B5EU 4O5CA 3A0BU 4XRHA 5DG7A 3NASA 5AK4A 4AYBC 1ZQQA 9ICKA 1T3QA 1Y88A 4GFJA 1JI7A 2P66A 5DLFA 2JEJA 4BX9C 1ZQVA 4ECVA 4B9UA 8ICBA 3A0HU 4DOAA 3F53A 4DFPA 2KSOA 4I2FA 2ZH2A 3LK9A 3AQNA 4QW8A 4M9GA 1ZQEA 5F9LA 4EX6A 1A0PA 2Y0SF 2ZIUB 4N7RA 3KKAA 2DPJA 3OWGA 1MQ2A 3NRZA 4Q8FA 4FS1A 2A1JA 4NLBA 3CK6A 4F4XA 3ISCA 3F2CA 4F8RA 3QUBA 4CF3A 5J0RA 2JGAA 2FPLA 3RJIA 5AKYA 5ALTA 1ZQKA 2UVVA 2XC9A 5JTGA 1JMSA 5JRTA 2M2WA 1YZ7A 1ZYQA 5KFIA 3PSFA 2B4VA 5KFXA 2VA2A 5DEDA 4I2HA 1URJA 3E0FA 1RG6A 4KLEA 2HBLA 4YD1A 4KX3A 3WK7A 5KT3A 2RHFA 4EELA 4UAVA 5HP4A 3SAHA 3IHQB 4EEKA 1NNLA 2ID1A 1KFSA 2G08A 3QU7A 2ATLA 3WKBA 3OSNA 3N97B 2W43A 1U9LA 2DL0A 3SENA 2KZMA 1SXEA 2KJ8A 2WF9A 4F5QA 2QARA 3B0XA 3QXGA 3AMZA 2JR5A 2K4IA 3HIYA 4U7CA 4KLQA 4ZH4A 4O3RA 5AIBA 1CUKA 2PKEA 1ZOLA 5HRBA 4QWBA 4YCXA 7ICNA 8ICCA 3ERCC 1O03A 3RR8A 1NZPA 2YMQA 8ICQA 4WC2A 4ED3A 4WC6A 3QU2A 2WF5A 2M2VA 3NYBA 5CRXA 3C5FA 4IQVA 4B9MA 2AGPA 4IR1A 4EBCA 3ICXA 3V6KA 3PW7A 4UD5A 4P0QB 1FIQA 4J9SA 3H8SA 1V97A 1XSPA 3HJEA 5J2BA 2FLNA 4OCZA 4ECTA 4EZ9A 4ECWA 3TKAA 2JHDA 3C5GA 1PZNA 1VLBA 2RP5A 4XQ7A 3CNHA 1QH9A 4QZ8A 4B9LA 7ICLA 1KFDA 3PX0A 4QJFB 2K4HA 2LKYA 5AI0A 3BS7A 4NM2A 4JK1A 5K4LA 4LZGA 5ALGA 1JN3A 5G5HA 3J81j 3T79A 4DWIA 4FH3A 9ICRA 9ICSA 1MN8A 1N60A 4YR3A 1QSYA 3RJKA 1F0MA 3JPPA 3QUCA 4IC9A 1K1QA 5DBCA 5IIOA 4MEXA 5L1KA 4FO1A 2PFOA 3AEVA 4ELVA 4RQNA 1ZD4A 1JROA 2B0CA 5KFFA 9ICPA 4QNLA 4RQMA 1L5UA 2BKEA 5J0SA 3OVAA 2NO4A 3LVWA 2ZXHA 7ICFA 4NKTA 2ZHBA 2O5AA 1Q8KA 3WFRE 2ISPA 1FFVA 2C2DA 4UARA 4Z6EA 1B4FA 2MUTB 4RQ0A 4KN7A 4DF8A 4NLNA 3ALRA 2UVUA 1NOMA 3OJSA 2I5HA 3BJYA 2YB1A 2E1FA 5J0QA 3HRDD 5DB8A 5D46A 2G5HB 1NJWA 2IUBA 4KLJA 8ICXA 2FE9A 4P0QA 2DUYA 4QW9A 3PSPA 1QTMA 3HPOA 3JZ0A 1IIPA 1NKEA 5J0PA 2XO7A 4E7XA 4UBCA 3DV9A 4DSFA 3QZ8A 4LEWA 1SL1A 4WBZA 3C1YA 3HW8A 1JIHA 3RJJA 3IRUA 3Q8LA 3N4MB 3SAFA 3ZD9A 1TAMA 1COOA 4MFAA 3UMGA 4IR9A 1RPLA 3C2LA 2W3SA 2VANA 5EWEA 2KICA 3RB0A 3D2QA 3TFSA 4BXOB 4MFCA 1UT5A 4JWMA 7ICEA 2DKXA 4FZNA 1WG8A 4LVSA 3FC4A 1QLNA 1RQLA 3N28A 2R8KA 2OYYA 5KG4A 1RXWA 3WFPA 1LKYA 3KKAC 1ZXIA 3K75D 3EUB2 3KHRA 5B66U 2ASJA 7ICJA 2DGZA 4P4MA 2XCAA 2E1EA 1NKCA 3WFOA 2R8JA 5AKKA 3KHHA 5EOZA 1JQRA 3OUYA 2H3IA 2ZIXB 1KN5A 5D63A 1DXSA 2NRKA 1UT8A 3U26A 5E79U 3BZKA 1HUOA 3Q8RB 5J2HA 1CEZA 2VJ5A 3T5LA 4A8EA 5AM4A 1UA1A 1A6SA 1KBUA 9ICQA 3HKZF 4QZHA 5DDMA 3GILA 2YMMA 4JWNA 4RWQA 2KFZA 5CHEA 4F3OA 4WC4A 2DR7A 4WCWA 1MQ3A 4UATA 3GIKA 2BQUA 1TK0A 4O69A 2KV2A 2YX8A 1JRPA 5BOMA 3MGVA 3UM9A 2GOLA 2JZBB 4NL9C 4YVZA 1O08A 4BDPA 2ES6A 3CP8A 3F2DA 3H0MB 5AKGA 4Y2XA 4KMUA 2QLTA 2IHMA 3M7DA 4ECZA 2LBOA 3PSTA 4DFKA 3WK4A 2LMRA 2DF4B 4QWDA 4E0DA 4RNOA 1WWUA 3RFAA 8ICUA 5HREA 2C22A 5IIMA 5EWFA 1Q3UA 2JH1A 1N62A 4C0ZA 2ASLA 1BNOA 4YP3A 2V4QA 5ALMA 4X4SA 2AGOA 5J2DA 1NK6A 3C2KA 4QZFA 4K8VA 3K1RB 4O3OA 3TACB 2N1RA 2IA6A 4IRCA 3G6YA 4PPXA 2BCUA 2PFNA 2PFQA 1V85A 3RAXA 2NRWA 3I1YA 1U45A 4RWNA 2F1HA 4NXTA 4O68A 5EE9A 3RBEA 2W9CB 4OAGA 2ZH7A 3C66A 3M1YA 3QU4A 3ZDBA 4NXUA 1L8LA 4X4TA 5KFNA 4I2BA 3EWAA 4I28A 9ICAA 2ASDA 4BUGA 4Y2UA 5J8YC 4X4VA 4Z6FA 7ICRA 1Z3EB 3C21A 5KT2A 1YLQA 5HRLA 8ICTA 5KTQA 4F4YA 2H3QA 4DLEA 4GIBA 3AQMA 4O5EA 2K89A 1SIJA 4ATBB 4XUSA 2J6TA 1N56A 2HHPA 4O3MA 4KITB 3UPQA 4FE3A 2YN4A 3K1ZA 1WCNA 1S9FA 2BCQA 4IQWA 2HVHA 4O3NA 4S3NA 4TUSA 4QZ9A 3HWTA 4AT8B 4K98A 2W7OA 4JB3A 2KIWA 4MHVA 5KFDA 5KFSA 1UPHA 5DQIA 5KFZA 1JAJA 4LT6A 4C4TA 3QE9Y 3NGDA 2PBEA 4YMOA 1JX4A 1ZJMA 2C28A 2E8PA 1B22A 2KN7A 1SL0A 2BCSA 4WH5A 2KSOB 3M8SA 2XI9A 1BPXA 2ZJ8A 4KX5A 4DOBA 2HHSA 5HMLA 1OW5A 1D9DA 1AROP 7ICGA 4OAIZ 2QB1A 4FBUA 4ED1A 1NK0A 3QEAZ 2HHWA 2HSZA 2LM4A 4KLHA 2LM1A 9ICLA 3BZCA 9ICWA 2BHNA 1TKDA 3T3FA 3GIIA 1NK9A 5J0YA 1V4AA 1IXRA 2PMZF 2W54A 4EBDA 2FPKA 1SKRA 1KW4A 4ED2A 2DWQA 5ALNA 1NJZA 1NK5A 4DQQA 4UB2A 4IQTA 2HW3A 4DL7A 4WC0A 4DQRA 2HMXA 2F3NA 1L7NA 5EE3A 4RQ5A 5L9XA 2PI4A 1ZQAA 4LEVA 2FMQA 3C18A 2UVWA 1F5SA 1N63A 1KL9A 3C1ZA 4KLUA 3IG5A 2W03A 5EE1A 4NY8A 4PGQA 2OWOA 1J97A 2M0NA 1WCLA 1EXNA 5KG6A 1LV5A 2JMGA 4USAA 5JUMA 2KHVA 3PVXA 1BPBA 4R65A 3GV7B 3BQ1A 4RPYA 4PL1A 2NO5A 1MSWD 2BPFA 1B43A 5KT5A 3AQKA 4F91B 4F5PA 5KL8B 4OJLA 5KFEA 3NVOA 3IM1A 5KFHA 2KK0A 4NXVA 4EV6A 1ZQGA 1HJPA 2NRTA 2KP7A 2HCFA 2G5IB 2Y0SC 4GC6A 2H3ZA 4J9LA 3D2NA 1TFRA 4HX0A 4PHDA 3MR5A 1D9FA 3KTQA 1Q79A 5DB7A 4YD2A 4E80A 1S0VA 3R9KA 1VJ7A 3WU2U 3AN1A 4GXIA 2KTQA 3RF9A 3MCRA 2BBJA 2H3VA 4KB6A 1MIVA 2ZIWB 4FH5A 3PR4A 2MUTA 2O1PA 2EZYA 2ISOA 7ICIA 5AM3A 2ZUBA 3ETLA 4YR0A 1PK3A 2C2EA 4RQ6A 1IM4A 5KFBA 5AI5A 3DDHA 1BGXT 5IIKA 4ED0A 1J2NA 3NS1A 1D8LA 2VA3A 4WC7A 2ZTEA 1RM6C 1ED1A 4K97A 3EPIA 4IRKA 5KFAA 2YB4A 3SR6A 5AKLA 2V4RA 4YQWA 4DL3A 5CFSA 3JYYA 2F8LA 2G0AA 1RYRA 4X4RA 4AP9A 1DOQA 1ZRMA 2K8BB 4F72A 3B9JA 3MABA 5DBAA 3L3FX 2P6UA 2WAQF 1ZQHA 3RJHA 4DL2A 4R8UA 4F4WA 2JEFA 5J2GA 4KLOA 3WK8A 1KSPA 8ICKA 3SMVA 4ED8A 4M9NA 5HRHA 1Z1BA
chains in the Genus database with same CATH topology
4KLJA 4J9RA 5DG9A 8ICXA 4KN4A 4AT7B 4P4PA 7ICHA 4QW9A 4YG2A 4YFKA 4UAWA 1QTMA 3HPOA 4ECSA 4O0IA 3GDXA 5F2VO 4BXOA 3OVBA 4RNMA 5HHIA 9ICFA 3RB4A 5KFWA 4IG8A 3JZ0A 1T3NA 2I9GA 2XY7A 3SYZA 1NKEA 9ICTA 5J0PA 2XO7A 2J6SA 3GIJA 3RJEA 1R8CA 4E7XA 4UBCA 1V9PA 4RQ8A 1ZQPA 4NLZA 4J9PA 3C2MA 2ZJAA 3QZ8A 2KZ3A 4DSFA 2V9WA 2ZH5A 3M8RA 1SL1A 4WBZA 2DRBA 4ECQA 3V6JA 2BE3A 3C1YA 4RPZA 2XCPA 1NJYA 3OGUA 3HW8A 1JIHA 3JPRA 1ZETA 1ZQWA 3ZDAA 3RJJA 3Q8LA 5IINA 4I29A 4AT9B 5DQHA 3TQ1A 5J2KA 3N4MB 3HJ4A 3ZD9A 5KT4A 4ELUA 5KT6A 1COOA 5CWRA 4MFAA 5KT7A 4ECRA 1DK3A 3RRGA 4UD4A 4IR9A 1RPLA 4R63A 3C2LA 1PX5A 4R64A 2VANA 5EWEA 4DFJA 3RB0A 1JXLA 3TFSA 4QZDA 4TQRA 4BXOB 4I2AA 4MFCA 1UT5A 2NRZA 3TI0A 4JWMA 4MFFA 8ICRA 3EW9A 2BQRA 7ICEA 4RWOA 3PW0A 4LVSA 7ICKA 7ICOA 1R89A 1QLNA 4RWPA 2ZH9A 2FPMA 2R8KA 4KLLA 1TV9A 5KG4A 1RXWA 2DR8A 3WFPA 1MIYA 2BQ3A 1ZQIA 3UXPA 3K75D 2HHVA 4X4TA 2HHQA 4MF8A 3KHRA 4R66A 2ASJA 4I2JA 3PMNA 7ICJA 3GV5B 2M2TA 2ZH6A 4F92B 7ICVA 3H3AA 4P4MA 4AT9A 3JPQA 2ZUCA 5J0WA 2XCAA 1X9MA 1ZQRA 5IIJA 4QZAA 3HP6A 1NKCA 4R8UB 2NRVA 1U4BA 2FMPA 3WFOA 2R8JA 4FHYA 5D49A 3KHHA 3EPGA 1TFYA 5EOZA 2WTFA 2MAXA 3ORYA 4TQSA 8ICGA 1SKSA 1L3UA 2AQ4A 3QEBZ 7ICTA 1JQRA 3OUYA 9ICNA 4P2HA 3H8JA 1XC9A 4RQ4A 2AQ0A 2ALZA 3B0YA 1XSLA 1N48A 3RAQA 4M6WB 2HVIA 5DB9A 3SV4A 1A77A 4F50A 4AT7A 2NRKA 2A1JB 1UT8A 2ZH4A 4DS5A 4F5RA 4J9MA 2DR9A 7ICUA 1HUOA 3Q8RB 2ZH3A 4I2DA 5KFUA 5J2HA 3V7JA 5D4BA 1BPYA 1TK8A 3RR7A 4F2SA 1CEZA 4UB3A 3AU6A 3T5LA 3MR3A 1L3TA 3HIYA 3ISDA 1WOTA 4X5VA 2HHUA 4RUCA 1UA1A 4J9QA 3PMLA 4FHXA 1UA0A 3PO4A 3PX4A 4I2EA 1ZQNA 2XY5A 1ZQOA 4CCHA 4RZRA 5DB6A 3GQCA 2BCVA 9ICQA 3AUOA 1SKWA 4QZHA 2H5XA 4P4OA 7ICMA 3NTUA 5DG8A 3ZDCA 5DDMA 3GILA 3H40A 4F2RA 4I27A 9ICIA 1H38A 4O3QA 2JEGA 3PW4A 4JWNA 4PHAA 4RU9A 4RWQA 5KG2A 1S0NA 3SI8A 4DLGA 2IHNA 3FYHA 2W9BA 1S77D 2KFZA 2PXIA 3G6VA 1KRPA 4F3OA 2XGQA 5HRKA 2ZJ5A 4FHVA 4WC4A 3Q8PB 3MR6A 5L1JA 8ICLA 5DGBA 