4PHEA

Structure of human dna polymerase beta complexed with t in the template base paired with incoming non-hydrolyzable gtp
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
329
structure length
325
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase,lyase/dna
molecule keywords DNA polymerase beta
publication title The spontaneous base substitution mechanisms of human DNA polymerase beta
rcsb
source organism Homo sapiens
total genus 107
structure length 325
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2014-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4pheA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4pheA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4pheA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4pheA03
3Q8LA 3JPNA 1SKRA 1RPLA 4ELUA 4ED3A 4X4PA 1WCNA 4NLZA 8ICKA 2JZBB 5F9LA 4F5PA 3RTVA 4QZFA 5CB1A 4O9MA 5KT4A 9ICOA 4DL6A 9ICWA 7ICSA 3EPGA 5KG7A 4I27A 4DSKA 2ZH2A 4GXIA 4Z6DA 7ICNA 3TQ1A 1X9SA 3ISCA 4TQSA 4YXJA 4EYHB 4RQ2A 4KLUA 5DLGA 5DBCA 4DQSA 2M2WA 3JPOA 1RXWA 4M2YA 3KTQA 4J9SA 5HRDA 3RB0A 9ICGA 3QEBZ 1ZJMA 2XCAA 1D8YA 3H37A 2DR7A 2W9BA 4UB5A 3AUOA 3V72A 3QE9Y 2VA3A 1SL0A 5D46A 5KFOA 3AU6A 3M8RA 1X9MA 4O3RA 9ICBA 4R65A 5HHHA 4EBJA 1U45A 2NRTA 5DQGA 2R8GA 5J29A 5HRHA 1OU5A 5KFGA 5KFNA 5KFTA 4YR0A 4I2JA 1U49A 1SKSA 5J0SA 1S97A 3JPTA 1NJWA 4LZGA 3MR6A 3H7IA 1TFRA 4J9PA 2HHWA 3HW8A 3PW7A 3RJJA 4P4MA 4HYKA 3PV8A 2IHMA 3UXOA 5KFDA 4CCHA 4R66A 4WCWA 1ZETA 3MBYA 9ICRA 2XGPA 1V4AA 1B43A 1TAUA 4KLSA 3C2KA 9ICTA 5J0WA 4TUSA 5JUMA 4RPZA 5J2EA 1TK5A 1T7PA 9ICKA 1ZQGA 4Z6FA 5HNKA 1S0NA 3LQCB 1NKCA 1Q79A 4YD1A 3H4DA 8ICZA 2BE3A 1NK8A 3HX0A 2PFNA 4YCXA 2W9CA 2ASLA 4M9GA 4DOCA 1BNOA 4E7XA 4X4RA 2AJQA 1N56A 9ICUA 4X4SA 2J6SA 5KFJA 2Y1JA 5KFFA 2AQ0A 4ED0A 2VA8A 2ZUCA 4RNNA 3C5GA 3RR7A 4QWDA 4I29A 4ED6A 1HUOA 1XWLA 5KFSA 4RQ1A 4QZIA 5HMLA 5KFUA 3SV3A 2OWOA 3PX6A 4NKTA 3B0XA 4DLEA 1L3SA 4S3NA 4IQTA 2R8IA 1H38A 5DDYA 1KDHA 4GLXA 7ICLA 2W9MA 3RB6A 4O3NA 2UVRA 4F4YA 3SV4A 1U48A 4BDPA 1ZQHA 5HC9A 4NKUA 9ICCA 4GC7A 4QZBA 4KLOA 1L3TA 4KLIA 5KG2A 4X0AA 3C66A 1ZQXA 4IRDA 7ICPA 1ZQVA 5J2HA 1L5UA 4PGQA 1X2IA 2W8KA 4FH5A 1ZJNA 4YQWA 3RH5A 5IIKA 4DWIA 3HWTA 1NK0A 9ICSA 5J2DA 2F1IA 5KG1A 4YN4A 4ECWA 2J6UA 3JZ0A 5KFIA 2JEFA 4I2GA 4RQ5A 1R89A 5HR9A 5EWFA 5J0OA 3NYBA 4FBUA 2C28A 3BQTA 5J2AA 3MR3A 1QSSA 4F2SA 3BJYA 4B9MA 4EZ6A 2HHSA 1L3UA 5KFAA 5BOLA 4NM2A 4DQIA 4KLMA 4YVZA 3UQ0A 4UB1A 8ICCA 4O3QA 5HRFA 3H8JA 7ICQA 5L1IA 3RJKA 3M9MB 4J9LA 1DGSA 4TUPA 2O1PA 4RUAA 1ZQPA 3V7KA 5F9NA 1S76D 4FHVA 2MUTA 2BQRA 5KFWA 2V4RA 4F5OA 3OGUA 3EZ5A 2C2RA 2IMWP 4I2FA 3RAXA 2KTQA 4RPXA 4YP3A 4DFMA 2ASDA 4YMNA 4ED2A 4E80A 9ICVA 4PPXA 4UQGA 1TVAA 4QZAA 4F4KA 5KFXA 4IG8A 5L1JA 2XY7A 1T4GA 4NLKA 4AT8B 4Q43A 4EBKA 3C2MA 4B9LA 2NRZA 4QZDA 3BQ1A 2C22A 4MFCA 1KFTA 2XCPA 3GIKA 3RH4A 4JK1A 3OSNA 7ICUA 5HRBA 2V4QA 1LV5A 2HHPA 4RZRA 5DGAA 4KLGA 4YR2A 3KHLA 1HJPA 4B9UA 3Q8MA 4UD5A 5IILA 5BPCA 5DGBA 7ICTA 5DBBA 2ISOA 5DB6A 3BDPA 3AQNA 1D9DA 5IIMA 3C2LA 3N4MB 3WFQE 4Q44A 1F5AA 1NK4A 4DL7A 3G6YA 5HHIA 1RXVA 4M04A 5HRLA 5J0UA 2M9NA 3PW5A 1FA0A 4RPYA 2ASJA 1KFSA 4PHDA 1UT5A 2ID1A 4KLHA 1A77A 4Z6EA 4RNMA 4BXOB 4JV0A 1KFDA 1AROP 5J0YA 1NK9A 2FMQA 3RJGA 4G3IA 3MABA 3UPQA 4EZ9A 4WC3A 1BPZA 4R8UB 5KG6A 3QEAZ 9ICNA 3H3AA 8ICTA 2BCQA 4ATBA 4RQ3A 3K4GA 4NY8A 1MSWD 2NRVA 4XUSA 3ETLA 4RU9A 2ZH5A 3PR5B 3QZ8A 3LWMA 2AU0A 4F4WA 2NRXA 5KTQA 2ZJ8A 4ECTA 4P4OA 3GV8B 8ICMA 5DECA 3ZDDA 