1X9WA 1MQ3A 4C8MA 3E2EA 4WCWA 2DR7A 4M9LA 2W9CA 3UXNA 3HT3A 4KTQA 5J2FA 1VFGA 3MGHA 3GIKA 1KEJA 1UEVA 5J2JA 2ZUDA 2BQUA 4YMMA 1TK0A 4UQGA 5HRGA 2AJQA 2W8KA 4EBJA 4YXMA 4C8LA 1TVAA 2BPGA 1FA0A 1T4GA 5BOMA 4DS4A 4I2CA 4KLDA 4EYIB 3OSPA 4O3SA 8ICPA 2JZBB 4M5DA 3HX0A 4YVZA 4BDPA 4X4OA 1XS9D 2PI5A 1ZQJA 4XQ8A 1L3VA 4TUQA 5IILA 4M9HA 1L3SA 8ICNA 1F5AA 5DLGA 9ICMA 4GLXA 1KDHA 4X4QA 4M6WA 4KMUA 5DDYA 2IHMA 5CHGA 4ECZA 5KFOA 4DFKA 9ICHA 4LZDA 2LYHA 1MIWA 4NLGA 5IIIA 5C5JA 1NO5A 4QWDA 3M9NB 4E0DA 5J0TA 5KFPA 2AU0A 4DSKA 4RNOA 4DSIA 3LWMA 1U47A 5HRDA 4F4ZA 8ICUA 3GV8B 4EP7A 4RQ3A 4F5NA 2C22A 1T8EA 5HREA 4GXJA 1ZQFA 5IIMA 5EWFA 3TARA 4K4HA 9ICGA 3T5HA 3M9MB 5CR0A 2ASLA 2HHXA 3SZ2A 1BNOA 4YP3A 2W9MA 5J2IA 4YR2A 5KFKA 2V4QA 1S97A 3MDCA 3PW5A 5F9NA 4QZIA 3RRHA 4ECXA 5HRFA 1NK8A 4X4SA 9ICJA 2I1QA 2AGOA 3HJ1A 5J2DA 4EEYA 1NK6A 4QWAA 3M9OB 4K4IA 1ZQYA 3C2KA 2DFLA 1BPEA 4QZFA 4JUZA 4Z6DA 4DO9A 4O3OA 4GXKA 5HC9A 3H4DA 4X0BA 2IA6A 2FLPA 3OUYB 1TAQA 4IRCA 2KFNA 3G6YA 4PPXA 2BCUA 3BQTA 3UQ2A 2PFNA 1TFWA 5EWGA 3PW2A 5KG3A 2PFQA 3MDAA 2J6UA 5DKWA 3RAXA 2NRWA 4F4KA 4JV2A 8ICEA 3JPSA 3TFRA 1U45A 4RWNA 2F1JA 2VA8A 8ICJA 2F1HA 2XGPA 5HMMA 1S0OA 2BPCA 4J9OA 4DF4A 3RBEA 2BR0A 3PNCA 2W9CB 1U49A 3OV7A 5KG7A 4I2IA 5J0OA 4PGXA 3C66A 4QZEA 3PX6A 3ZDBA 4DSJA 2ZH7A 2DRAA 2ZTCA 3K4GA 4QZCA 4NXZA 3KHLA 3MGIA 4KLFA 9ICOA 5KFNA 5HRIA 4X0AA 1BPZA 2P6RA 4I2BA 4ED7A 4NM1A 3C23A 3OHAA 3EWAA 3BDPA 4I28A 4X4NA 4PHPA 4M47A 2IMWP 1RYSA 2ASDA 9ICAA 8ICHA 4DL5A 4K4GA 4X4VA 1ZQLA 8ICWA 4Z6FA 1ZQMA 3ISBA 5KFCA 3THVA 3LDAA 5TZVA 4RQ1A 7ICRA 4EBEA 1ZQZA 4RT3A 1Z3EB 3C21A 5KT2A 3QZ7A 3JPTA 8ICYA 4YXJA 1BVSA 5J2AA 3UPSA 4O5CA 2IBKA 1YLQA 3JPNA 4RQ7A 4XRHA 5DG7A 5HRLA 8ICTA 4O5KA 1ZQQA 5KTQA 9ICKA 1S76D 3TAPA 1Y88A 5KG5A 4F4YA 4MF2A 1KNYA 8ICOA 2P66A 4DLEA 3AQMA 1ZQDA 5KG1A 5DLFA 4O5EA 4ATBB 1RXVA 4XUSA 2JEJA 4UB4A 1U48A 2J6TA 1BNPA 1N56A 1ZQVA 4ECVA 2HHPA 4B9UA 3LWLA 8ICBA 3PY8A 4DOAA 4KITB 3UPQA 4DQPA 4DFPA 2JEIA 4I2FA 4Q43A 4ECUA 4QWCA 3LK9A 2R8GA 8ICMA 1KFTA 4NLKA 4QW8A 3AQNA 2ZH2A 4M9GA 7ICPA 9ICVA 4Q44A 1LB2B 1WCNA 4UAYA 1S9FA 1ZQSA 2BCQA 5KFMA 4IQWA 1X2IA 4FS2A 1ZQEA 5F9LA 2HVHA 4O3NA 4EYHB 4FBTA 4DQSA 4S3NA 4TUSA 2R8HA 4QZ9A 3HWTA 4DL4A 9ICEA 5HNKA 3V6HA 2ZTDA 4AT8B 4RT2A 4UBBA 2FLLA 2DPJA 2PFPA 1DGSA 1MQ2A 5DQGA 4O9MA 5J29A 4Q8FA 3H37A 4FS1A 4AT8A 2A1JA 5KFDA 4F4XA 2KZZA 2F1IA 5KFSA 3ISCA 1KLNA 1XO1A 4F8RA 4BGDA 5DQIA 1ZQBA 2DR5A 3RJFA 4X4PA 5KFZA 1JAJA 5J0RA 5KFJA 4LT6A 3QE9Y 3NGDA 4PH5A 2FPLA 4YMOA 5L1LA 3ZDDA 2PBEA 3RJIA 1JX4A 1ZJMA 2C28A 4RPXA 1ZQKA 2UVVA 4Z6CA 4F93B 5HHHA 2XC9A 5L1IA 1ZJNA 7ICQA 1JMSA 4X4UA 8ICSA 1B22A 2KN7A 4Q8EA 4G3IA 1SL0A 1S0MA 2BCSA 1JXEA 4I2GA 1ZYQA 2BGWA 4QZBA 3M8SA 1SL2A 5KFIA 1BPXA 8ICIA 2ZJ8A 4DSEA 4WC5A 5KFXA 4DOBA 4KLIA 4J9NA 1ZQCA 5HMLA 4GC7A 3Q8MA 2VA2A 1D9DA 2HHSA 5DEDA 1T7PA 4DL6A 4KLGA 4I2HA 2M9NA 1AROP 1XWLA 1ZQXA 7ICGA 4TURA 4FBUA 1NKBA 4ED1A 4KLEA 4J9KA 1NK0A 2NRXA 3QEAZ 3Q8KA 2HHWA 3GFKB 3OHBA 4YD1A 4KLHA 3Q8QB 9ICLA 1R8BA 5KT3A 9ICWA 3EZ5A 2BHNA 1TKDA 4F5OA 3T3FA 5HP4A 3IHQB 3GIIA 1NK9A 5J0YA 4KLTA 5KFVA 2ID1A 4B9VA 1V4AA 1IXRA 4BWJA 3T5JA 1S10A 3H8WA 3MFHA 4FO6A 1KFSA 4ATBA 2ATLA 4EBDA 2FPKA 1SKRA 3OSNA 3N97B 3RJGA 1U9LA 3V7LA 4ED2A 2KZMA 4F5QA 3LQCB 3B0XA 1ZQTA 2C2RA 2RDJA 1NJZA 4YN4A 4EZ6A 3KHGA 3RB3A 1NK5A 4M0AA 4DQQA 4UB2A 4RUAA 4DEZA 2XY6A 9ICCA 4KLQA 4ZH4A 4O3RA 4Q45A 1CUKA 9ICUA 2M2WA 4IQTA 4FHWA 5HRBA 4QWBA 3RTVA 2FMSA 2HW3A 4YCXA 5KFQA 1RZTA 7ICNA 4DL7A 1XSNA 4EBKA 4QWEA 4TUPA 4B9NA 8ICCA 2HHTA 4WC0A 4KLMA 4DQRA 4RQ5A 5L9XA 3RR8A 3RH4A 8ICQA 2PI4A 1NZPA 3FDSA 3Q8SB 1ZQAA 5CP2A 1UETA 4WC2A 5CJ7A 2FMQA 3C18A 4ED3A 5J0UA 3RBDA 2UVWA 3C1ZA 4WC6A 2B21A 2M2VA 1DK2A 1SZPA 2RFFA 3NYBA 3ZDEA 4KLUA 3C5FA 4IQVA 1TK5A 3WFQE 2RDIA 3RH6A 4B9MA 4DSLA 4NKUA 4ECYA 4WC3A 3H4BA 2AGPA 4IR1A 4EBCA 4NY8A 1K1SA 4PGQA 3V6KA 3PW7A 2OWOA 4E8FA 4UD5A 1NK7A 1WCLA 1EXNA 5KG6A 2ZH1A 5J0XA 1LV5A 4J9SA 2UVRA 5JUMA 3H8SA 3PVXA 1BPBA 1ZQUA 1R8AA 4R65A 1XSPA 4B9TA 3GV7B 5J2BA 3BQ1A 3JPOA 2FLNA 4B9SA 1A76A 4RPYA 4ECTA 1MSWD 8ICAA 2BPFA 4JV0A 1B43A 4EZ9A 8ICVA 5KT5A 3ZD8A 4UB5A 4F91B 3C5GA 1PZNA 4ECWA 3AQKA 3SV3A 4F5PA 4UB1A 1BPDA 4XQ7A 3AQLA 5CA7A 5KFEA 1C7YA 3IM1A 2R8IA 5HR9A 9ICXA 3MBYA 5KFHA 4QZ8A 7ICSA 4B9LA 3L9DA 7ICLA 1KFDA 3PX0A 3PO5A 1ZQGA 1HJPA 2NRTA 3T5KA 2KP7A 3H7IA 5KFLA 5KFRA 4WC1A 4RNNA 1Q78A 4NM2A 4GC6A 4M2YA 4J9LA 2DVIA 1QSSA 1TFRA 4JK1A 4PHDA 3MR5A 1D9FA 4LZGA 1JN3A 2W8LA 3KTQA 1Q79A 5DB7A 1XU4A 1OU5A 3OVSA 4YMNA 4YD2A 3MFIA 3TAQA 4DWIA 1TAUA 4IRDA 5KFYA 4DQIA 4E80A 4FH3A 1S0VA 1VJ7A 4GXIA 9ICRA 9ICSA 2KTQA 2W9AA 4YR3A 1X9SA 4HYKA 1QSYA 4XA5A 3RJKA 4ED6A 5KFTA 3BQ2A 3BQ0A 4C8KA 3V72A 1MIVA 1MC8A 3JPPA 4FH5A 3PR4A 3TANA 2MUTA 4WBYA 1K1QA 2JZBA 4C8NA 4M04A 5KG0A 5DBCA 5IIOA 4MEXA 3RH5A 2O1PA 5L1KA 2ISOA 2Q0ZX 1HUZA 2PFOA 7ICIA 4ELVA 1Z00B 2ZUBA 3ETLA 4MEYA 4YR0A 1D8YA 2GWSA 4RQ2A 1NJXA 1QSLA 2C2EA 5KFFA 4RQ6A 4DOCA 9ICPA 1IM4A 3WFSC 5KFBA 4PHEA 5IIKA 1BGXT 4QZGA 5BPCA 4ED0A 3UQ0A 4UAZA 1D8LA 1L5UA 2BKEA 2ZTEA 5J0SA 3EYZA 3UXOA 2VA3A 4WC7A 3OVAA 2Y1IA 3EPIA 8ICFA 4IRKA 2DPIA 4M9JA 5KFAA 2M2UA 3V7KA 4KLSA 7ICFA 4NKTA 5BOLA 5DGAA 2ZHBA 2O5AA 1UEUA 2V4RA 4O3PA 4YQWA 1KTQA 4DL3A 3JYYA 2W9BB 3WFRE 2ISPA 4BWMA 4PGYA 3PV8A 4DFMA 3GIMA 2C2DA 1RYRA 3H39A 5DECA 4X4RA 1DOQA 2ZHAA 5CB1A 2Y1JA 4Z6EA 3AU2A 2BCRA 2MUTB 4RQ0A 4JV1A 4KN7A 4DF8A 3MABA 5DBAA 3OJUA 2Q66A 3RB6A 4NLNA 3RJHA 2P6UA 2AGQA 1ZQHA 4IQUA 3MR2A 4DL2A 1NK4A 2BDPA 2UVUA 1Z00A 4R8UA 5DBBA 1NOMA 3OJSA 4F4WA 2JEFA 3BJYA 3G6XA 5J2CA 4C8OA 5J2GA 5J0QA 4KLOA 4FHPA 9ICBA 3H38A 5DB8A 1KSPA 5D46A 8ICKA 2ZH8A 5J2EA 4ED8A 4M9NA 1NJWA 8ICZA 4ELTA 5HRHA 5KFGA 3PR5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KLJ A;  4J9R A;  5DG9 A;  8ICX A;  4KN4 A;  4AT7 B;  4P4P A;  7ICH A;  4QW9 A;  4YG2 A;  4YFK A;  4UAW A;  1QTM A;  3HPO A;  4ECS A;  4O0I A;  3GDX A;  5F2V O;  4BXO A;  3OVB A;  4RNM A;  5HHI A;  9ICF A;  3RB4 A;  5KFW A;  4IG8 A;  3JZ0 A;  1T3N A;  2I9G A;  2XY7 A;  3SYZ A;  1NKE A;  9ICT A;  5J0P A;  2XO7 A;  2J6S A;  3GIJ A;  3RJE A;  1R8C A;  4E7X A;  4UBC A;  1V9P A;  4RQ8 A;  1ZQP A;  4NLZ A;  4J9P A;  3C2M A;  2ZJA A;  3QZ8 A;  2KZ3 A;  4DSF A;  2V9W A;  2ZH5 A;  3M8R A;  1SL1 A;  4WBZ A;  2DRB A;  4ECQ A;  3V6J A;  2BE3 A;  3C1Y A;  4RPZ A;  2XCP A;  1NJY A;  3OGU A;  3HW8 A;  1JIH A;  3JPR A;  1ZET A;  1ZQW A;  3ZDA A;  3RJJ A;  3Q8L A;  5IIN A;  4I29 A;  4AT9 B;  5DQH A;  3TQ1 A;  5J2K A;  3N4M B;  3HJ4 A;  3ZD9 A;  5KT4 A;  4ELU A;  5KT6 A;  1COO A;  5CWR A;  4MFA A;  5KT7 A;  4ECR A;  1DK3 A;  3RRG A;  4UD4 A;  4IR9 A;  1RPL A;  4R63 A;  3C2L A;  1PX5 A;  4R64 A;  2VAN A;  5EWE A;  4DFJ A;  3RB0 A;  1JXL A;  3TFS A;  4QZD A;  4TQR A;  4BXO B;  4I2A A;  4MFC A;  1UT5 A;  2NRZ A;  3TI0 A;  4JWM A;  4MFF A;  8ICR A;  3EW9 A;  2BQR A;  7ICE A;  4RWO A;  3PW0 A;  4LVS A;  7ICK A;  7ICO A;  1R89 A;  1QLN A;  4RWP A;  2ZH9 A;  2FPM A;  2R8K A;  4KLL A;  1TV9 A;  5KG4 A;  1RXW A;  2DR8 A;  3WFP A;  1MIY A;  2BQ3 A;  1ZQI A;  3UXP A;  3K75 D;  2HHV A;  4X4T A;  2HHQ A;  4MF8 A;  3KHR A;  4R66 A;  2ASJ A;  4I2J A;  3PMN A;  7ICJ A;  3GV5 B;  2M2T A;  2ZH6 A;  4F92 B;  7ICV A;  3H3A A;  4P4M A;  4AT9 A;  3JPQ A;  2ZUC A;  5J0W A;  2XCA A;  1X9M A;  1ZQR A;  5IIJ A;  4QZA A;  3HP6 A;  1NKC A;  4R8U B;  2NRV A;  1U4B A;  2FMP A;  3WFO A;  2R8J A;  4FHY A;  5D49 A;  3KHH A;  3EPG A;  1TFY A;  5EOZ A;  2WTF A;  2MAX A;  3ORY A;  4TQS A;  8ICG A;  1SKS A;  1L3U A;  2AQ4 A;  3QEB Z;  7ICT A;  1JQR A;  3OUY A;  9ICN A;  4P2H A;  3H8J A;  1XC9 A;  4RQ4 A;  2AQ0 A;  2ALZ A;  3B0Y A;  1XSL A;  1N48 A;  3RAQ A;  4M6W B;  2HVI A;  5DB9 A;  3SV4 A;  1A77 A;  4F50 A;  4AT7 A;  2NRK A;  2A1J B;  1UT8 A;  2ZH4 A;  4DS5 A;  4F5R A;  4J9M A;  2DR9 A;  7ICU A;  1HUO A;  3Q8R B;  2ZH3 A;  4I2D A;  5KFU A;  5J2H A;  3V7J A;  5D4B A;  1BPY A;  1TK8 A;  3RR7 A;  4F2S A;  1CEZ A;  4UB3 A;  3AU6 A;  3T5L A;  3MR3 A;  1L3T A;  3HIY A;  3ISD A;  1WOT A;  4X5V A;  2HHU A;  4RUC A;  1UA1 A;  4J9Q A;  3PML A;  4FHX A;  1UA0 A;  3PO4 A;  3PX4 A;  4I2E A;  1ZQN A;  2XY5 A;  1ZQO A;  4CCH A;  4RZR A;  5DB6 A;  3GQC A;  2BCV A;  9ICQ A;  3AUO A;  1SKW A;  4QZH A;  2H5X A;  4P4O A;  7ICM A;  3NTU A;  5DG8 A;  3ZDC A;  5DDM A;  3GIL A;  3H40 A;  4F2R A;  4I27 A;  9ICI A;  1H38 A;  4O3Q A;  2JEG A;  3PW4 A;  4JWN A;  4PHA A;  4RU9 A;  4RWQ A;  5KG2 A;  1S0N A;  3SI8 A;  4DLG A;  2IHN A;  3FYH A;  2W9B A;  1S77 D;  2KFZ A;  2PXI A;  3G6V A;  1KRP A;  4F3O A;  2XGQ A;  5HRK A;  2ZJ5 A;  4FHV A;  4WC4 A;  3Q8P B;  3MR6 A;  5L1J A;  8ICL A;  5DGB A;  1X9W A;  1MQ3 A;  4C8M A;  3E2E A;  4WCW A;  2DR7 A;  4M9L A;  2W9C A;  3UXN A;  3HT3 A;  4KTQ A;  5J2F A;  1VFG A;  3MGH A;  3GIK A;  1KEJ A;  1UEV A;  5J2J A;  2ZUD A;  2BQU A;  4YMM A;  1TK0 A;  4UQG A;  5HRG A;  2AJQ A;  2W8K A;  4EBJ A;  4YXM A;  4C8L A;  1TVA A;  2BPG A;  1FA0 A;  1T4G A;  5BOM A;  4DS4 A;  4I2C A;  4KLD A;  4EYI B;  3OSP A;  4O3S A;  8ICP A;  2JZB B;  4M5D A;  3HX0 A;  4YVZ A;  4BDP A;  4X4O A;  1XS9 D;  2PI5 A;  1ZQJ A;  4XQ8 A;  1L3V A;  4TUQ A;  5IIL A;  4M9H A;  1L3S A;  8ICN A;  1F5A A;  5DLG A;  9ICM A;  4GLX A;  1KDH A;  4X4Q A;  4M6W A;  4KMU A;  5DDY A;  2IHM A;  5CHG A;  4ECZ A;  5KFO A;  4DFK A;  9ICH A;  4LZD A;  2LYH A;  1MIW A;  4NLG A;  5III A;  5C5J A;  1NO5 A;  4QWD A;  3M9N B;  4E0D A;  5J0T A;  5KFP A;  2AU0 A;  4DSK A;  4RNO A;  4DSI A;  3LWM A;  1U47 A;  5HRD A;  4F4Z A;  8ICU A;  3GV8 B;  4EP7 A;  4RQ3 A;  4F5N A;  2C22 A;  1T8E A;  5HRE A;  4GXJ A;  1ZQF A;  5IIM A;  5EWF A;  3TAR A;  4K4H A;  9ICG A;  3T5H A;  3M9M B;  5CR0 A;  2ASL A;  2HHX A;  3SZ2 A;  1BNO A;  4YP3 A;  2W9M A;  5J2I A;  4YR2 A;  5KFK A;  2V4Q A;  1S97 A;  3MDC A;  3PW5 A;  5F9N A;  4QZI A;  3RRH A;  4ECX A;  5HRF A;  1NK8 A;  4X4S A;  9ICJ A;  2I1Q A;  2AGO A;  3HJ1 A;  5J2D A;  4EEY A;  1NK6 A;  4QWA A;  3M9O B;  4K4I A;  1ZQY A;  3C2K A;  2DFL A;  1BPE A;  4QZF A;  4JUZ A;  4Z6D A;  4DO9 A;  4O3O A;  4GXK A;  5HC9 A;  3H4D A;  4X0B A;  2IA6 A;  2FLP A;  3OUY B;  1TAQ A;  4IRC A;  2KFN A;  3G6Y A;  4PPX A;  2BCU A;  3BQT A;  3UQ2 A;  2PFN A;  1TFW A;  5EWG A;  3PW2 A;  5KG3 A;  2PFQ A;  3MDA A;  2J6U A;  5DKW A;  3RAX A;  2NRW A;  4F4K A;  4JV2 A;  8ICE A;  3JPS A;  3TFR A;  1U45 A;  4RWN A;  2F1J A;  2VA8 A;  8ICJ A;  2F1H A;  2XGP A;  5HMM A;  1S0O A;  2BPC A;  4J9O A;  4DF4 A;  3RBE A;  2BR0 A;  3PNC A;  2W9C B;  1U49 A;  3OV7 A;  5KG7 A;  4I2I A;  5J0O A;  4PGX A;  3C66 A;  4QZE A;  3PX6 A;  3ZDB A;  4DSJ A;  2ZH7 A;  2DRA A;  2ZTC A;  3K4G A;  4QZC A;  4NXZ A;  3KHL A;  3MGI A;  4KLF A;  9ICO A;  5KFN A;  5HRI A;  4X0A A;  1BPZ A;  2P6R A;  4I2B A;  4ED7 A;  4NM1 A;  3C23 A;  3OHA A;  3EWA A;  3BDP A;  4I28 A;  4X4N A;  4PHP A;  4M47 A;  2IMW P;  1RYS A;  2ASD A;  9ICA A;  8ICH A;  4DL5 A;  4K4G A;  4X4V A;  1ZQL A;  8ICW A;  4Z6F A;  1ZQM A;  3ISB A;  5KFC A;  3THV A;  3LDA A;  5TZV A;  4RQ1 A;  7ICR A;  4EBE A;  1ZQZ A;  4RT3 A;  1Z3E B;  3C21 A;  5KT2 A;  3QZ7 A;  3JPT A;  8ICY A;  4YXJ A;  1BVS A;  5J2A A;  3UPS A;  4O5C A;  2IBK A;  1YLQ A;  3JPN A;  4RQ7 A;  4XRH A;  5DG7 A;  5HRL A;  8ICT A;  4O5K A;  1ZQQ A;  5KTQ A;  9ICK A;  1S76 D;  3TAP A;  1Y88 A;  5KG5 A;  4F4Y A;  4MF2 A;  1KNY A;  8ICO A;  2P66 A;  4DLE A;  3AQM A;  1ZQD A;  5KG1 A;  5DLF A;  4O5E A;  4ATB B;  1RXV A;  4XUS A;  2JEJ A;  4UB4 A;  1U48 A;  2J6T A;  1BNP A;  1N56 A;  1ZQV A;  4ECV A;  2HHP A;  4B9U A;  3LWL A;  8ICB A;  3PY8 A;  4DOA A;  4KIT B;  3UPQ A;  4DQP A;  4DFP A;  2JEI A;  4I2F A;  4Q43 A;  4ECU A;  4QWC A;  3LK9 A;  2R8G A;  8ICM A;  1KFT A;  4NLK A;  4QW8 A;  3AQN A;  2ZH2 A;  4M9G A;  7ICP A;  9ICV A;  4Q44 A;  1LB2 B;  1WCN A;  4UAY A;  1S9F A;  1ZQS A;  2BCQ A;  5KFM A;  4IQW A;  1X2I A;  4FS2 A;  1ZQE A;  5F9L A;  2HVH A;  4O3N A;  4EYH B;  4FBT A;  4DQS A;  4S3N A;  4TUS A;  2R8H A;  4QZ9 A;  3HWT A;  4DL4 A;  9ICE A;  5HNK A;  3V6H A;  2ZTD A;  4AT8 B;  4RT2 A;  4UBB A;  2FLL A;  2DPJ A;  2PFP A;  1DGS A;  1MQ2 A;  5DQG A;  4O9M A;  5J29 A;  4Q8F A;  3H37 A;  4FS1 A;  4AT8 A;  2A1J A;  5KFD A;  4F4X A;  2KZZ A;  2F1I A;  5KFS A;  3ISC A;  1KLN A;  1XO1 A;  4F8R A;  4BGD A;  5DQI A;  1ZQB A;  2DR5 A;  3RJF A;  4X4P A;  5KFZ A;  1JAJ A;  5J0R A;  5KFJ A;  4LT6 A;  3QE9 Y;  3NGD A;  4PH5 A;  2FPL A;  4YMO A;  5L1L A;  3ZDD A;  2PBE A;  3RJI A;  1JX4 A;  1ZJM A;  2C28 A;  4RPX A;  1ZQK A;  2UVV A;  4Z6C A;  4F93 B;  5HHH A;  2XC9 A;  5L1I A;  1ZJN A;  7ICQ A;  1JMS A;  4X4U A;  8ICS A;  1B22 A;  2KN7 A;  4Q8E A;  4G3I A;  1SL0 A;  1S0M A;  2BCS A;  1JXE A;  4I2G A;  1ZYQ A;  2BGW A;  4QZB A;  3M8S A;  1SL2 A;  5KFI A;  1BPX A;  8ICI A;  2ZJ8 A;  4DSE A;  4WC5 A;  5KFX A;  4DOB A;  4KLI A;  4J9N A;  1ZQC A;  5HML A;  4GC7 A;  3Q8M A;  2VA2 A;  1D9D A;  2HHS A;  5DED A;  1T7P A;  4DL6 A;  4KLG A;  4I2H A;  2M9N A;  1ARO P;  1XWL A;  1ZQX A;  7ICG A;  4TUR A;  4FBU A;  1NKB A;  4ED1 A;  4KLE A;  4J9K A;  1NK0 A;  2NRX A;  3QEA Z;  3Q8K A;  2HHW A;  3GFK B;  3OHB A;  4YD1 A;  4KLH A;  3Q8Q B;  9ICL A;  1R8B A;  5KT3 A;  9ICW A;  3EZ5 A;  2BHN A;  1TKD A;  4F5O A;  3T3F A;  5HP4 A;  3IHQ B;  3GII A;  1NK9 A;  5J0Y A;  4KLT A;  5KFV A;  2ID1 A;  4B9V A;  1V4A A;  1IXR A;  4BWJ A;  3T5J A;  1S10 A;  3H8W A;  3MFH A;  4FO6 A;  1KFS A;  4ATB A;  2ATL A;  4EBD A;  2FPK A;  1SKR A;  3OSN A;  3N97 B;  3RJG A;  1U9L A;  3V7L A;  4ED2 A;  2KZM A;  4F5Q A;  3LQC B;  3B0X A;  1ZQT A;  2C2R A;  2RDJ A;  1NJZ A;  4YN4 A;  4EZ6 A;  3KHG A;  3RB3 A;  1NK5 A;  4M0A A;  4DQQ A;  4UB2 A;  4RUA A;  4DEZ A;  2XY6 A;  9ICC A;  4KLQ A;  4ZH4 