4FBTA 1TAQA 1DK2A 4DSFA 3PO4A 2FLPA 4J9QA 1JXLA 1K1SA 5IINA 3C1ZA 1NK5A 4M9NA 1MIYA 2PBEA 5DB7A 1XSPA 5EWGA 4ECUA 1VJ7A 1ZQYA 4ED8A 2VA2A 2HHQA 4B9VA 1D9FA 2BCUA 4IR1A 2JEJA 2FPKA 3GDXA 5J2JA 1BNPA 2DFLA 5L1LA 4F3OA 8ICJA 2KFZA 3NGDA 1ZQEA 5KFBA 2FMPA 2JEIA 4DOBA 2DR9A 9ICPA 2B21A 2H5XA 1Z00A 2ZTEA 3V6HA 4DL2A 2BGWA 5CHGA 2R8HA 3UXNA 5J0PA 4FO6A 5J0RA 3RB3A 1S10A 4XQ8A 1RYRA 3V6JA 4DQRA 3RB4A 3OSPA 1ZQBA 3ZDAA 8ICNA 2P6RA 5HP4A 4AT9B 4X4QA 8ICVA 5KFLA 4RQ4A 4X5VA 4J9KA 7ICIA 2F1JA 3SYZA 1R8BA 4F50A 4WC0A 4F91B 3NTUA 3RJHA 3RR8A 2RDIA 4GXKA 1MIWA 4ED7A 8ICEA 4KLLA 3C18A 1B22A 3LDAA 4PGXA 3E2EA 1UA0A 3HJ1A 1MC8A 4ZH4A 3WFPA 2RDJA 4DSEA 4IQWA 4JV1A 8ICBA 4X4UA 4DL3A 4KLTA 2HW3A 4F92B 3ZDEA 2JEGA 8ICYA 2DVIA 2HHVA 4UD4A 1UT8A 2XGQA 2BHNA 4YG2A 5KT6A 4PHAA 2BPGA 4QW9A 1KEJA 1NJYA 4I2AA 7ICGA 4UB4A 1KSPA 2W9AA 3AQMA 1SL2A 3RRGA 4WBZA 2JZBA 4YXMA 4KN7A 4QZ9A 3OVSA 3KHRA 4Q45A 9ICJA 4JWNA 4WC4A 3JPSA 2ATLA 1DK3A 2UVVA 4AT7B 5HREA 2BKEA 5EWEA 3EYZA 8ICOA 2A1JB 2BCVA 8ICQA 4K4HA 1BGXT 2Q0ZX 3PVXA 1UETA 4RWPA 1ZQFA 4F93B 1NZPA 5HRIA 4J9NA 3EWAA 5KFQA 3MR5A 3LK9A 1ZQRA 4K4GA 5CR0A 4GXJA 4RWNA 4F2RA 4DEZA 3TANA 2VANA 1Z3EB 3Q8RB 4DFPA 4I28A 2KP7A 2M2VA 1S77D 3Q8KA 1U47A 4ECVA 3PX4A 4DO9A 8ICWA 2HHUA 3H8WA 1T3NA 5J2KA 4QZHA 4NLNA 4UBBA 4R63A 1NJXA 1NOMA 4IRKA 1KRPA 1BPDA 4WC2A 1XU4A 4EEYA 3M9NB 4FHYA 4RQ7A 4DL5A 1ZYQA 2J6TA 4WC7A 4J9RA 4M6WB 3GV7B 4LT6A 4K4IA 4MF8A 2ZH7A 3GFKB 3TARA 3M9OB 2NRKA 4WC6A 4UB3A 1ZQKA 4DQQA 1N48A 4PHEA 4DOAA 1ZQJA 3OJUA 2BDPA 8ICPA 4RT3A 8ICAA 9ICIA 3IM1A 2F1HA 9ICEA 4IQVA 2AGPA 2KN7A 1PX5A 4YMMA 3OHAA 1BPXA 3QZ7A 2BPCA 2ZH8A 5DG7A 4UBCA 1JQRA 1XC9A 4C8NA 4KLQA 3K75D 1U4BA 1MQ3A 3RBDA 5KT2A 2ZUBA 5DEDA 1S9FA 7ICFA 4PH5A 5J2CA 3Q8QB 3M8SA 5TZVA 4ECQA 3N97B 3PW4A 2DRAA 1ZQCA 2I9GA 2DR5A 2PI4A 1JXEA 5D49A 3C1YA 4DFJA 2KZZA 1NKEA 4MFFA 4X0BA 3OVAA 4WBYA 1COOA 3C23A 1KTQA 5KT7A 4EBDA 3MDCA 3UQ2A 4ELTA 4Q8EA 1Q78A 3WFSC 3JPQA 1PZNA 4NXZA 2V9WA 1CEZA 1ZQTA 4YMOA 4DFKA 1BPYA 2HHTA 1S0MA 3AQLA 4KITB 1ZQMA 1ZQUA 4M0AA 2BQ3A 1DOQA 3T5KA 2AGOA 2UVUA 2R8KA 3RBEA 4KLDA 3OV7A 2DRBA 1UA1A 5KFPA 1MIVA 4BWMA 4ECXA 1Y88A 4TURA 2Q66A 4BWJA 2P66A 2R8JA 1NJZA 5D4BA 1KLNA 4M9JA 1ZQNA 4B9NA 4F8RA 4DLGA 2HVIA 9ICQA 1R8CA 1NO5A 7ICKA 4M5DA 1QLNA 3V7LA 5DQIA 3T5JA 3TFSA 4ECRA 3AQKA 4M9LA 3ZD8A 5KT5A 1SKWA 4O5KA 4WC5A 2LYHA 5KFEA 1D8LA 3C21A 4FS1A 3RJIA 3HIYA 2ZH4A 2W9CB 3GQCA 3EPIA 4LVSA 1NK6A 1TFYA 5DQHA 4RWOA 3HPOA 3FDSA 2O5AA 2Y1IA 2XC9A 3Q8SB 4KLEA 4F5RA 3OHBA 2ZH9A 4QW8A 3MFIA 2IBKA 8ICIA 4QWEA 4IR9A 4X4NA 1JMSA 1XSLA 4WC1A 5DG9A 5KFYA 5L1KA 1R8AA 5BOMA 5KT3A 4Q8FA 2IHNA 4I2DA 5KG4A 3H4BA 8ICHA 4MFAA 2ZHAA 4NM1A 4PGYA 4LZDA 2XY5A 1NKBA 4O5EA 5HRGA 4QWCA 3GIIA 4F4XA 3PW2A 3SI8A 3RJFA 2BR0A 2ZUDA 3MGIA 4FHPA 2DPJA 4AT8A 1ZQWA 1QSYA 1TFWA 2KZMA 4X4VA 3V7JA 5HRKA 2BCRA 5DDMA 4KTQA 5J2FA 4C8KA 4O3SA 4QZGA 7ICJA 2PI5A 2KFNA 3PMLA 3H38A 4FH3A 5C5JA 5KFRA 3TFRA 3PO5A 4FS2A 8ICRA 1WOTA 2MAXA 4UAYA 5DLFA 1XSNA 8ICFA 2AGQA 4QZEA 4F5QA 3MDAA 4I2HA 5DKWA 1K1QA 4DF8A 3ZDBA 1VFGA 1ZQIA 1ZQOA 3JPRA 3KHHA 3UXPA 1CUKA 3BQ0A 4X4TA 4JUZA 1ZQLA 1JN3A 2IA6A 4X4OA 3GV5B 5KFMA 3PR4A 7ICHA 3OJSA 4J9OA 4DS4A 4ELVA 4E0DA 4BXOA 2BPFA 4I2BA 2XY6A 4M47A 3H39A 5J0TA 4ECZA 7ICVA 2MUTB 4R8UA 1ZQAA 3ZDCA 1RYSA 2M2TA 4XQ7A 3H40A 1NK7A 4RT2A 7ICMA 5IIIA 2HHXA 3RH6A 9ICLA 4QZ8A 3MGHA 3T5HA 2FPMA 4MEYA 3ZD9A 4ECSA 3RRHA 1IM4A 3TAQA 1S0OA 4MEXA 4FHWA 2ZH1A 4DL4A 3PNCA 2PFPA 2UVWA 1V9PA 2GWSA 5DB9A 