A;  4O3R A;  4Q45 A;  1CUK A;  9ICU A;  2M2W A;  4IQT A;  4FHW A;  5HRB A;  4QWB A;  3RTV A;  2FMS A;  2HW3 A;  4YCX A;  5KFQ A;  1RZT A;  7ICN A;  4DL7 A;  1XSN A;  4EBK A;  4QWE A;  4TUP A;  4B9N A;  8ICC A;  2HHT A;  4WC0 A;  4KLM A;  4DQR A;  4RQ5 A;  5L9X A;  3RR8 A;  3RH4 A;  8ICQ A;  2PI4 A;  1NZP A;  3FDS A;  3Q8S B;  1ZQA A;  5CP2 A;  1UET A;  4WC2 A;  5CJ7 A;  2FMQ A;  3C18 A;  4ED3 A;  5J0U A;  3RBD A;  2UVW A;  3C1Z A;  4WC6 A;  2B21 A;  2M2V A;  1DK2 A;  1SZP A;  2RFF A;  3NYB A;  3ZDE A;  4KLU A;  3C5F A;  4IQV A;  1TK5 A;  3WFQ E;  2RDI A;  3RH6 A;  4B9M A;  4DSL A;  4NKU A;  4ECY A;  4WC3 A;  3H4B A;  2AGP A;  4IR1 A;  4EBC A;  4NY8 A;  1K1S A;  4PGQ A;  3V6K A;  3PW7 A;  2OWO A;  4E8F A;  4UD5 A;  1NK7 A;  1WCL A;  1EXN A;  5KG6 A;  2ZH1 A;  5J0X A;  1LV5 A;  4J9S A;  2UVR A;  5JUM A;  3H8S A;  3PVX A;  1BPB A;  1ZQU A;  1R8A A;  4R65 A;  1XSP A;  4B9T A;  3GV7 B;  5J2B A;  3BQ1 A;  3JPO A;  2FLN A;  4B9S A;  1A76 A;  4RPY A;  4ECT A;  1MSW D;  8ICA A;  2BPF A;  4JV0 A;  1B43 A;  4EZ9 A;  8ICV A;  5KT5 A;  3ZD8 A;  4UB5 A;  4F91 B;  3C5G A;  1PZN A;  4ECW A;  3AQK A;  3SV3 A;  4F5P A;  4UB1 A;  1BPD A;  4XQ7 A;  3AQL A;  5CA7 A;  5KFE A;  1C7Y A;  3IM1 A;  2R8I A;  5HR9 A;  9ICX A;  3MBY A;  5KFH A;  4QZ8 A;  7ICS A;  4B9L A;  3L9D A;  7ICL A;  1KFD A;  3PX0 A;  3PO5 A;  1ZQG A;  1HJP A;  2NRT A;  3T5K A;  2KP7 A;  3H7I A;  5KFL A;  5KFR A;  4WC1 A;  4RNN A;  1Q78 A;  4NM2 A;  4GC6 A;  4M2Y A;  4J9L A;  2DVI A;  1QSS A;  1TFR A;  4JK1 A;  4PHD A;  3MR5 A;  1D9F A;  4LZG A;  1JN3 A;  2W8L A;  3KTQ A;  1Q79 A;  5DB7 A;  1XU4 A;  1OU5 A;  3OVS A;  4YMN A;  4YD2 A;  3MFI A;  3TAQ A;  4DWI A;  1TAU A;  4IRD A;  5KFY A;  4DQI A;  4E80 A;  4FH3 A;  1S0V A;  1VJ7 A;  4GXI A;  9ICR A;  9ICS A;  2KTQ A;  2W9A A;  4YR3 A;  1X9S A;  4HYK A;  1QSY A;  4XA5 A;  3RJK A;  4ED6 A;  5KFT A;  3BQ2 A;  3BQ0 A;  4C8K A;  3V72 A;  1MIV A;  1MC8 A;  3JPP A;  4FH5 A;  3PR4 A;  3TAN A;  2MUT A;  4WBY A;  1K1Q A;  2JZB A;  4C8N A;  4M04 A;  5KG0 A;  5DBC A;  5IIO A;  4MEX A;  3RH5 A;  2O1P A;  5L1K A;  2ISO A;  2Q0Z X;  1HUZ A;  2PFO A;  7ICI A;  4ELV A;  1Z00 B;  2ZUB A;  3ETL A;  4MEY A;  4YR0 A;  1D8Y A;  2GWS A;  4RQ2 A;  1NJX A;  1QSL A;  2C2E A;  5KFF A;  4RQ6 A;  4DOC A;  9ICP A;  1IM4 A;  3WFS C;  5KFB A;  4PHE A;  5IIK A;  1BGX T;  4QZG A;  5BPC A;  4ED0 A;  3UQ0 A;  4UAZ A;  1D8L A;  1L5U A;  2BKE A;  2ZTE A;  5J0S A;  3EYZ A;  3UXO A;  2VA3 A;  4WC7 A;  3OVA A;  2Y1I A;  3EPI A;  8ICF A;  4IRK A;  2DPI A;  4M9J A;  5KFA A;  2M2U A;  3V7K A;  4KLS A;  7ICF A;  4NKT A;  5BOL A;  5DGA A;  2ZHB A;  2O5A A;  1UEU A;  2V4R A;  4O3P A;  4YQW A;  1KTQ A;  4DL3 A;  3JYY A;  2W9B B;  3WFR E;  2ISP A;  4BWM A;  4PGY A;  3PV8 A;  4DFM A;  3GIM A;  2C2D A;  1RYR A;  3H39 A;  5DEC A;  4X4R A;  1DOQ A;  2ZHA A;  5CB1 A;  2Y1J A;  4Z6E A;  3AU2 A;  2BCR A;  2MUT B;  4RQ0 A;  4JV1 A;  4KN7 A;  4DF8 A;  3MAB A;  5DBA A;  3OJU A;  2Q66 A;  3RB6 A;  4NLN A;  3RJH A;  2P6U A;  2AGQ A;  1ZQH A;  4IQU A;  3MR2 A;  4DL2 A;  1NK4 A;  2BDP A;  2UVU A;  1Z00 A;  4R8U A;  5DBB A;  1NOM A;  3OJS A;  4F4W A;  2JEF A;  3BJY A;  3G6X A;  5J2C A;  4C8O A;  5J2G A;  5J0Q A;  4KLO A;  4FHP A;  9ICB A;  3H38 A;  5DB8 A;  1KSP A;  5D46 A;  8ICK A;  2ZH8 A;  5J2E A;  4ED8 A;  4M9N A;  1NJW A;  8ICZ A;  4ELT A;  5HRH A;  5KFG A;  3PR5 B; 
#chains in the Genus database with same CATH topology
 1TE2 A;  5GTH U;  5AM0 A;  4ECS A;  4O0I A;  5ALO A;  4IG8 A;  4UB6 U;  5AM1 A;  1Z4O A;  2XY7 A;  2OEH A;  1FFU A;  3RJE A;  1R8C A;  1V9P A;  4J9P A;  2V9W A;  2IOF A;  2DRB A;  2WB1 C;  4RPZ A;  1NJY A;  4NXW A;  1ZET A;  1ZQW A;  2W11 A;  3ZDA A;  2W55 A;  5IIN A;  5AKZ A;  2NV3 A;  5J2K A;  2WFA A;  2WB1 F;  4UAU A;  5CWR A;  1DK3 A;  4HAI A;  4R63 A;  2GAF D;  4CDG A;  4G9B A;  1PX5 A;  5ALI A;  1JXL A;  4TQR A;  4X4N A;  1X42 A;  2NRZ A;  8ICR A;  3EW9 A;  4RWO A;  2E8O A;  5KL1 B;  4RWP A;  3HIL A;  4KLL A;  1TV9 A;  3AQE A;  5AI6 A;  3OTQ A;  2LHT A;  1L8O A;  1X66 A;  2HHQ A;  4MF8 A;  4I2J A;  1L7P A;  3GV5 B;  5J0W A;  3HP6 A;  4QZA A;  3NVW A;  2KJ5 A;  3NUQ A;  4FHY A;  5AKH A;  1L3U A;  7ICT A;  4P2H A;  3L4P A;  1N48 A;  1XSL A;  3RAQ A;  1A77 A;  4EGW A;  3F2B A;  5ALV A;  4F5R A;  4J9M A;  1F44 A;  4WJ3 B;  1HIW A;  1SV0 C;  4PJ0 U;  3V7J A;  4F2S A;  5EE0 A;  2OHF A;  1SGG A;  1WOT A;  4X5V A;  2HHU A;  3H0L B;  4J9Q A;  4Y2R A;  1UA0 A;  3PO4 A;  3PX4 A;  4I2E A;  2F2A B;  2XY5 A;  1ZQO A;  3LYS A;  1AQ6 A;  3GQC A;  3AUO A;  1SKW A;  4P4O A;  4OAF A;  3TAD C;  3H40 A;  2JEG A;  1PVR A;  3SI8 A;  2IHN A;  4UW9 A;  2FJ6 A;  3G6V A;  1KRP A;  1COK A;  5HRK A;  2Y9U A;  3ETR A;  5L1J A;  1VFG A;  4FZM A;  2YY6 A;  4C4S A;  4YMM A;  2LYB A;  1D8B A;  2ODG A;  1T4G A;  4EYI B;  3OSP A;  3GU3 A;  3HX0 A;  1XS9 D;  1ZQJ A;  4TUQ A;  4PZN A;  5IIL A;  1F5A A;  4X4Q A;  4GLX A;  4M6W A;  3QX7 A;  5DDY A;  5KFO A;  1VJ5 A;  1NO5 A;  3M9N B;  4DSK A;  5AHX A;  2EWR A;  2IOH A;  5CFT A;  3TAR A;  1RDF A;  5GTI U;  3M9M B;  2HHX A;  5J2I A;  3NVZ A;  2I1Q A;  4EEY A;  4K4I A;  1ZQY A;  2FLP A;  3OUY B;  3UQ2 A;  1TFW A;  5ALP A;  3MDA A;  5AKE A;  5DKW A;  4F4K A;  8ICE A;  3TFR A;  2XID A;  2CPR A;  2F1J A;  2XGP A;  2RLT A;  5ALD A;  3VC8 A;  4CE6 A;  4J9O A;  2BR0 A;  2K8A A;  5KG7 A;  4BJQ A;  1JUD A;  4QZE A;  5C0Y A;  3K4G A;  9ICO A;  4KLF A;  3MGI A;  5ALK A;  1BPZ A;  5A0L A;  4NM1 A;  3C23 A;  3OHA A;  3BDP A;  4M47 A;  1RYS A;  4DL5 A;  4NWI A;  4CNQ A;  1RQN A;  2HOF A;  4Y2V A;  3ISB A;  3LDA A;  4EBE A;  4RT3 A;  3SEI A;  3JPT A;  1BVS A;  4C7Y A;  5J2A A;  4OAH A;  2EAM A;  2IBK A;  1P7D A;  4RQ7 A;  1SZH A;  2RRD A;  4O5K A;  1OUQ A;  5KG5 A;  4MF2 A;  1IG6 A;  5AKX A;  4UB4 A;  3LWL A;  4C80 A;  3PY8 A;  4DQP A;  2JEI A;  4QWC A;  2A1A A;  4NLK A;  9ICV A;  3CW2 C;  1LB2 B;  4UAY A;  2D6F C;  5KFM A;  3BQ7 A;  4FS2 A;  4FBT A;  2R8H A;  4DL4 A;  9ICE A;  5HNK A;  2ZTD A;  2VIX A;  3WKA A;  4U6P A;  4UBB A;  1DGS A;  4O9M A;  3WKD A;  3AQF A;  3IDW A;  4Y2J A;  2KZZ A;  1UQV A;  2KE7 A;  3QNM A;  2KIV A;  5D62 A;  3IP4 B;  1ZQB A;  2DR5 A;  3RJF A;  4X4P A;  1MA7 A;  4PH5 A;  4P0P B;  4Z6C A;  4F93 B;  5HHH A;  5L1I A;  2RQ5 A;  4X4U A;  2G09 A;  2OM6 A;  4G3I A;  4JMU A;  2GO7 A;  1SL2 A;  2MSN A;  8ICI A;  4DSE A;  4WOY A;  2M2U A;  1ZQC A;  1FO4 A;  1B0X A;  4DL6 A;  4KLG A;  2M9N A;  1ZQX A;  4TUR A;  2B56 A;  2EAP A;  3GFK B;  3OHB A;  5AIC A;  1NZB A;  1Z4N A;  2BBH A;  4F5O A;  2MA1 A;  5JTI A;  2KMD A;  5JU5 A;  5KFV A;  4KLT A;  4BWJ A;  4ATB A;  1N2X A;  3H8W A;  4FO6 A;  2AHO B;  2R18 A;  3RJG A;  4JLX A;  2L5Y A;  3NWI A;  3F5E A;  2RDJ A;  4EZ6 A;  4OO1 J;  3KHG A;  3RB3 A;  4M0A A;  2JXJ A;  9ICC A;  4WC5 A;  2XY6 A;  4DEZ A;  4Q45 A;  9ICU A;  4FHW A;  3RTV A;  4EEN A;  5KFQ A;  4EBK A;  1XSN A;  4QWE A;  4TUP A;  4B9N A;  4KLM A;  2F8K A;  5AK6 A;  5AI9 A;  3RH4 A;  3NRW A;  3FDS A;  1UET A;  5CP2 A;  5CJ7 A;  5J0U A;  2ZG6 A;  1FEZ A;  2RFF A;  3FM9 A;  4OJO A;  4DSL A;  3ER8 C;  4OJ5 A;  4ECY A;  1PVP A;  3H4B A;  2D3D A;  2ZIX A;  3E58 A;  1K1S A;  3GZF A;  4ZOH C;  2VJ4 A;  4B6J A;  5KAF U;  4I0U A;  5J0X A;  2BZF A;  5F3X B;  4B9T A;  4B9S A;  2KG5 A;  4JV0 A;  4UB1 A;  5CA7 A;  1C7Y A;  5HR9 A;  2XVT A;  4OJP A;  4P0P A;  3PO5 A;  5KFR A;  4OD0 A;  2EQY A;  1QSS A;  3VCB A;  2QAR B;  2W8L A;  5AI4 A;  1XU4 A;  5ALQ A;  4YMN A;  3MFI A;  2HOI A;  2FDR A;  1X9S A;  4HYK A;  4ED6 A;  3BQ0 A;  4C8K A;  1MC8 A;  1ZRN A;  4M04 A;  5ALX A;  3M6K A;  3O0F A;  3RH5 A;  1PVQ A;  3FAH A;  1HUZ A;  1Z00 B;  4MEY A;  1D8Y A;  3ZI4 A;  1NJX A;  1QSL A;  2E8M A;  4DOC A;  4Y2S A;  2YMP A;  5ALL A;  5BPC A;  5HR6 A;  4QZG A;  3UQ0 A;  4UAZ A;  3EYZ A;  2Y1I A;  8ICF A;  4M9J A;  3V7K A;  1X6I A;  4KLS A;  2F76 X;  4O3P A;  5DEC A;  4DFM A;  3GIM A;  3H39 A;  3KD3 A;  3AU2 A;  2BCR A;  4JV1 A;  2Q66 A;  3OJU A;  3RB6 A;  4CF4 A;  1NK4 A;  2BDP A;  1Z19 A;  2EZX A;  3KZI U;  5J2C A;  2OXO A;  4FHP A;  3H38 A;  2QB0 A;  2WF6 A;  8ICZ A;  2YML A;  2QB0 B;  5KFG A;  4DCC A;  4J9R A;  4P4P A;  1GO3 F;  7ICH A;  4OJ6 A;  3HKZ C;  4UAW A;  3GDX A;  3OVB A;  4RNM A;  9ICF A;  3RB4 A;  5KFW A;  3SYZ A;  9ICT A;  1Q3V A;  2J6S A;  1ZQP A;  4EED A;  2KZ3 A;  2YTU A;  4LJX A;  4CF5 A;  2BE3 A;  2XCP A;  3OGU A;  4XJE A;  2GH1 A;  4I29 A;  4AT9 B;  3TQ1 A;  1ZD5 A;  4ECR A;  2KEY A;  3RRG A;  4UD4 A;  4R64 A;  1XO0 A;  4QZD A;  3TI0 A;  2BQR A;  2KVC A;  2G07 A;  7ICK A;  2ZIV A;  7ICO A;  1R89 A;  2DQN B;  4JLZ A;  1ZQ1 C;  2ZH9 A;  3L5K A;  1MIY A;  4J03 A;  2BQ3 A;  1ZQI A;  2LI6 A;  2Q4T A;  3N7R C;  1QQ7 A;  3PMN A;  2M2T A;  7ICV A;  3H3A A;  3WKC A;  2ZUC A;  5IIJ A;  2GLE A;  4R8U B;  2NRV A;  2FMP A;  2HDO A;  5ALF A;  5D49 A;  2KHQ A;  4TQS A;  2AQ4 A;  5AK3 A;  1T94 A;  1XC9 A;  2ALZ A;  5DB9 A;  4F50 A;  2ZH4 A;  2W7P A;  4DS5 A;  2E3T A;  2DR9 A;  1UHU A;  5KFU A;  1BPY A;  1TK8 A;  3AU6 A;  2VKQ A;  3MR3 A;  4NV0 A;  4RUC A;  4FHX A;  3ONN A;  5ALR A;  1PK1 B;  3H8M A;  2BCV A;  5DB6 A;  2NYV A;  2H5X A;  7ICM A;  3NTU A;  3BS5 B;  4F2R A;  5ALU A;  1H38 A;  2BDU A;  2KJ9 A;  4MKP A;  1WUD A;  1S0N A;  4DLG A;  3FYH A;  2Y9T A;  2W9B A;  1S77 D;  4FHV A;  2XGQ A;  2ZJ5 A;  3KFU F;  2YQE A;  3MR6 A;  1X9W A;  4C8M A;  4M9L A;  4KTQ A;  3UXN A;  3HT3 A;  2I6X A;  5J2F A;  5J2J A;  2ZUD A;  2W3R A;  5HRG A;  4EBJ A;  4C8L A;  1TVA A;  1FA0 A;  4I2C A;  3TAD A;  4KLD A;  2F77 X;  4O3S A;  4IS7 A;  4DFD A;  4X4O A;  2PI5 A;  4UB8 U;  8ICN A;  2IOF K;  2LPE A;  4K9A A;  2G06 A;  9ICH A;  4Y2Y A;  1MIW A;  4NLG A;  5III A;  1S8O A;  4DSI A;  1QQ6 A;  1GPJ A;  3LWM A;  5HRD A;  3GV8 B;  4EP7 A;  1T8E A;  5CR0 A;  1HEK A;  4LEZ A;  3D2S A;  1S97 A;  3PW5 A;  5F9N A;  4ECX A;  9ICJ A;  1X6J A;  4QWA A;  1UCV A;  4KMO B;  4JUZ A;  1VDV A;  4Z6D A;  4DO9 A;  3H4D A;  4X0B A;  3BQT A;  5EWG A;  5KG3 A;  2A3V A;  2J6U A;  5J8Y A;  3NKU A;  3JPS A;  1QCK A;  5HMM A;  4DF4 A;  1U49 A;  4NLC A;  3PNC A;  5AK5 A;  5J0O A;  3KZX A;  3KHL A;  4QZC A;  4NXZ A;  4ED7 A;  2EZZ A;  2F44 A;  1ZQL A;  8ICW A;  1QQ5 A;  2HI0 A;  1ZQM A;  2ZIU A;  3THV A;  5TZV A;  3QZ7 A;  1ECW A;  8ICY A;  4C4R A;  4YXJ A;  1S5L U;  3UPS A;  1SV0 A;  4US8 A;  3JPN A;  4AYB F;  4FZL A;  3M6Z A;  5FP0 A;  1S76 D;  3TAP A;  1IV8 A;  2ZIW A;  5ALJ A;  1K5O A;  1KNY A;  8ICO A;  2H3F A;  5CFU A;  2KKP A;  1ZQD A;  5KG1 A;  1RXV A;  1U48 A;  3CRX A;  1BNP A;  2DBY A;  3ER9 B;  4Q43 A;  4ECU A;  2OH2 A;  2R8G A;  8ICM A;  1KFT A;  1C20 A;  2HN1 A;  2WF8 A;  7ICP A;  4Q44 A;  4ICA A;  4WQL A;  2EH9 A;  1ZQS A;  1X2I A;  4EYH B;  1YT3 A;  4DQS A;  3PSI A;  3V6H A;  2EAN A;  4RT2 A;  2FLL A;  2PFP A;  5ALS A;  5DQG A;  1ZD3 A;  5J29 A;  3H37 A;  3OPX A;  4AT8 A;  2F1I A;  1KLN A;  2WF7 A;  1XO1 A;  1WYG A;  4BGD A;  4K9B A;  5KFJ A;  2LYA A;  5L1L A;  5B3Q A;  3ZDD A;  1SWV A;  4RPX A;  1ZJN A;  4IL6 U;  4Y2T A;  7ICQ A;  5B3P A;  8ICS A;  4Q8E A;  2OCE A;  1S0M A;  1JXE A;  3N7P D;  4I2G A;  2BGW A;  4QZB A;  4KLI A;  4J9N A;  4GC7 A;  3QU5 A;  3Q8M A;  1T7P A;  3UMC A;  3NVV A;  1XWL A;  1SB3 C;  1NKB A;  4J9K A;  3IN5 A;  2NRX A;  3Q8K A;  2B51 A;  3F5A A;  3Q8Q B;  1R8B A;  3EZ5 A;  3QUQ A;  1LVH A;  3C28 A;  4PL2 A;  4B9V A;  3T5J A;  1S10 A;  3N7S C;  3MFH A;  3UMB A;  3V7L A;  1SXD A;  2CXY A;  3LQC B;  1ZQT A;  2C2R A;  4YN4 A;  1L7O A;  3I28 A;  3CYM A;  4RUA A;  2B6G A;  2FMS A;  5ALW A;  1RZT A;  1SV4 A;  2HHT A;  5ALY A;  2A19 A;  3Q8S B;  3RBD A;  2B21 A;  2D8C A;  1DK2 A;  1SZP A;  2MRL A;  4FFD A;  5AKI A;  3ZDE A;  3S6J A;  1DGJ A;  1TK5 A;  3WFQ E;  2RDI A;  3RH6 A;  4NKU A;  1JAL A;  4UAS A;  2JH7 A;  4WC3 A;  2IHO A;  2CN1 A;  2E5S A;  4E8F A;  1NK7 A;  2ZH1 A;  2UVR A;  4NJ8 A;  1ZQU A;  1R8A A;  8ICA A;  3JPO A;  1A76 A;  8ICV A;  4UB5 A;  3ZD8 A;  3SV3 A;  1BPD A;  3AQL A;  1N61 A;  2R8I A;  9ICX A;  3MBY A;  7ICS A;  2CRX A;  5CEH A;  3L9D A;  1WWV A;  4Y2Q A;  5AM5 A;  2JRZ A;  3T5K A;  3WKE A;  3D6J A;  3H7I A;  5KFL A;  4WC1 A;  4NXX A;  1ZD2 P;  4RNN A;  1Q78 A;  4M2Y A;  2DVI A;  4PZO A;  1OU5 A;  2HBM A;  2E8N A;  3TAQ A;  3NVY A;  1TAU A;  4IRD A;  5KFY A;  4DQI A;  2HOQ A;  3C29 A;  2W9A A;  4XA5 A;  3IV6 A;  5KFT A;  3BQ2 A;  5D61 A;  3V72 A;  3TAN A;  4WBY A;  4F71 A;  2JZB A;  4C8N A;  2EAO A;  5KG0 A;  3QUT A;  1OXJ A;  2Q0Z X;  2MU2 A;  2GWS A;  2K60 A;  4RQ2 A;  3IG8 A;  4PHE A;  3QYP A;  3UXO A;  2AXT U;  2DPI A;  3SAG A;  5BOL A;  5KAI U;  5DGA A;  1UEU A;  4C7Z A;  5ALH A;  1KTQ A;  2W9B B;  1LKY B;  4BWM A;  4PGY A;  3PV8 A;  2ZHA A;  2Y1J A;  5CB1 A;  3LVV A;  1DRG A;  3H0R B;  2AGQ A;  4IQU A;  3MR2 A;  1Z00 A;  5DBB A;  5ALE A;  5ALZ A;  1Z1V A;  3EF2 A;  3G6X A;  2P35 A;  4C8O A;  4QIW F;  4K99 A;  4US9 A;  9ICB A;  2W04 A;  2XIC A;  2ZH8 A;  5J2E A;  3BS5 A;  4O67 A;  4ELT A;  3PR5 B;  1RYU A;  4Y2P A;  5DG9 A;  4AT7 B;  4KN4 A;  3SQI A;  1KQQ A;  1XNS A;  4YG2 A;  4YFK A;  5F2V O;  4BXO A;  2KNJ A;  5HHI A;  5G5G A;  1T3N A;  2I9G A;  3GIJ A;  4RQ8 A;  3WK5 A;  4NLZ A;  2ZH5 A;  3C2M A;  2ZJA A;  3M8R A;  2AH5 A;  4ECQ A;  3V6J A;  3I76 A;  4ACO A;  3JPR A;  5DQH A;  2KVS A;  3HJ4 A;  5KT4 A;  4O6A A;  4ELU A;  2HBJ A;  2JV3 A;  5KT6 A;  5KT7 A;  4DFJ A;  3AL0 B;  4I2A A;  4MFF A;  1NI3 A;  3PW0 A;  1YZ6 A;  1N5X A;  1L7M A;  2FPM A;  1CRX A;  2DR8 A;  5L1M A;  1M6Y A;  3UXP A;  2HHV A;  4R66 A;  2ZH6 A;  4F92 B;  4AT9 A;  3JPQ A;  1X9M A;  1ZQR A;  1U4B A;  3KOO A;  3EPG A;  2HN2 A;  1TFY A;  2WTF