2XO7A 4C8LA 2W8LA 9ICFA 4YR3A 9ICHA 3T3FA 3TI0A 4EP7A 4I2IA 3GIJA 1LB2B 5KFZA 1IXRA 3JPPA 2ISPA 4O0IA 3IHQB 2PFQA 5KFVA 4QWAA 4O5CA 1QSLA 2WTFA 1EXNA 1SZPA 4XA5A 2PFOA 5KG0A 4DSJA 1YLQA 1TK0A 3WFRE 2ZHBA 5EOZA 2NRWA 1ZQQA 9ICAA 3C5FA 1JX4A 3RAQA 2RFFA 1ZQDA 4AT7A 4ECYA 8ICXA 1U9LA 3EW9A 4R64A 1UEVA 4AT9A 4JWMA 5F2VO 1T8EA 1JIHA 5KG5A 4ATBB 1XS9D 7ICRA 3PMNA 8ICLA 4RWQA 3ISDA 4RQ0A 1SL1A 4P2HA 4MF2A 5DBAA 4I2EA 3OUYA 4UB2A 4UAWA 2ZH3A 4EYIB 3PW0A 4C8MA 4BGDA 3HT3A 3SZ2A 2BCSA 5CWRA 3MFHA 3GILA 5KG3A 2ALZA 3PY8A 4O3PA 1C7YA 3AU2A 3G6XA 4QWBA 4F5NA 5DG8A 5KFHA 5CA7A 4Z6CA 3H8SA 4KN4A 3BQ2A 2C2EA 1RZTA 3L9DA 2DR8A 2ZTDA 3ORYA 5HMMA 5DB8A 2FPLA 5CJ7A 5J0QA 4RQ8A 2W9BB 5J2IA 4ED1A 2I1QA 3T5LA 2FLNA 4DSLA 9ICXA 4KLFA 3GIMA 3MR2A 1TV9A 1X9WA 4I2CA 2P6UA 4UAZA 4P4PA 2HVHA 5J2GA 4B9SA 4KLJA 3FYHA 4JV2A 4F4ZA 4KMUA 4E8FA 1JAJA 5KFKA 3JYYA 3PX0A 2BQUA 5IIJA 1BVSA 4DSIA 4TQRA 3Q8PB 1S0VA 2A1JA 1A76A 3LWLA 1Z00B 7ICEA 7ICOA 1BPEA 1XO1A 4RUCA 5KFCA 4C8OA 4FHXA 3THVA 3B0YA 2AQ4A 4NLGA 3V6KA 2C2DA 1MQ2A 1KNYA 3OUYB 4O3OA 3KHGA 3ISBA 3HJ4A 5J0XA 2ZH6A 4EBEA 4TUQA 4IQUA 4DS5A 2ZTCA 3G6VA 2FMSA 1ZQSA 4PHPA 9ICMA 4EBCA 4B9TA 5L9XA 1TKDA 8ICSA 1ZQZA 4YFKA 2PXIA 2FLLA 5IIOA 3HP6A 1WCLA 4DF4A 1TK8A 2DPIA 4IRCA 8ICUA 4RNOA 3UPSA 3WFOA 4RQ6A 1UEUA 1BPBA 1QTMA 3RJEA 8ICGA 4M9HA 3TAPA 2KZ3A 4YD2A 2ZJ5A 4J9MA 1HUZA 2M2UA 2ZJAA 4QZCA 4DQPA 3OVBA 4GC6A 4M6WA 5CP2A 5J2BA 4XRHA 1L3VA
chains in the Genus database with same CATH superfamily
3Q8LA 3JPNA 1SKRA 2OM6A 1RPLA 3RFAA 5GTIU 4QZFA 1KQQA 9ICWA 4DL6A 5KG7A 4Z6DA 3CW2C 1X9SA 4NXVA 3ISCA 4YXJA 4EYHB 4KLUA 2M2WA 3KTQA 3QU5A 3D2NA 1ZJMA 4K98A 5ALHA 3V72A 3OTQA 3QU9A 2KMDA 4O3RA 2IHOA 2EDUA 4Y2RA 5HR7A 2PMZC 5KFGA 3IG8A 5KFTA 5KFNA 1T3QA 5ALIA 3HW8A 3PW7A 4P4MA 1SGGA 5KFDA 1ZETA 2RRDA 9ICRA 1B43A 1MA7A 3SMVA 1RQLA 9ICKA 4Z6FA 2B4VA 4US9A 3M6ZA 2AJQA 2J6SA 2Y1JA 4QWDA 4ED6A 5HMLA 5KFUA 1H38A 1X6JA 1LKYA 2YQEA 2YY6A 3SV4A 1B0XA 3WKCA 9ICCA 5F3XB 4GC7A 4KLIA 1ZOLA 2NO4A 2A3VA 2W8KA 2Z7JA 4PL1A 9ICSA 2LBOA 4WQLA 5HR9A 2ZIXB 5J2AA 3BJYA 4B9MA 1SIJA 3N7RC 1L3UA 4YVZA 3D2SA 5L1IA 5J8YC 4J9LA 3F5EA 1O03A 2MUTA 2BQRA 4F5OA 3EZ5A 4I2FA 2KTQA 4KB6A 3QUQA 4YMNA 5KFXA 2XI9A 2E1FA 4IG8A 5L1JA 2XY7A 1T4GA 3N7PD 4NLKA 4EBKA 2KD1A 1COKA 1Z19A 5D63A 3GIKA 4O69A 4YR2A 4OJOA 4BUGA 5G5HA 5BPCA 2LYAA 7ICTA 2ISOA 3N4MB 1F5AA 2FI1A 1JALA 2DL0A 1NNLA 4M04A 5J0UA 2ID1A 4PHDA 1UT5A 2VJ4A 1DGJA 4G3IA 3MABA 3TADC 3UPQA 4WC3A 4ATBA 2BCQA 2FE9A 3NWIA 1O08A 4RQ3A 2LYBA 3FAHA 2NRVA 3ETLA 5AI8A 4RU9A 3QZ8A 1RYUA 2NRXA 5KTQA 2ZJ8A 5DECA 4IS7A 1J97A 4NWIA 5E79U 3UMCA 2I5HA 4WQKA 5DB7A 1VLBA 4ECUA 2YMLA 4CF3A 4ED8A 3HILA 4B9VA 1D9FA 1X9XA 2JEJA 5L1LA 2W7OA 2B21A 4DL2A 5ALJA 2BGWA 1RYRA 1F44A 3UXNA 5GTHU 7ICNA 8ICNA 9ICLA 4X0AA 4X4QA 2G07A 5KFLA 4RQ4A 7ICIA 4F50A 4F91B 3RJHA 2RDIA 3H0LB 5ALKA 8ICEA 5G5GA 4NXTA 1MC8A 4ZH4A 4X4UA 2RDJA 4O68A 1UT8A 1V38A 4PHAA 2BPGA 4I2AA 7ICGA 2WAQC 3AQMA 4QZ9A 5AK5A 4GIBA 1DK3A 5EWEA 3EYZA 8ICOA 1WYGA 3C29A 3QU7A 4UAUA 1UETA 4RWPA 4J9NA 5KFQA 3LK9A 4J03A 1XO0A 5KAIU 3F53A 1ZQRA 4K4GA 4GXJA 4F2RA 2E8OA 2KP7A 3Q8RB 2M0NA 5J2KA 4UBBA 2HI0A 4IRKA 2AHOB 4C7ZA 4FHYA 4RQ7A 2VKQA 4DL5A 2ZG6A 4LT6A 2K4EA 4EEDA 2NRKA 3NVWA 1N48A 2IUBA 4DOAA 8ICPA 3L3FX 8ICAA 3IM1A 3ED5A 3VCBA 1PX5A 3DEEA 4KLQA 3K75D 1U4BA 7ICFA 5EE0A 3M8SA 5TZVA 3PW4A 2DR5A 2PI4A 3C1YA 2LM4A 2KJ5A 3UQ2A 1Q3VA 3SAHA 1BPYA 1ZQUA 5ALWA 2R8KA 1DOQA 2UVUA 4KLDA 4M0AA 3QU4A 5KFPA 2JGAA 4ECXA 