A;  2MAX A;  3ORY A;  8ICG A;  3WFS C;  1SKS A;  3QEB Z;  9ICN A;  3H8J A;  4RQ4 A;  2AQ0 A;  1X40 A;  2FI1 A;  3B0Y A;  2HVI A;  3K7D A;  4M6W B;  3SV4 A;  4AT7 A;  2A1J B;  1V38 A;  3KBB A;  7ICU A;  2ZH3 A;  4I2D A;  3OVS A;  3RR7 A;  5D4B A;  4EEB A;  4UB3 A;  2HBK A;  1L3T A;  3ISD A;  3PHZ A;  2DKZ A;  3PML A;  1Q46 A;  1ZQN A;  4CCH A;  4RZR A;  5AIA A;  4NL9 A;  1KKX A;  2KOB A;  5DG8 A;  3ZDC A;  3JCF A;  3ED5 A;  9ICI A;  4I27 A;  4O3Q A;  3PW4 A;  4PHA A;  4RU9 A;  5KG2 A;  2K4P A;  1L6N A;  2FCL A;  2PXI A;  3Q8P B;  8ICL A;  5DGB A;  3E2E A;  2W9C A;  1J2M A;  3WK6 A;  3MGH A;  1KEJ A;  2ZIV B;  1UEV A;  4UQG A;  2AJQ A;  2W8K A;  4YXM A;  2BPG A;  1N5W A;  4DS4 A;  8ICP A;  4CGZ A;  4M5D A;  2GA9 D;  4EX7 A;  4XQ8 A;  1L3V A;  2WAQ C;  4M9H A;  1L3S A;  5DLG A;  9ICM A;  1KDH A;  1SWW A;  5CHG A;  2EDU A;  5HR7 A;  4LZD A;  3AM9 A;  1X9X A;  2LYH A;  4WQK A;  2Z7J A;  5C5J A;  2O6K A;  4K96 A;  5J0T A;  5KFP A;  2AU0 A;  3DEE A;  1U47 A;  4F4Z A;  4RQ3 A;  4F5N A;  4GXJ A;  1ZQF A;  5T14 A;  4K4H A;  9ICG A;  3T5H A;  4CRX A;  3SZ2 A;  2W9M A;  4YR2 A;  5KFK A;  3MDC A;  4QZI A;  3RRH A;  5HRF A;  2KD1 A;  1NK8 A;  2KKV A;  3HJ1 A;  2PMZ C;  3M9O B;  2K8C B;  5TIS U;  2DFL A;  1BPE A;  4QIW C;  2K4E A;  1PK1 A;  5HC9 A;  5AKJ A;  4GXK A;  5AI8 A;  1TAQ A;  2KFN A;  2WHE A;  3WK9 A;  2ESE A;  3PZP A;  2ZXI A;  3PW2 A;  1PUZ A;  3MC1 A;  4JV2 A;  2VA8 A;  5H2F U;  8ICJ A;  4LEY A;  1S0O A;  2BPC A;  3OV7 A;  4I2I A;  2DRA A;  4PGX A;  3PX6 A;  4DSJ A;  2ZTC A;  4KM5 A;  5HRI A;  3QU9 A;  4X0A A;  2P6R A;  4PHP A;  2IMW P;  8ICH A;  3SD7 A;  5AM2 A;  4K4G A;  5KNI A;  2QKQ A;  5KFC A;  4RQ1 A;  1CI4 A;  1ZQZ A;  5B5E U;  4O5C A;  3A0B U;  4XRH A;  5DG7 A;  3NAS A;  5AK4 A;  4AYB C;  1ZQQ A;  9ICK A;  1T3Q A;  1Y88 A;  4GFJ A;  1JI7 A;  2P66 A;  5DLF A;  2JEJ A;  4BX9 C;  1ZQV A;  4ECV A;  4B9U A;  8ICB A;  3A0H U;  4DOA A;  3F53 A;  4DFP A;  2KSO A;  4I2F A;  2ZH2 A;  3LK9 A;  3AQN A;  4QW8 A;  4M9G A;  1ZQE A;  5F9L A;  4EX6 A;  1A0P A;  2Y0S F;  2ZIU B;  4N7R A;  3KKA A;  2DPJ A;  3OWG A;  1MQ2 A;  3NRZ A;  4Q8F A;  4FS1 A;  2A1J A;  4NLB A;  3CK6 A;  4F4X A;  3ISC A;  3F2C A;  4F8R A;  3QUB A;  4CF3 A;  5J0R A;  2JGA A;  2FPL A;  3RJI A;  5AKY A;  5ALT A;  1ZQK A;  2UVV A;  2XC9 A;  5JTG A;  1JMS A;  5JRT A;  2M2W A;  1YZ7 A;  1ZYQ A;  5KFI A;  3PSF A;  2B4V A;  5KFX A;  2VA2 A;  5DED A;  4I2H A;  1URJ A;  3E0F A;  1RG6 A;  4KLE A;  2HBL A;  4YD1 A;  4KX3 A;  3WK7 A;  5KT3 A;  2RHF A;  4EEL A;  4UAV A;  5HP4 A;  3SAH A;  3IHQ B;  4EEK A;  1NNL A;  2ID1 A;  1KFS A;  2G08 A;  3QU7 A;  2ATL A;  3WKB A;  3OSN A;  3N97 B;  2W43 A;  1U9L A;  2DL0 A;  3SEN A;  2KZM A;  1SXE A;  2KJ8 A;  2WF9 A;  4F5Q A;  2QAR A;  3B0X A;  3QXG A;  3AMZ A;  2JR5 A;  2K4I A;  3HIY A;  4U7C A;  4KLQ A;  4ZH4 A;  4O3R A;  5AIB A;  1CUK A;  2PKE A;  1ZOL A;  5HRB A;  4QWB A;  4YCX A;  7ICN A;  8ICC A;  3ERC C;  1O03 A;  3RR8 A;  1NZP A;  2YMQ A;  8ICQ A;  4WC2 A;  4ED3 A;  4WC6 A;  3QU2 A;  2WF5 A;  2M2V A;  3NYB A;  5CRX A;  3C5F A;  4IQV A;  4B9M A;  2AGP A;  4IR1 A;  4EBC A;  3ICX A;  3V6K A;  3PW7 A;  4UD5 A;  4P0Q B;  1FIQ A;  4J9S A;  3H8S A;  1V97 A;  1XSP A;  3HJE A;  5J2B A;  2FLN A;  4OCZ A;  4ECT A;  4EZ9 A;  4ECW A;  3TKA A;  2JHD A;  3C5G A;  1PZN A;  1VLB A;  2RP5 A;  4XQ7 A;  3CNH A;  1QH9 A;  4QZ8 A;  4B9L A;  7ICL A;  1KFD A;  3PX0 A;  4QJF B;  2K4H A;  2LKY A;  5AI0 A;  3BS7 A;  4NM2 A;  4JK1 A;  5K4L A;  4LZG A;  5ALG A;  1JN3 A;  5G5H A;  3J81 j;  3T79 A;  4DWI A;  4FH3 A;  9ICR A;  9ICS A;  1MN8 A;  1N60 A;  4YR3 A;  1QSY A;  3RJK A;  1F0M A;  3JPP A;  3QUC A;  4IC9 A;  1K1Q A;  5DBC A;  5IIO A;  4MEX A;  5L1K A;  4FO1 A;  2PFO A;  3AEV A;  4ELV A;  4RQN A;  1ZD4 A;  1JRO A;  2B0C A;  5KFF A;  9ICP A;  4QNL A;  4RQM A;  1L5U A;  2BKE A;  5J0S A;  3OVA A;  2NO4 A;  3LVW A;  2ZXH A;  7ICF A;  4NKT A;  2ZHB A;  2O5A A;  1Q8K A;  3WFR E;  2ISP A;  1FFV A;  2C2D A;  4UAR A;  4Z6E A;  1B4F A;  2MUT B;  4RQ0 A;  4KN7 A;  4DF8 A;  4NLN A;  3ALR A;  2UVU A;  1NOM A;  3OJS A;  2I5H A;  3BJY A;  2YB1 A;  2E1F A;  5J0Q A;  3HRD D;  5DB8 A;  5D46 A;  2G5H B;  1NJW A;  2IUB A;  4KLJ A;  8ICX A;  2FE9 A;  4P0Q A;  2DUY A;  4QW9 A;  3PSP A;  1QTM A;  3HPO A;  3JZ0 A;  1IIP A;  1NKE A;  5J0P A;  2XO7 A;  4E7X A;  4UBC A;  3DV9 A;  4DSF A;  3QZ8 A;  4LEW A;  1SL1 A;  4WBZ A;  3C1Y A;  3HW8 A;  1JIH A;  3RJJ A;  3IRU A;  3Q8L A;  3N4M B;  3SAF A;  3ZD9 A;  1TAM A;  1COO A;  4MFA A;  3UMG A;  4IR9 A;  1RPL A;  3C2L A;  2W3S A;  2VAN A;  5EWE A;  2KIC A;  3RB0 A;  3D2Q A;  3TFS A;  4BXO B;  4MFC A;  1UT5 A;  4JWM A;  7ICE A;  2DKX A;  4FZN A;  1WG8 A;  4LVS A;  3FC4 A;  1QLN A;  1RQL A;  3N28 A;  2R8K A;  2OYY A;  5KG4 A;  1RXW A;  3WFP A;  1LKY A;  3KKA C;  1ZXI A;  3K75 D;  3EUB 2;  3KHR A;  5B66 U;  2ASJ A;  7ICJ A;  2DGZ A;  4P4M A;  2XCA A;  2E1E A;  1NKC A;  3WFO A;  2R8J A;  5AKK A;  3KHH A;  5EOZ A;  1JQR A;  3OUY A;  2H3I A;  2ZIX B;  1KN5 A;  5D63 A;  1DXS A;  2NRK A;  1UT8 A;  3U26 A;  5E79 U;  3BZK A;  1HUO A;  3Q8R B;  5J2H A;  1CEZ A;  2VJ5 A;  3T5L A;  4A8E A;  5AM4 A;  1UA1 A;  1A6S A;  1KBU A;  9ICQ A;  3HKZ F;  4QZH A;  5DDM A;  3GIL A;  2YMM A;  4JWN A;  4RWQ A;  2KFZ A;  5CHE A;  4F3O A;  4WC4 A;  2DR7 A;  4WCW A;  1MQ3 A;  4UAT A;  3GIK A;  2BQU A;  1TK0 A;  4O69 A;  2KV2 A;  2YX8 A;  1JRP A;  5BOM A;  3MGV A;  3UM9 A;  2GOL A;  2JZB B;  4NL9 C;  4YVZ A;  1O08 A;  4BDP A;  2ES6 A;  3CP8 A;  3F2D A;  3H0M B;  5AKG A;  4Y2X A;  4KMU A;  2QLT A;  2IHM A;  3M7D A;  4ECZ A;  2LBO A;  3PST A;  4DFK A;  3WK4 A;  2LMR A;  2DF4 B;  4QWD A;  4E0D A;  4RNO A;  1WWU A;  3RFA A;  8ICU A;  5HRE A;  2C22 A;  5IIM A;  5EWF A;  1Q3U A;  2JH1 A;  1N62 A;  4C0Z A;  2ASL A;  1BNO A;  4YP3 A;  2V4Q A;  5ALM A;  4X4S A;  2AGO A;  5J2D A;  1NK6 A;  3C2K A;  4QZF A;  4K8V A;  3K1R B;  4O3O A;  3TAC B;  2N1R A;  2IA6 A;  4IRC A;  3G6Y A;  4PPX A;  2BCU A;  2PFN A;  2PFQ A;  1V85 A;  3RAX A;  2NRW A;  3I1Y A;  1U45 A;  4RWN A;  2F1H A;  4NXT A;  4O68 A;  5EE9 A;  3RBE A;  2W9C B;  4OAG A;  2ZH7 A;  3C66 A;  3M1Y A;  3QU4 A;  3ZDB A;  4NXU A;  1L8L A;  4X4T A;  5KFN A;  4I2B A;  3EWA A;  4I28 A;  9ICA A;  2ASD A;  4BUG A;  4Y2U A;  5J8Y C;  4X4V A;  4Z6F A;  7ICR A;  1Z3E B;  3C21 A;  5KT2 A;  1YLQ A;  5HRL A;  8ICT A;  5KTQ A;  4F4Y A;  2H3Q A;  4DLE A;  4GIB A;  3AQM A;  4O5E A;  2K89 A;  1SIJ A;  4ATB B;  4XUS A;  2J6T A;  1N56 A;  2HHP A;  4O3M A;  4KIT B;  3UPQ A;  4FE3 A;  2YN4 A;  3K1Z A;  1WCN A;  1S9F A;  2BCQ A;  4IQW A;  2HVH A;  4O3N A;  4S3N A;  4TUS A;  4QZ9 A;  3HWT A;  4AT8 B;  4K98 A;  2W7O A;  4JB3 A;  2KIW A;  4MHV A;  5KFD A;  5KFS A;  1UPH A;  5DQI A;  5KFZ A;  1JAJ A;  4LT6 A;  4C4T A;  