2R8JA 2RQ5A 5D4BA 4OAFA 4F8RA 1P7DA 1R8CA 7ICKA 4QJFB 4OJ5A 4Y2VA 4M9LA 2QARA 5KT5A 1SKWA 2K8CB 4UB6U 4O5KA 2EAPA 4FS1A 3EPIA 1KKXA 1TFYA 4OJ6A 5ALNA 2RP5A 5DQHA 4KLEA 3Q8SB 4F5RA 5FP0A 2E8NA 2K4PA 4QW8A 3OHBA 3MFIA 2IBKA 4QWEA 3PZPA 1R8AA 5KG4A 8ICHA 2XY5A 2QB0A 5AI5A 3PW2A 1N5WA 1ZD3A 1J2NA 1ZQWA 4X4VA 5DDMA 4C8KA 2KHQA 1OW5A 3PO5A 1SV0A 4CE6A 1X66A 1WOTA 2AGQA 1K1QA 3N7SC 4CDGA 5B66U 5AM3A 3BQ0A 3NVVA 1ZQLA 4X4OA 3GV5B 3CP8A 3PR4A 4E0DA 4EENA 4BXOA 3H39A 4ECZA 2K8AA 2W54A 3ZDCA 7ICMA 5ALUA 5IIIA 2HHXA 3MGHA 2FPMA 1S0OA 4ECSA 4FHWA 2E8PA 4MEXA 4DL4A 3AEVA 4OJLA 2MA1A 2PFPA 5ALSA 5CEHA 2GWSA 4BJQA 1VDVA 5JTGA 1Q8KA 4JLZA 1KL9A 4EP7A 4I2IA 2W03A 3GIJA 3IHQB 5KFVA 5ALPA 2WTFA 3WFRE 3C5FA 2GOLA 5AKYA 1LVHA 4AT7A 1UEVA 1NZBA 4KM5A 2E5SA 4I2EA 4UAWA 4EYIB 3PW0A 3HT3A 5CWRA 3GILA 2OCEA 1ZD2P 3G6XA 2F76X 5DG8A 5CA7A 1RZTA 3L9DA 1GO3F 5HMMA 5DB8A 2W9BB 4NY8A 5J2IA 3WFSC 3KKAC 2OEHA 3GIMA 1TV9A 3PSFA 2P6UA 4P4PA 1N62A 3FYHA 4JV2A 2KIVA 2JV3A 5ALZA 4O6AA 4TQRA 2A1JA 1A76A 5F2VO 1Z00B 1VFGA 1BPEA 4FHXA 4PZOA 5KFCA 1F0MA 2EH9A 3B0YA 3OUYB 1MQ2A 3AQFA 1JROA 4DS5A 2ZTCA 2FMSA 4B9TA 8ICSA 2FLLA 2PXIA 5IIOA 4DF4A 4M9HA 2KZ3A 4YD2A 4FZLA 3N28A 4C4SA 4QZCA 4DQPA 5CP2A 5J2BA 3NUQA 1FFUA 2R18A 5AK6A 8ICKA 2JZBB 3RTVA 5CB1A 4O9MA 9ICOA 4DSKA 2ZH2A 4GXIA 3I76A 4DQSA 2ZIUA 3JPOA 1D8BA 9ICGA 4NXXA 2DR7A 3AUOA 3ER9B 3QE9Y 2E8MA 5D46A 5KFOA 3AU6A 4R65A 5HHHA 1SXEA 5DQGA 2R8GA 3LVWA 2KOBA 1WWVA 4YR0A 4I2JA 5JU5A 1S97A 3JPTA 1NJWA 4LZGA 3MR6A 5AI0A 1OXJA 1WG8A 3MBYA 4WH5A 2RLTA 1SZHA 2G09A 1SV0C 2XGPA 9ICTA 2PKEA 4LJXA 5J2EA 1TK5A 1T7PA 1Q79A 3F2BA 1NKCA 3H4DA 8ICZA 3HX0A 2ASLA 1N56A 2MSNA 2AQ0A 4RNNA 1WWUA 2E1EA 2HHQA 4RQ1A 3RF9A 4QZIA 4S3NA 5JTIA 3B0XA 3UMGA 4IQTA 5DDYA 4P0PA 3RB6A 4OJPA 4F4YA 1Q3UA 4BDPA 1ZQHA 4QZBA 2YN4A 2KK0A 1L3TA 3C66A 1ZQXA 4NLBA 4MHVA 1X2IA 3NRWA 4FH5A 3RH5A 1NK0A 4Y2YA 5KG1A 4YN4A 5J2DA 3NS1A 5KFIA 2JEFA 4I2GA 4RQ5A 1R89A 3WK9A 3MR3A 1QSSA 4EZ6A 2HHSA 4FFDA 2WF7A 5BOLA 4DQIA 4UB1A 5HRFA 4EEKA 4EX6A 3RJKA 3BZCA 1DGSA 1SXDA 5EE9A 1S76D 3V7KA 2KNJA 3OGUA 2IMWP 3LVVA 5D62A 4ED2A 4PPXA 4UQGA 4F4KA 2MRLA 4AT8B 4Q43A 4B9LA 1QCKA 2NRZA 1KBUA 2C22A 3ZI4A 4UARA 3CK6A 3OSNA 5EE3A 4RZRA 4PZNA 5AHXA 3Q8MA 4OCZA 4LEVA 2H3IA 3WK8A 1D9DA 3C2LA 3J81j 3WFQE 2ES6A 4Q44A 5HHIA 2GO7A 2M9NA 4RPYA 2JH1A 4KLHA 4RNMA 1BNPA 1AROP 5KG6A 4C0ZA 3QEAZ 8ICTA 1UQVA 1L7PA 1MSWD 3GZFA 2ZH5A 3PR5B 3LWMA 4F4WA 3GV8B 1SB3C 1TAQA 4DSFA 2FLPA 5IINA 1MIYA 5EWGA 3TKAA 3TACB 2W3SA 1PK1A 2FPKA 3GDXA 5J2JA 2DFLA 8ICJA 5B5EU 3NGDA 2KFZA 2F8LA 2H5XA 2B0CA 4FO6A 8ICIA 1S10A 1ZQBA 4N7RA 4AT9B 2P6RA 1YZ6A 1S5LU 4QIWF 1R8BA 3NTUA 3RR8A 4ED7A 1UA0A 4IC9A 3HJ1A 4K99A 3KOOA 4KX3A 4IQWA 2LI6A 4DSEA 4JV1A 8ICBA 4KLTA 2HW3A 4F92B 3ZDEA 4CF5A 4UD4A 2HDOA 4YG2A 2KG5A 4KN7A 2KSOA 4Q45A 3SR6A 2ATLA 2UVVA 2BKEA 4K4HA 2Q0ZX 3NVYA 4F93B 2D6FC 1S8OA 4NL9A 2K60A 1IG6A 2VANA 4B6JA 1Z3EB 2M2VA 4DFPA 4I28A 2W43A 4DO9A 8ICWA 2EAMA 3H8WA 3NKUA 1NOMA 1BPDA 2KVCA 4OAHA 2ZH7A 3GFKB 3M9OB 1L7MA 3HRDD 4PHEA 1NI3A 3OJUA 1ZQJA 2F1HA 4UASA 2ODGA 2Y0SF 4ZOHC 4YMMA 1YT3A 1XC9A 1MQ3A 3RBDA 5KT2A 2ZUBA 4P0QB 4PH5A 4ECQA 1Z1VA 2HN1A 3OVAA 4MFFA 4X0BA 1RQNA 1M6YA 4Q8EA 1Q78A 3MDCA 3JPQA 2EWRA 5ALMA 3HJEA 1ZQTA 2G06A 4DFKA 5L1MA 1S0MA 2W04A 3S6JA 1DRGA 4BWMA 4FZMA 2Q66A 2P66A 2A19A 3HKZF 2OH2A 2F2AB 4USAA 5KL1B 4DLGA 9ICQA 2LPEA 1N61A 3IG5A 5DQIA 4CF4A 4U7CA 3AQKA 2L5YA 3ZD8A 4AYBF 1Z4OA 3RJIA 2WF5A 2WB1F 4CNQA 1RDFA 3SQIA 2HSZA 4X4NA 5KFYA 2KJ9A 2IHNA 3H4BA 2ZHAA 5HRGA 4QWCA 3GIIA 3UMBA 5AKJA 3F5AA 2BR0A 3MGIA 4FHPA 4MKPA 2KZMA 3V7JA 4G9BA 5T14A 2YB4A 4O3SA 7ICJA 3PMLA 3TFRA 2MAXA 4UAYA 5DLFA 3MDAA 2DBYA 2XVTA 1ZQOA 3JPRA 1CUKA 4JUZA 1JN3A 7ICHA 2W11A 4RQMA 4DS4A 2GA9D 4I2BA 2XY6A 2MUTB 3QNMA 4R8UA 2M2TA 1B4FA 5AKKA 2O6KA 5ALVA 4QZ8A 3RRHA 3TAQA 3PNCA 3QUCA 5DB9A 2D3DA 3JCFA 2CXYA 3WK7A 3NASA 4Y2UA 5AI9A 5KFZA 3JPPA 4O0IA 2PFQA 2AH5A 1QSLA 3ICXA 4XA5A 1SZPA 2PFOA 4DSJA 1YLQA 2K89A 1TK0A 2ZHBA 2EQYA 2NRWA 2P35A 3QUBA 3K1RB 3EW9A 4ATBB 1XS9D 1SWVA 2KV2A 4RWQA 1SV4A 4MF2A 5DBAA 5CHEA 3MC1A 1L7OA 4RWOA 4F5NA 2ZIWA 3BQ2A 1L7NA 2W3RA 2FPLA 3T5LA 5J0QA 2FLNA 4KLFA 3MR2A 1X9WA 4KLJA 5KFKA 3JYYA 7ICEA 3Q8PB 3LWLA 4C8OA 2G5HB 5HC9A 1ECWA 4UAVA 4IQUA 1ZQSA 4EBCA 5L9XA 1ZQZA 2HBLA 2BDUA 1JRPA 1JUDA 2BBJA 2DPIA 2G08A 3WFOA 1UEUA 3RJEA 3TAPA 4XJEA 1HUZA 3GU3A 1CI4A 5AI6A 4M6WA 4XRHA 4QIWC 5AM1A 4ELUA 4ED3A 1WCNA 5F9LA 5H2FU 4C4TA 1IV8A 3EPGA 2DUYA 1PVQA 3TQ1A 4TQSA 4OAIZ 4RQ2A 1Z1BA 2JH7A 4J9SA 3QEBZ 2E3TA 2XCAA 1D8YA 3FM9A 2W9BA 4UB5A 1SL0A 9ICBA 2OXOA 3PSIA 2NRTA 5J29A 5ALEA 5J0SA 1SKSA 3R9KA 1TFRA 2GLEA 3WKEA 3RJJA 2ZIVA 4HYKA 3PV8A 2IHMA 2W7PA 2Y9UA 1V4AA 1TAUA 3C2KA 5JUMA 4RPZA 3LQCB 2ZH4A 5HNKA 2BE3A 1NK8A 2PFNA 1BNOA 4Y2TA 4YCXA 2W9CA 4X4RA 2KIWA 4X4SA 5KFJA 4ED0A 2VA8A 2ZUCA 4I29A 2HBMA 2OWOA 2Y0SC 5CFUA 3PX6A 4NKTA 1KDHA 3SEIA 2UVRA 5ALQA 4US8A 3VC8A 5KL8B 3EUB2 4LEZA 3QX7A 4IRDA 5J2HA 1ZJNA 5IIKA 4DWIA 4HX0A 2F1IA 2QB1A 4ECWA 2HOIA 2J6UA 2KEYA 3JZ0A 2QARB 5J0OA 3BQTA 4F2SA 2B6GA 5AM5A 3UQ0A 3HKZC 4OO1J 3M9MB 5CFSA 2Y9TA 2YMMA 2O1PA 1ZQPA 1Z4NA 5F9NA 3I1YA 4FHVA 2V4RA 4AYBC 3AQEA 3RAXA 4YP3A 2QB0B 5AKGA 4DFMA 2ASDA 4E80A 1TVAA 1XNSA 2WB1C 2BZFA 3C2MA 4QZDA 4MFCA 3QXGA 1KFTA 3ETRA 3RH4A 4JK1A 7ICUA 1LV5A 5DGAA 4KLGA 5IILA 4DFDA 3BDPA 3AQNA 5IIMA 1NK4A 4DL7A 3G6YA 1RXVA 4K8VA 3PW5A 1YZ7A 2ASJA 2LKYA 1DXSA 4BXOB 4JV0A 3RJGA 4UATA 1BPZA 4O67A 2VJ5A 2EAOA 5AIAA 2IOHA 3BS5A 1FIQA 4FBTA 4GFJA 1DK2A 2DKXA 4J9QA 1XSPA 5ALYA 3WK5A 3SAGA 2YTUA 4IL6U 2VA2A 4CGZA 4IR1A 1X6IA 2JEIA 2FMPA 5KNIA 2KVSA 2WHEA 2B56A 1CRXA 2DGZA 3V6HA 2R8HA 5J0PA 3RB3A 4AT7B 4XQ8A 3OSPA 4DQRA 3RB4A 3CYMA 5HP4A 2OYYA 4F71A 4J9KA 2F1JA 4WC0A 1MIWA 3C18A 3LDAA 3KFUF 4PGXA 3KBBA 2HHVA 2EZYA 1FFVA 5KT6A 3M1YA 1KEJA 1NJYA 2JHDA 3F2DA 2W9AA 1SL2A 1JI7A 4JWNA 4WC4A 3JPSA 4EEBA 2A1JB 1N5XA 3H0RB 3BQ7A 2F44A 5HRIA 4F72A 4PL2A 5CFTA 2HBJA 3ALRA 1S77D 3Q8KA 1U47A 4ECVA 3PX4A 5ALRA 4QZHA 4EELA 4R63A 4WC2A 2Q4TA 1ZYQA 3K1ZA 5AKLA 4WC7A 4Y2XA 4J9RA 3GV7B 4K4IA 5J8YA 4MF8A 5CRXA 4BX9C 2YX8A 4DQQA 9ICIA 4IQVA 2KN7A 4A8EA 5TISU 4Y2SA 2HCFA 2ZH8A 5DG7A 4UBCA 1JQRA 3E58A 5DEDA 3Q8QB 3N97B 2FCLA 2I9GA 4DFJA 2KZZA 1NKEA 1L8OA 4WBYA 4ELTA 2KE7A 4EBDA 5KT7A 2QLTA 2F77X 2V9WA 1RG6A 4YMOA 3AQLA 4KITB 1HEKA 3OV7A 3RBEA 1UPHA 2DRBA 2N1RA 1MIVA 1TE2A 4TURA 4BWJA 2MU2A 1KLNA 1ZQNA 1MN8A 1QLNA 3TFSA 2ZIXA 4WC5A 1K5OA 1D8LA 3C21A 3BS7A 3FDSA 1URJA 2XC9A 3T79A 4IR9A 1JMSA 4KMOB 1FO4A 5DG9A 1XSLA 5KT3A 3ONNA 4I2DA 4P0PB 4MFAA 4PGYA 1N2XA 3K7DA 3SI8A 2CPRA 3WKBA 2DPJA 1UCVA 4P0QA 3F2CA 5J2FA 2KFNA 4FH3A 3H38A 4RQNA 5KFRA 8ICRA 4FS2A 4AP9A 5AM0A 1XSNA 8ICFA 4K9AA 4QZEA 3A0HU 4PJ0U 5DKWA 4DF8A 3UXPA 2H3FA 2IA6A 3OWGA 3M6KA 1KW4A 1PVRA 4ACOA 2BPFA 3L5KA 5AK3A 4I0UA 2RHFA 1RYSA 4XQ7A 3QUTA 3KD3A 3H40A 4RT2A 3RH6A 4MEYA 3IP4B 2ZH1A 3WKDA 1ZD5A 2UVWA 1V9PA 4C8LA 2W55A 2W8LA 9ICFA 5AIBA 9ICHA 3T3FA 1IXRA 2KKPA 3E0FA 4QWAA 4O5CA 1EXNA 3AN1A 3QU2A 2F8KA 5EOZA 1ZQQA 