3QE9 Y;  3NGD A;  2PBE A;  4YMO A;  1JX4 A;  1ZJM A;  2C28 A;  2E8P A;  1B22 A;  2KN7 A;  1SL0 A;  2BCS A;  4WH5 A;  2KSO B;  3M8S A;  2XI9 A;  1BPX A;  2ZJ8 A;  4KX5 A;  4DOB A;  2HHS A;  5HML A;  1OW5 A;  1D9D A;  1ARO P;  7ICG A;  4OAI Z;  2QB1 A;  4FBU A;  4ED1 A;  1NK0 A;  3QEA Z;  2HHW A;  2HSZ A;  2LM4 A;  4KLH A;  2LM1 A;  9ICL A;  3BZC A;  9ICW A;  2BHN A;  1TKD A;  3T3F A;  3GII A;  1NK9 A;  5J0Y A;  1V4A A;  1IXR A;  2PMZ F;  2W54 A;  4EBD A;  2FPK A;  1SKR A;  1KW4 A;  4ED2 A;  2DWQ A;  5ALN A;  1NJZ A;  1NK5 A;  4DQQ A;  4UB2 A;  4IQT A;  2HW3 A;  4DL7 A;  4WC0 A;  4DQR A;  2HMX A;  2F3N A;  1L7N A;  5EE3 A;  4RQ5 A;  5L9X A;  2PI4 A;  1ZQA A;  4LEV A;  2FMQ A;  3C18 A;  2UVW A;  1F5S A;  1N63 A;  1KL9 A;  3C1Z A;  4KLU A;  3IG5 A;  2W03 A;  5EE1 A;  4NY8 A;  4PGQ A;  2OWO A;  1J97 A;  2M0N A;  1WCL A;  1EXN A;  5KG6 A;  1LV5 A;  2JMG A;  4USA A;  5JUM A;  2KHV A;  3PVX A;  1BPB A;  4R65 A;  3GV7 B;  3BQ1 A;  4RPY A;  4PL1 A;  2NO5 A;  1MSW D;  2BPF A;  1B43 A;  5KT5 A;  3AQK A;  4F91 B;  4F5P A;  5KL8 B;  4OJL A;  5KFE A;  3NVO A;  3IM1 A;  5KFH A;  2KK0 A;  4NXV A;  4EV6 A;  1ZQG A;  1HJP A;  2NRT A;  2KP7 A;  2HCF A;  2G5I B;  2Y0S C;  4GC6 A;  2H3Z A;  4J9L A;  3D2N A;  1TFR A;  4HX0 A;  4PHD A;  3MR5 A;  1D9F A;  3KTQ A;  1Q79 A;  5DB7 A;  4YD2 A;  4E80 A;  1S0V A;  3R9K A;  1VJ7 A;  3WU2 U;  3AN1 A;  4GXI A;  2KTQ A;  3RF9 A;  3MCR A;  2BBJ A;  2H3V A;  4KB6 A;  1MIV A;  2ZIW B;  4FH5 A;  3PR4 A;  2MUT A;  2O1P A;  2EZY A;  2ISO A;  7ICI A;  5AM3 A;  2ZUB A;  3ETL A;  4YR0 A;  1PK3 A;  2C2E A;  4RQ6 A;  1IM4 A;  5KFB A;  5AI5 A;  3DDH A;  1BGX T;  5IIK A;  4ED0 A;  1J2N A;  3NS1 A;  1D8L A;  2VA3 A;  4WC7 A;  2ZTE A;  1RM6 C;  1ED1 A;  4K97 A;  3EPI A;  4IRK A;  5KFA A;  2YB4 A;  3SR6 A;  5AKL A;  2V4R A;  4YQW A;  4DL3 A;  5CFS A;  3JYY A;  2F8L A;  2G0A A;  1RYR A;  4X4R A;  4AP9 A;  1DOQ A;  1ZRM A;  2K8B B;  4F72 A;  3B9J A;  3MAB A;  5DBA A;  3L3F X;  2P6U A;  2WAQ F;  1ZQH A;  3RJH A;  4DL2 A;  4R8U A;  4F4W A;  2JEF A;  5J2G A;  4KLO A;  3WK8 A;  1KSP A;  8ICK A;  3SMV A;  4ED8 A;  4M9N A;  5HRH A;  1Z1B A; 
#chains in the Genus database with same CATH homology
 4KLJ A;  4J9R A;  5DG9 A;  8ICX A;  4KN4 A;  4AT7 B;  4P4P A;  7ICH A;  4QW9 A;  4YG2 A;  4YFK A;  4UAW A;  1QTM A;  3HPO A;  4ECS A;  4O0I A;  3GDX A;  5F2V O;  4BXO A;  3OVB A;  4RNM A;  5HHI A;  9ICF A;  3RB4 A;  5KFW A;  4IG8 A;  3JZ0 A;  1T3N A;  2I9G A;  2XY7 A;  3SYZ A;  1NKE A;  9ICT A;  5J0P A;  2XO7 A;  2J6S A;  3GIJ A;  3RJE A;  1R8C A;  4E7X A;  4UBC A;  1V9P A;  4RQ8 A;  1ZQP A;  4NLZ A;  4J9P A;  3C2M A;  2ZJA A;  3QZ8 A;  2KZ3 A;  4DSF A;  2V9W A;  2ZH5 A;  3M8R A;  1SL1 A;  4WBZ A;  2DRB A;  4ECQ A;  3V6J A;  2BE3 A;  3C1Y A;  4RPZ A;  2XCP A;  1NJY A;  3OGU A;  3HW8 A;  1JIH A;  3JPR A;  1ZET A;  1ZQW A;  3ZDA A;  3RJJ A;  3Q8L A;  5IIN A;  4I29 A;  4AT9 B;  5DQH A;  3TQ1 A;  5J2K A;  3N4M B;  3HJ4 A;  3ZD9 A;  5KT4 A;  4ELU A;  5KT6 A;  1COO A;  5CWR A;  4MFA A;  5KT7 A;  4ECR A;  1DK3 A;  3RRG A;  4UD4 A;  4IR9 A;  1RPL A;  4R63 A;  3C2L A;  1PX5 A;  4R64 A;  2VAN A;  5EWE A;  4DFJ A;  3RB0 A;  1JXL A;  3TFS A;  4QZD A;  4TQR A;  4BXO B;  4I2A A;  4MFC A;  1UT5 A;  2NRZ A;  3TI0 A;  4JWM A;  4MFF A;  8ICR A;  3EW9 A;  2BQR A;  7ICE A;  4RWO A;  3PW0 A;  4LVS A;  7ICK A;  7ICO A;  1R89 A;  1QLN A;  4RWP A;  2ZH9 A;  2FPM A;  2R8K A;  4KLL A;  1TV9 A;  5KG4 A;  1RXW A;  2DR8 A;  3WFP A;  1MIY A;  2BQ3 A;  1ZQI A;  3UXP A;  3K75 D;  2HHV A;  4X4T A;  2HHQ A;  4MF8 A;  3KHR A;  4R66 A;  2ASJ A;  4I2J A;  3PMN A;  7ICJ A;  3GV5 B;  2M2T A;  2ZH6 A;  4F92 B;  7ICV A;  3H3A A;  4P4M A;  4AT9 A;  3JPQ A;  2ZUC A;  5J0W A;  2XCA A;  1X9M A;  1ZQR A;  5IIJ A;  4QZA A;  3HP6 A;  1NKC A;  4R8U B;  2NRV A;  1U4B A;  2FMP A;  3WFO A;  2R8J A;  4FHY A;  5D49 A;  3KHH A;  3EPG A;  1TFY A;  5EOZ A;  2WTF A;  2MAX A;  3ORY A;  4TQS A;  8ICG A;  1SKS A;  1L3U A;  2AQ4 A;  3QEB Z;  7ICT A;  1JQR A;  3OUY A;  9ICN A;  4P2H A;  3H8J A;  1XC9 A;  4RQ4 A;  2AQ0 A;  2ALZ A;  3B0Y A;  1XSL A;  1N48 A;  3RAQ A;  4M6W B;  2HVI A;  5DB9 A;  3SV4 A;  1A77 A;  4F50 A;  4AT7 A;  2NRK A;  2A1J B;  1UT8 A;  2ZH4 A;  4DS5 A;  4F5R A;  4J9M A;  2DR9 A;  7ICU A;  1HUO A;  3Q8R B;  2ZH3 A;  4I2D A;  5KFU A;  5J2H A;  3V7J A;  5D4B A;  1BPY A;  1TK8 A;  3RR7 A;  4F2S A;  1CEZ A;  4UB3 A;  3AU6 A;  3T5L A;  3MR3 A;  1L3T A;  3HIY A;  3ISD A;  1WOT A;  4X5V A;  2HHU A;  4RUC A;  1UA1 A;  4J9Q A;  3PML A;  4FHX A;  1UA0 A;  3PO4 A;  3PX4 A;  4I2E A;  1ZQN A;  2XY5 A;  1ZQO A;  4CCH A;  4RZR A;  5DB6 A;  3GQC A;  2BCV A;  9ICQ A;  3AUO A;  1SKW A;  4QZH A;  2H5X A;  4P4O A;  7ICM A;  3NTU A;  5DG8 A;  3ZDC A;  5DDM A;  3GIL A;  3H40 A;  4F2R A;  4I27 A;  9ICI A;  1H38 A;  4O3Q A;  2JEG A;  3PW4 A;  4JWN A;  4PHA A;  4RU9 A;  4RWQ A;  5KG2 A;  1S0N A;  3SI8 A;  4DLG A;  2IHN A;  3FYH A;  2W9B A;  1S77 D;  2KFZ A;  2PXI A;  3G6V A;  1KRP A;  4F3O A;  2XGQ A;  5HRK A;  2ZJ5 A;  4FHV A;  4WC4 A;  3Q8P B;  3MR6 A;  5L1J A;  8ICL A;  5DGB A;  1X9W A;  1MQ3 A;  4C8M A;  3E2E A;  4WCW A;  2DR7 A;  4M9L A;  2W9C A;  3UXN A;  3HT3 A;  4KTQ A;  5J2F A;  1VFG A;  3MGH A;  3GIK A;  1KEJ A;  1UEV A;  5J2J A;  2ZUD A;  2BQU A;  4YMM A;  1TK0 A;  4UQG A;  5HRG A;  2AJQ A;  2W8K A;  4EBJ A;  4YXM A;  4C8L A;  1TVA A;  2BPG A;  1FA0 A;  1T4G A;  5BOM A;  4DS4 A;  4I2C A;  4KLD A;  4EYI B;  3OSP A;  4O3S A;  8ICP A;  2JZB B;  4M5D A;  3HX0 A;  4YVZ A;  4BDP A;  4X4O A;  1XS9 D;  2PI5 A;  1ZQJ A;  4XQ8 A;  1L3V A;  4TUQ A;  5IIL A;  4M9H A;  1L3S A;  8ICN A;  1F5A A;  5DLG A;  9ICM A;  4GLX A;  1KDH A;  4X4Q A;  4M6W A;  4KMU A;  5DDY A;  2IHM A;  5CHG A;  4ECZ A;  5KFO A;  4DFK A;  9ICH A;  4LZD A;  2LYH A;  1MIW A;  4NLG A;  5III A;  5C5J A;  1NO5 A;  4QWD A;  3M9N B;  4E0D A;  5J0T A;  5KFP A;  2AU0 A;  4DSK A;  4RNO A;  4DSI A;  3LWM A;  1U47 A;  5HRD A;  4F4Z A;  8ICU A;  3GV8 B;  4EP7 A;  4RQ3 A;  4F5N A;  2C22 A;  1T8E A;  5HRE A;  4GXJ A;  1ZQF A;  5IIM A;  5EWF A;  3TAR A;  4K4H A;  9ICG A;  3T5H A;  3M9M B;  5CR0 A;  2ASL A;  2HHX A;  3SZ2 A;  1BNO A;  4YP3 A;  2W9M A;  5J2I A;  4YR2 A;  5KFK A;  2V4Q A;  1S97 A;  3MDC A;  3PW5 A;  5F9N A;  4QZI A;  3RRH A;  4ECX A;  5HRF A;  1NK8 A;  4X4S A;  9ICJ A;  2I1Q A;  2AGO A;  3HJ1 A;  5J2D A;  4EEY A;  1NK6 A;  4QWA A;  3M9O B;  4K4I A;  1ZQY A;  3C2K A;  2DFL A;  1BPE A;  4QZF A;  4JUZ A;  4Z6D A;  4DO9 A;  4O3O A;  4GXK A;  5HC9 A;  3H4D A;  4X0B A;  2IA6 A;  2FLP A;  3OUY B;  1TAQ A;  4IRC A;  2KFN A;  3G6Y A;  4PPX A;  2BCU A;  3BQT A;  3UQ2 A;  2PFN A;  1TFW A;  5EWG A;  3PW2 A;  5KG3 A;  2PFQ A;  3MDA A;  2J6U A;  5DKW A;  3RAX A;  2NRW A;  4F4K A;  4JV2 A;  8ICE A;  3JPS A;  3TFR A;  