9ICAA 3RAQA 2RFFA 1U9LA 4R64A 1T8EA 1JIHA 4NV0A 3PMNA 8ICLA 3ISDA 4RQ0A 1SL1A 4Y2JA 2ZH3A 4C8MA 3SZ2A 2BCSA 4O3MA 1FEZA 3H8MA 5KG3A 2ALZA 3PY8A 4O3PA 4QWBA 4Z6CA 2DR8A 4KN4A 2ZTDA 4ED1A 2WF6A 2I1QA 5ALLA 2HVHA 4I2CA 1PK1B 2F3NA 5J2GA 3CRXA 4B9SA 1J2MA 5IIJA 4DSIA 1XO1A 4RUCA 3THVA 1KNYA 3V6KA 4O3OA 3KHGA 3ISBA 3HJ4A 5J0XA 5EE1A 1TKDA 1A0PA 4RQ6A 1BPBA 1QTMA 8ICGA 2ZJ5A 2M2UA 3B9JA 2ZJAA 3K4GA 2NV3A 1L3VA 4X4PA 4NLZA 4F5PA 1LKYB 2KSOB 5AM4A 5KT4A 3WKAA 7ICSA 4EX7A 4I27A 1IIPA 2OHFA 5DLGA 5DBCA 1RXWA 4M2YA 5HRDA 3RB0A 3H37A 1A6SA 1QQ7A 1VJ5A 2VA3A 1X40A 4K9BA 1X9MA 3M8RA 4EBJA 1U45A 3PSPA 4DCCA 2CRXA 5HRHA 1OU5A 1U49A 1Q46A 3H7IA 3NRZA 4J9PA 2HHWA 2NO5A 4CCHA 4WCWA 3UXOA 4R66A 4EV6A 4UB8U 3IRUA 3SAFA 2VIXA 4KLSA 5J0WA 4TUSA 5AKZA 1AQ6A 1ZQGA 2LMRA 1S0NA 3H0MB 4YD1A 4E7XA 4M9GA 2H3VA 4DOCA 2HOQA 9ICUA 4EGWA 5KFFA 3C5GA 3RR7A 1HUOA 1XWLA 5KFSA 3SV3A 4JMUA 2DF4B 4DLEA 1L3SA 4CRXA 2R8IA 1KN5A 7ICLA 4GLXA 2W9MA 4O3NA 2B51A 1U48A 1C20A 4NKUA 4KLOA 2DWQA 5KG2A 7ICPA 1ZQVA 1L5UA 5JRTA 5ALFA 4PGQA 3U26A 2GAFD 3WU2U 4NL9C 4YQWA 5K4LA 3HWTA 1RM6C 3LYSA 1ZRMA 2JXJA 3NYBA 5EWFA 4FBUA 2C28A 2K4IA 3DV9A 4FE3A 5KFAA 4KLMA 4NM2A 8ICCA 4O3QA 3H8JA 7ICQA 5AKEA 3KKAA 4TUPA 3FC4A 4RUAA 5KFWA 2C2RA 2K4HA 4RPXA 3AL0B 1N63A 1PUZA 9ICVA 4QZAA 3PSTA 3BQ1A 2XCPA 2NYVA 2LHTA 5HRBA 2V4QA 2HHPA 3KHLA 1HJPA 4B9UA 4UD5A 5DGBA 4U6PA 5DBBA 5DB6A 1PK3A 1N60A 5HRLA 1FA0A 1KFSA 1A77A 4Z6EA 1KFDA 5J0YA 2FMQA 1NK9A 4EZ9A 2KICA 4R8UB 3H3AA 9ICNA 1ZRNA 3BZKA 4XUSA 2AU0A 4ECTA 4UW9A 1WUDA 8ICMA 4P4OA 2YB1A 1QQ5A 2IOFA 3ZDDA 4Y2QA 3PO4A 5AKXA 1JXLA 1K1SA 4C7YA 1NK5A 3C1ZA 4M9NA 2PBEA 4C80A 1VJ7A 3IDWA 1SWWA 2EANA 1ZQYA 3SD7A 2BCUA 4OAGA 4F3OA 1ZQEA 5KFBA 4DOBA 2DR9A 3WK4A 9ICPA 3MCRA 1Z00A 2ZTEA 8ICXA 3AMZA 5A0LA 5CHGA 3OUYA 5J0RA 3V6JA 3ZDAA 8ICVA 4X5VA 2WF8A 3SYZA 2H3ZA 4C4RA 1ZQ1C 2GH1A 3QYPA 4GXKA 4KLLA 3D2QA 1B22A 3E2EA 2ZXHA 3WFPA 2ZIWB 4DL3A 5AM2A 2DVIA 8ICYA 2JEGA 3L4PA 2ESEA 2XGQA 2BHNA 4QW9A 5ALGA 4UB4A 1KSPA 4WBZA 4KX5A 3RRGA 3OVSA 1T94A 2JZBA 4YXMA 3KHRA 9ICJA 2K8BB 5HREA 4LEWA 2BCVA 8ICQA 1BGXT 3O0FA 2PMZF 1ED1A 3PVXA 1ZQFA 1NZPA 3CNHA 3MR5A 3EWAA 2FJ6A 5CR0A 4RWNA 3D6JA 4DEZA 3TANA 5ALOA 2HHUA 1T3NA 4NLNA 1NJXA 1KRPA 1XU4A 4EEYA 3M9NB 3NVOA 2J6TA 4M6WB 3TARA 4WC6A 4UB3A 1ZQKA 5C0YA 2WFAA 2XIDA 2BDPA 4RT3A 5AKHA 9ICEA 2AGPA 4FO1A 2ZXIA 4Y2PA 4NXWA 3OPXA 3OHAA 1BPXA 3QZ7A 2BPCA 3KZIU 1QQ6A 4C8NA 5AK4A 1S9FA 5J2CA 3SENA 2DRAA 2EZZA 4ICAA 1ZQCA 1JXEA 5D49A 5D61A 1COOA 3C23A 1KTQA 1TAMA 1PZNA 4NXZA 1ZXIA 4WOYA 1CEZA 2HHTA 2H3QA 1ZQMA 2QKQA 2BQ3A 3T5KA 2AGOA 1UA1A 2YMQA 2HMXA 1Y88A 3DDHA 1NJZA 2ZIVB 4M9JA 2I6XA 5AKIA 1HIWA 2IOFK 4B9NA 2HVIA 1NO5A 4M5DA 3V7LA 3T5JA 4ECRA 1V97A 1X42A 3M7DA 5ALTA 2LYHA 5KFEA 3HIYA 2W9CB 3GQCA 4LVSA 1OUQA 4WJ3B 3MGVA 1NK6A 3HPOA 2KJ8A 2O5AA 2Y1IA 1L6NA 3I28A 1F5SA 3KZXA 4NXUA 2ZH9A 4WC1A 1ZD4A 5L1KA 5BOMA 4Q8FA 1QH9A 2EZXA 4NM1A 4LZDA 1NKBA 4O5EA 4F4XA 3RJFA 2ZUDA 2WF9A 2LM1A 4AT8A 1QSYA 1TFWA 5HRKA 2BCRA 2G5IB 4KTQA 2FDRA 4QZGA 2PI5A 2HN2A 5C5JA 3PHZA 2CN1A 4F5QA 4I2HA 3ZDBA 1ZQIA 3KHHA 1L8LA 4X4TA 5ALXA 2BBHA 4JB3A 3IV6A 5KFMA 2JRZA 2JR5A 4OD0A 3OJSA 4J9OA 4ELVA 4FZNA 2G0AA 4M47A 5KAFU 5AI4A 5J0TA 4K97A 7ICVA 2JMGA 1ZQAA 2XICA 1NK7A 3T5HA 3ZD9A 1IM4A 4JLXA 1GPJA 2XO7A 5B3PA 4YR3A 2DQNB 3TI0A 2AXTU 1LB2B 2ISPA 2DKZA 4QNLA 3IN5A 5KG0A 3UM9A 5ALDA 4NJ8A 1JX4A 1ZQDA 4ECYA 4AT9A 4JWMA 3A0BU 5KG5A 2KHVA 2HOFA 7ICRA 4K96A 4P2HA 2WAQF 4UB2A 1UHUA 4LEYA 2HBKA 3BS5B 4BGDA 3MFHA 2YMPA 2ZIUB 1C7YA 3AU2A 5KFHA 5HR6A 3H8SA 2C2EA 3ORYA 4RQ8A 5CJ7A 1PVPA 4DSLA 9ICXA 4NLCA 5AICA 5B3QA 4UAZA 2D8CA 4F4ZA 2KKVA 4KMUA 4E8FA 1JAJA 3PX0A 2BQUA 1BVSA 1S0VA 7ICOA 4NLGA 2AQ4A 2C2DA 3TADA 3AM9A 2ZH6A 4EBEA 4TUQA 3C28A 1V85A 3G6VA 9ICMA 4PHPA 3EF2A 4YFKA 3HP6A 1WCLA 1TK8A 8ICUA 4IRCA 2A1AA 4RNOA 3UPSA 4J9MA 4HAIA 3OVBA 4GC6A 3ER8C 3WK6A 3NVZA 3ERCC
chains in the Genus database with same CATH topology
3Q8LA 3JPNA 1SKRA 1RPLA 4ELUA 4ED3A 4X4PA 1WCNA 4NLZA 8ICKA 2JZBB 5F9LA 4F5PA 3RTVA 4QZFA 5CB1A 4O9MA 5KT4A 9ICOA 4DL6A 9ICWA 7ICSA 3EPGA 5KG7A 4I27A 4DSKA 2ZH2A 4GXIA 4Z6DA 7ICNA 3TQ1A 1X9SA 3ISCA 4TQSA 4YXJA 4EYHB 4RQ2A 4KLUA 5DLGA 5DBCA 4DQSA 2M2WA 3JPOA 1RXWA 4M2YA 3KTQA 4J9SA 5HRDA 3RB0A 9ICGA 3QEBZ 1ZJMA 2XCAA 1D8YA 3H37A 2DR7A 2W9BA 4UB5A 3AUOA 3V72A 3QE9Y 2VA3A 1SL0A 5D46A 5KFOA 3AU6A 3M8RA 1X9MA 4O3RA 9ICBA 4R65A 5HHHA 4EBJA 1U45A 2NRTA 5DQGA 2R8GA 5J29A 5HRHA 1OU5A 5KFGA 5KFNA 5KFTA 4YR0A 4I2JA 1U49A 1SKSA 5J0SA 1S97A 3JPTA 1NJWA 4LZGA 3MR6A 3H7IA 1TFRA 4J9PA 2HHWA 3HW8A 3PW7A 3RJJA 4P4MA 4HYKA 3PV8A 2IHMA 3UXOA 5KFDA 4CCHA 4R66A 4WCWA 1ZETA 3MBYA 9ICRA 2XGPA 1V4AA 1B43A 1TAUA 4KLSA 3C2KA 9ICTA 5J0WA 4TUSA 5JUMA 4RPZA 5J2EA 1TK5A 1T7PA 9ICKA 1ZQGA 4Z6FA 5HNKA 1S0NA 3LQCB 1NKCA 1Q79A 4YD1A 3H4DA 8ICZA 2BE3A 1NK8A 3HX0A 2PFNA 4YCXA 2W9CA 2ASLA 4M9GA 4DOCA 1BNOA 4E7XA 4X4RA 2AJQA 1N56A 9ICUA 4X4SA 2J6SA 5KFJA 2Y1JA 5KFFA 2AQ0A 4ED0A 2VA8A 2ZUCA 4RNNA 3C5GA 3RR7A 4QWDA 4I29A 4ED6A 1HUOA 1XWLA 5KFSA 4RQ1A 4QZIA 5HMLA 5KFUA 3SV3A 2OWOA 3PX6A 4NKTA 3B0XA 4DLEA 1L3SA 4S3NA 4IQTA 2R8IA 1H38A 5DDYA 1KDHA 4GLXA 7ICLA 2W9MA 3RB6A 4O3NA 2UVRA 4F4YA 3SV4A 1U48A 4BDPA 1ZQHA 5HC9A 4NKUA 9ICCA 4GC7A 4QZBA 4KLOA 1L3TA 4KLIA 5KG2A 4X0AA 3C66A 1ZQXA 4IRDA 7ICPA 1ZQVA 5J2HA 1L5UA 4PGQA 1X2IA 2W8KA 4FH5A 1ZJNA 4YQWA 3RH5A 5IIKA 4DWIA 3HWTA 1NK0A 9ICSA 5J2DA 2F1IA 5KG1A 4YN4A 4ECWA 2J6UA 3JZ0A 5KFIA 2JEFA 4I2GA 4RQ5A 1R89A 5HR9A 5EWFA 5J0OA 3NYBA 4FBUA 2C28A 3BQTA 5J2AA 3MR3A 1QSSA 4F2SA 3BJYA 4B9MA 4EZ6A 2HHSA 1L3UA 5KFAA 5BOLA 4NM2A 4DQIA 4KLMA 4YVZA 3UQ0A 4UB1A 8ICCA 4O3QA 5HRFA 3H8JA 7ICQA 5L1IA 3RJKA 3M9MB 4J9LA 1DGSA 4TUPA 2O1PA 4RUAA 1ZQPA 3V7KA 5F9NA 1S76D 4FHVA 2MUTA 2BQRA 5KFWA 2V4RA 4F5OA 3OGUA 3EZ5A 2C2RA 2IMWP 4I2FA 3RAXA 2KTQA 4RPXA 4YP3A 4DFMA 2ASDA 4YMNA 4ED2A 4E80A 9ICVA 4PPXA 4UQGA 1TVAA 4QZAA 4F4KA 5KFXA 4IG8A 5L1JA 2XY7A 1T4GA 4NLKA 4AT8B 4Q43A 4EBKA 3C2MA 4B9LA 2NRZA 4QZDA 3BQ1A 2C22A 4MFCA 1KFTA 2XCPA 3GIKA 3RH4A 4JK1A 3OSNA 7ICUA 5HRBA 2V4QA 1LV5A 2HHPA 4RZRA 5DGAA 4KLGA 4YR2A 3KHLA 1HJPA 4B9UA 3Q8MA 4UD5A 5IILA 5BPCA 5DGBA 7ICTA 5DBBA 2ISOA 5DB6A 3BDPA 3AQNA 1D9DA 5IIMA 3C2LA 3N4MB 3WFQE 4Q44A 1F5AA 1NK4A 4DL7A 3G6YA 5HHIA 1RXVA 4M04A 5HRLA 5J0UA 2M9NA 3PW5A 1FA0A 4RPYA 2ASJA 1KFSA 4PHDA 1UT5A 2ID1A 4KLHA 1A77A 4Z6EA 4RNMA 4BXOB 4JV0A 1KFDA 1AROP 5J0YA 1NK9A 2FMQA 3RJGA 4G3IA 3MABA 3UPQA 4EZ9A 4WC3A 1BPZA 4R8UB 5KG6A 3QEAZ 9ICNA 3H3AA 8ICTA 2BCQA 4ATBA 4RQ3A 3K4GA 4NY8A 1MSWD 2NRVA 4XUSA 3ETLA 4RU9A 2ZH5A 3PR5B 3QZ8A 3LWMA 2AU0A 4F4WA 2NRXA 5KTQA 2ZJ8A 4ECTA 4P4OA 3GV8B 8ICMA 5DECA 3ZDDA 4FBTA 1TAQA 1DK2A 4DSFA 3PO4A 2FLPA 4J9QA 1JXLA 1K1SA 5IINA 3C1ZA 1NK5A 4M9NA 1MIYA 2PBEA 5DB7A 1XSPA 5EWGA 4ECUA 1VJ7A 1ZQYA 4ED8A 2VA2A 2HHQA 4B9VA 1D9FA 2BCUA 4IR1A 2JEJA 2FPKA 3GDXA 5J2JA 1BNPA 2DFLA 5L1LA 4F3OA 8ICJA 2KFZA 3NGDA 1ZQEA 5KFBA 2FMPA 2JEIA 4DOBA 2DR9A 9ICPA 2B21A 2H5XA 1Z00A 2ZTEA 3V6HA 4DL2A 2BGWA 5CHGA 2R8HA 3UXNA 5J0PA 4FO6A 