1U45 A;  4RWN A;  2F1J A;  2VA8 A;  8ICJ A;  2F1H A;  2XGP A;  5HMM A;  1S0O A;  2BPC A;  4J9O A;  4DF4 A;  3RBE A;  2BR0 A;  3PNC A;  2W9C B;  1U49 A;  3OV7 A;  5KG7 A;  4I2I A;  5J0O A;  4PGX A;  3C66 A;  4QZE A;  3PX6 A;  3ZDB A;  4DSJ A;  2ZH7 A;  2DRA A;  2ZTC A;  3K4G A;  4QZC A;  4NXZ A;  3KHL A;  3MGI A;  4KLF A;  9ICO A;  5KFN A;  5HRI A;  4X0A A;  1BPZ A;  2P6R A;  4I2B A;  4ED7 A;  4NM1 A;  3C23 A;  3OHA A;  3EWA A;  3BDP A;  4I28 A;  4X4N A;  4PHP A;  4M47 A;  2IMW P;  1RYS A;  2ASD A;  9ICA A;  8ICH A;  4DL5 A;  4K4G A;  4X4V A;  1ZQL A;  8ICW A;  4Z6F A;  1ZQM A;  3ISB A;  5KFC A;  3THV A;  3LDA A;  5TZV A;  4RQ1 A;  7ICR A;  4EBE A;  1ZQZ A;  4RT3 A;  1Z3E B;  3C21 A;  5KT2 A;  3QZ7 A;  3JPT A;  8ICY A;  4YXJ A;  1BVS A;  5J2A A;  3UPS A;  4O5C A;  2IBK A;  1YLQ A;  3JPN A;  4RQ7 A;  4XRH A;  5DG7 A;  5HRL A;  8ICT A;  4O5K A;  1ZQQ A;  5KTQ A;  9ICK A;  1S76 D;  3TAP A;  1Y88 A;  5KG5 A;  4F4Y A;  4MF2 A;  1KNY A;  8ICO A;  2P66 A;  4DLE A;  3AQM A;  1ZQD A;  5KG1 A;  5DLF A;  4O5E A;  4ATB B;  1RXV A;  4XUS A;  2JEJ A;  4UB4 A;  1U48 A;  2J6T A;  1BNP A;  1N56 A;  1ZQV A;  4ECV A;  2HHP A;  4B9U A;  3LWL A;  8ICB A;  3PY8 A;  4DOA A;  4KIT B;  3UPQ A;  4DQP A;  4DFP A;  2JEI A;  4I2F A;  4Q43 A;  4ECU A;  4QWC A;  3LK9 A;  2R8G A;  8ICM A;  1KFT A;  4NLK A;  4QW8 A;  3AQN A;  2ZH2 A;  4M9G A;  7ICP A;  9ICV A;  4Q44 A;  1LB2 B;  1WCN A;  4UAY A;  1S9F A;  1ZQS A;  2BCQ A;  5KFM A;  4IQW A;  1X2I A;  4FS2 A;  1ZQE A;  5F9L A;  2HVH A;  4O3N A;  4EYH B;  4FBT A;  4DQS A;  4S3N A;  4TUS A;  2R8H A;  4QZ9 A;  3HWT A;  4DL4 A;  9ICE A;  5HNK A;  3V6H A;  2ZTD A;  4AT8 B;  4RT2 A;  4UBB A;  2FLL A;  2DPJ A;  2PFP A;  1DGS A;  1MQ2 A;  5DQG A;  4O9M A;  5J29 A;  4Q8F A;  3H37 A;  4FS1 A;  4AT8 A;  2A1J A;  5KFD A;  4F4X A;  2KZZ A;  2F1I A;  5KFS A;  3ISC A;  1KLN A;  1XO1 A;  4F8R A;  4BGD A;  5DQI A;  1ZQB A;  2DR5 A;  3RJF A;  4X4P A;  5KFZ A;  1JAJ A;  5J0R A;  5KFJ A;  4LT6 A;  3QE9 Y;  3NGD A;  4PH5 A;  2FPL A;  4YMO A;  5L1L A;  3ZDD A;  2PBE A;  3RJI A;  1JX4 A;  1ZJM A;  2C28 A;  4RPX A;  1ZQK A;  2UVV A;  4Z6C A;  4F93 B;  5HHH A;  2XC9 A;  5L1I A;  1ZJN A;  7ICQ A;  1JMS A;  4X4U A;  8ICS A;  1B22 A;  2KN7 A;  4Q8E A;  4G3I A;  1SL0 A;  1S0M A;  2BCS A;  1JXE A;  4I2G A;  1ZYQ A;  2BGW A;  4QZB A;  3M8S A;  1SL2 A;  5KFI A;  1BPX A;  8ICI A;  2ZJ8 A;  4DSE A;  4WC5 A;  5KFX A;  4DOB A;  4KLI A;  4J9N A;  1ZQC A;  5HML A;  4GC7 A;  3Q8M A;  2VA2 A;  1D9D A;  2HHS A;  5DED A;  1T7P A;  4DL6 A;  4KLG A;  4I2H A;  2M9N A;  1ARO P;  1XWL A;  1ZQX A;  7ICG A;  4TUR A;  4FBU A;  1NKB A;  4ED1 A;  4KLE A;  4J9K A;  1NK0 A;  2NRX A;  3QEA Z;  3Q8K A;  2HHW A;  3GFK B;  3OHB A;  4YD1 A;  4KLH A;  3Q8Q B;  9ICL A;  1R8B A;  5KT3 A;  9ICW A;  3EZ5 A;  2BHN A;  1TKD A;  4F5O A;  3T3F A;  5HP4 A;  3IHQ B;  3GII A;  1NK9 A;  5J0Y A;  4KLT A;  5KFV A;  2ID1 A;  4B9V A;  1V4A A;  1IXR A;  4BWJ A;  3T5J A;  1S10 A;  3H8W A;  3MFH A;  4FO6 A;  1KFS A;  4ATB A;  2ATL A;  4EBD A;  2FPK A;  1SKR A;  3OSN A;  3N97 B;  3RJG A;  1U9L A;  3V7L A;  4ED2 A;  2KZM A;  4F5Q A;  3LQC B;  3B0X A;  1ZQT A;  2C2R A;  2RDJ A;  1NJZ A;  4YN4 A;  4EZ6 A;  3KHG A;  3RB3 A;  1NK5 A;  4M0A A;  4DQQ A;  4UB2 A;  4RUA A;  4DEZ A;  2XY6 A;  9ICC A;  4KLQ A;  4ZH4 A;  4O3R A;  4Q45 A;  1CUK A;  9ICU A;  2M2W A;  4IQT A;  4FHW A;  5HRB A;  4QWB A;  3RTV A;  2FMS A;  2HW3 A;  4YCX A;  5KFQ A;  1RZT A;  7ICN A;  4DL7 A;  1XSN A;  4EBK A;  4QWE A;  4TUP A;  4B9N A;  8ICC A;  2HHT A;  4WC0 A;  4KLM A;  4DQR A;  4RQ5 A;  5L9X A;  3RR8 A;  3RH4 A;  8ICQ A;  2PI4 A;  1NZP A;  3FDS A;  3Q8S B;  1ZQA A;  5CP2 A;  1UET A;  4WC2 A;  5CJ7 A;  2FMQ A;  3C18 A;  4ED3 A;  5J0U A;  3RBD A;  2UVW A;  3C1Z A;  4WC6 A;  2B21 A;  2M2V A;  1DK2 A;  1SZP A;  2RFF A;  3NYB A;  3ZDE A;  4KLU A;  3C5F A;  4IQV A;  1TK5 A;  3WFQ E;  2RDI A;  3RH6 A;  4B9M A;  4DSL A;  4NKU A;  4ECY A;  4WC3 A;  3H4B A;  2AGP A;  4IR1 A;  4EBC A;  4NY8 A;  1K1S A;  4PGQ A;  3V6K A;  3PW7 A;  2OWO A;  4E8F A;  4UD5 A;  1NK7 A;  1WCL A;  1EXN A;  5KG6 A;  2ZH1 A;  5J0X A;  1LV5 A;  4J9S A;  2UVR A;  5JUM A;  3H8S A;  3PVX A;  1BPB A;  1ZQU A;  1R8A A;  4R65 A;  1XSP A;  4B9T A;  3GV7 B;  5J2B A;  3BQ1 A;  3JPO A;  2FLN A;  4B9S A;  1A76 A;  4RPY A;  4ECT A;  1MSW D;  8ICA A;  2BPF A;  4JV0 A;  1B43 A;  4EZ9 A;  8ICV A;  5KT5 A;  3ZD8 A;  4UB5 A;  4F91 B;  3C5G A;  1PZN A;  4ECW A;  3AQK A;  3SV3 A;  4F5P A;  4UB1 A;  1BPD A;  4XQ7 A;  3AQL A;  5CA7 A;  5KFE A;  1C7Y A;  3IM1 A;  2R8I A;  5HR9 A;  9ICX A;  3MBY A;  5KFH A;  4QZ8 A;  7ICS A;  4B9L A;  3L9D A;  7ICL A;  1KFD A;  3PX0 A;  3PO5 A;  1ZQG A;  1HJP A;  2NRT A;  3T5K A;  2KP7 A;  3H7I A;  5KFL A;  5KFR A;  4WC1 A;  4RNN A;  1Q78 A;  4NM2 A;  4GC6 A;  4M2Y A;  4J9L A;  2DVI A;  1QSS A;  1TFR A;  4JK1 A;  4PHD A;  3MR5 A;  1D9F A;  4LZG A;  1JN3 A;  2W8L A;  3KTQ A;  1Q79 A;  5DB7 A;  1XU4 A;  1OU5 A;  3OVS A;  4YMN A;  4YD2 A;  3MFI A;  3TAQ A;  4DWI A;  1TAU A;  4IRD A;  5KFY A;  4DQI A;  4E80 A;  4FH3 A;  1S0V A;  1VJ7 A;  4GXI A;  9ICR A;  9ICS A;  2KTQ A;  2W9A A;  4YR3 A;  1X9S A;  4HYK A;  1QSY A;  4XA5 A;  3RJK A;  4ED6 A;  5KFT A;  3BQ2 A;  3BQ0 A;  4C8K A;  3V72 A;  1MIV A;  1MC8 A;  3JPP A;  4FH5 A;  3PR4 A;  3TAN A;  2MUT A;  4WBY A;  1K1Q A;  2JZB A;  4C8N A;  4M04 A;  5KG0 A;  5DBC A;  5IIO A;  4MEX A;  3RH5 A;  2O1P A;  5L1K A;  2ISO A;  2Q0Z X;  1HUZ A;  2PFO A;  7ICI A;  4ELV A;  1Z00 B;  2ZUB A;  3ETL A;  4MEY A;  4YR0 A;  1D8Y A;  2GWS A;  4RQ2 A;  1NJX A;  1QSL A;  2C2E A;  5KFF A;  4RQ6 A;  4DOC A;  9ICP A;  1IM4 A;  3WFS C;  5KFB A;  4PHE A;  5IIK A;  1BGX T;  4QZG A;  5BPC A;  4ED0 A;  3UQ0 A;  4UAZ A;  1D8L A;  1L5U A;  2BKE A;  2ZTE A;  5J0S A;  3EYZ A;  3UXO A;  2VA3 A;  4WC7 A;  3OVA A;  2Y1I A;  3EPI A;  8ICF A;  4IRK A;  2DPI A;  4M9J A;  5KFA A;  2M2U A;  3V7K A;  4KLS A;  7ICF A;  4NKT A;  5BOL A;  5DGA A;  2ZHB A;  2O5A A;  1UEU A;  2V4R A;  4O3P A;  4YQW A;  1KTQ A;  4DL3 A;  3JYY A;  2W9B B;  3WFR E;  2ISP A;  4BWM A;  4PGY A;  3PV8 A;  4DFM A;  3GIM A;  2C2D A;  1RYR A;  3H39 A;  5DEC A;  4X4R A;  1DOQ A;  2ZHA A;  5CB1 A;  2Y1J A;  4Z6E A;  3AU2 A;  2BCR A;  2MUT B;  4RQ0 A;  4JV1 A;  4KN7 A;  4DF8 A;  3MAB A;  5DBA A;  3OJU A;  2Q66 A;  3RB6 A;  4NLN A;  3RJH A;  2P6U A;  2AGQ A;  1ZQH A;  4IQU A;  3MR2 A;  4DL2 A;  1NK4 A;  2BDP A;  2UVU A;  1Z00 A;  4R8U A;  5DBB A;  1NOM A;  3OJS A;  4F4W A;  2JEF A;  3BJY A;  3G6X A;  5J2C A;  4C8O A;  5J2G A;  5J0Q A;  4KLO A;  4FHP A;  9ICB A;  3H38 A;  5DB8 A;  1KSP A;  5D46 A;  8ICK A;  2ZH8 A;  5J2E A;  4ED8 A;  4M9N A;  1NJW A;  8ICZ A;  4ELT A;  5HRH A;  5KFG A;  3PR5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...