5J0RA 3RB3A 1S10A 4XQ8A 1RYRA 3V6JA 4DQRA 3RB4A 3OSPA 1ZQBA 3ZDAA 8ICNA 2P6RA 5HP4A 4AT9B 4X4QA 8ICVA 5KFLA 4RQ4A 4X5VA 4J9KA 7ICIA 2F1JA 3SYZA 1R8BA 4F50A 4WC0A 4F91B 3NTUA 3RJHA 3RR8A 2RDIA 4GXKA 1MIWA 4ED7A 8ICEA 4KLLA 3C18A 1B22A 3LDAA 4PGXA 3E2EA 1UA0A 3HJ1A 1MC8A 4ZH4A 3WFPA 2RDJA 4DSEA 4IQWA 4JV1A 8ICBA 4X4UA 4DL3A 4KLTA 2HW3A 4F92B 3ZDEA 2JEGA 8ICYA 2DVIA 2HHVA 4UD4A 1UT8A 2XGQA 2BHNA 4YG2A 5KT6A 4PHAA 2BPGA 4QW9A 1KEJA 1NJYA 4I2AA 7ICGA 4UB4A 1KSPA 2W9AA 3AQMA 1SL2A 3RRGA 4WBZA 2JZBA 4YXMA 4KN7A 4QZ9A 3OVSA 3KHRA 4Q45A 9ICJA 4JWNA 4WC4A 3JPSA 2ATLA 1DK3A 2UVVA 4AT7B 5HREA 2BKEA 5EWEA 3EYZA 8ICOA 2A1JB 2BCVA 8ICQA 4K4HA 1BGXT 2Q0ZX 3PVXA 1UETA 4RWPA 1ZQFA 4F93B 1NZPA 5HRIA 4J9NA 3EWAA 5KFQA 3MR5A 3LK9A 1ZQRA 4K4GA 5CR0A 4GXJA 4RWNA 4F2RA 4DEZA 3TANA 2VANA 1Z3EB 3Q8RB 4DFPA 4I28A 2KP7A 2M2VA 1S77D 3Q8KA 1U47A 4ECVA 3PX4A 4DO9A 8ICWA 2HHUA 3H8WA 1T3NA 5J2KA 4QZHA 4NLNA 4UBBA 4R63A 1NJXA 1NOMA 4IRKA 1KRPA 1BPDA 4WC2A 1XU4A 4EEYA 3M9NB 4FHYA 4RQ7A 4DL5A 1ZYQA 2J6TA 4WC7A 4J9RA 4M6WB 3GV7B 4LT6A 4K4IA 4MF8A 2ZH7A 3GFKB 3TARA 3M9OB 2NRKA 4WC6A 4UB3A 1ZQKA 4DQQA 1N48A 4PHEA 4DOAA 1ZQJA 3OJUA 2BDPA 8ICPA 4RT3A 8ICAA 9ICIA 3IM1A 2F1HA 9ICEA 4IQVA 2AGPA 2KN7A 1PX5A 4YMMA 3OHAA 1BPXA 3QZ7A 2BPCA 2ZH8A 5DG7A 4UBCA 1JQRA 1XC9A 4C8NA 4KLQA 3K75D 1U4BA 1MQ3A 3RBDA 5KT2A 2ZUBA 5DEDA 1S9FA 7ICFA 4PH5A 5J2CA 3Q8QB 3M8SA 5TZVA 4ECQA 3N97B 3PW4A 2DRAA 1ZQCA 2I9GA 2DR5A 2PI4A 1JXEA 5D49A 3C1YA 4DFJA 2KZZA 1NKEA 4MFFA 4X0BA 3OVAA 4WBYA 1COOA 3C23A 1KTQA 5KT7A 4EBDA 3MDCA 3UQ2A 4ELTA 4Q8EA 1Q78A 3WFSC 3JPQA 1PZNA 4NXZA 2V9WA 1CEZA 1ZQTA 4YMOA 4DFKA 1BPYA 2HHTA 1S0MA 3AQLA 4KITB 1ZQMA 1ZQUA 4M0AA 2BQ3A 1DOQA 3T5KA 2AGOA 2UVUA 2R8KA 3RBEA 4KLDA 3OV7A 2DRBA 1UA1A 5KFPA 1MIVA 4BWMA 4ECXA 1Y88A 4TURA 2Q66A 4BWJA 2P66A 2R8JA 1NJZA 5D4BA 1KLNA 4M9JA 1ZQNA 4B9NA 4F8RA 4DLGA 2HVIA 9ICQA 1R8CA 1NO5A 7ICKA 4M5DA 1QLNA 3V7LA 5DQIA 3T5JA 3TFSA 4ECRA 3AQKA 4M9LA 3ZD8A 5KT5A 1SKWA 4O5KA 4WC5A 2LYHA 5KFEA 1D8LA 3C21A 4FS1A 3RJIA 3HIYA 2ZH4A 2W9CB 3GQCA 3EPIA 4LVSA 1NK6A 1TFYA 5DQHA 4RWOA 3HPOA 3FDSA 2O5AA 2Y1IA 2XC9A 3Q8SB 4KLEA 4F5RA 3OHBA 2ZH9A 4QW8A 3MFIA 2IBKA 8ICIA 4QWEA 4IR9A 4X4NA 1JMSA 1XSLA 4WC1A 5DG9A 5KFYA 5L1KA 1R8AA 5BOMA 5KT3A 4Q8FA 2IHNA 4I2DA 5KG4A 3H4BA 8ICHA 4MFAA 2ZHAA 4NM1A 4PGYA 4LZDA 2XY5A 1NKBA 4O5EA 5HRGA 4QWCA 3GIIA 4F4XA 3PW2A 3SI8A 3RJFA 2BR0A 2ZUDA 3MGIA 4FHPA 2DPJA 4AT8A 1ZQWA 1QSYA 1TFWA 2KZMA 4X4VA 3V7JA 5HRKA 2BCRA 5DDMA 4KTQA 5J2FA 4C8KA 4O3SA 4QZGA 7ICJA 2PI5A 2KFNA 3PMLA 3H38A 4FH3A 5C5JA 5KFRA 3TFRA 3PO5A 4FS2A 8ICRA 1WOTA 2MAXA 4UAYA 5DLFA 1XSNA 8ICFA 2AGQA 4QZEA 4F5QA 3MDAA 4I2HA 5DKWA 1K1QA 4DF8A 3ZDBA 1VFGA 1ZQIA 1ZQOA 3JPRA 3KHHA 3UXPA 1CUKA 3BQ0A 4X4TA 4JUZA 1ZQLA 1JN3A 2IA6A 4X4OA 3GV5B 5KFMA 3PR4A 7ICHA 3OJSA 4J9OA 4DS4A 4ELVA 4E0DA 4BXOA 2BPFA 4I2BA 2XY6A 4M47A 3H39A 5J0TA 4ECZA 7ICVA 2MUTB 4R8UA 1ZQAA 3ZDCA 1RYSA 2M2TA 4XQ7A 3H40A 1NK7A 4RT2A 7ICMA 5IIIA 2HHXA 3RH6A 9ICLA 4QZ8A 3MGHA 3T5HA 2FPMA 4MEYA 3ZD9A 4ECSA 3RRHA 1IM4A 3TAQA 1S0OA 4MEXA 4FHWA 2ZH1A 4DL4A 3PNCA 2PFPA 2UVWA 1V9PA 2GWSA 5DB9A 2XO7A 4C8LA 2W8LA 9ICFA 4YR3A 9ICHA 3T3FA 3TI0A 4EP7A 4I2IA 3GIJA 1LB2B 5KFZA 1IXRA 3JPPA 2ISPA 4O0IA 3IHQB 2PFQA 5KFVA 4QWAA 4O5CA 1QSLA 2WTFA 1EXNA 1SZPA 4XA5A 2PFOA 5KG0A 4DSJA 1YLQA 1TK0A 3WFRE 2ZHBA 5EOZA 2NRWA 1ZQQA 9ICAA 3C5FA 1JX4A 3RAQA 2RFFA 1ZQDA 4AT7A 4ECYA 8ICXA 1U9LA 3EW9A 4R64A 1UEVA 4AT9A 4JWMA 5F2VO 1T8EA 1JIHA 5KG5A 4ATBB 1XS9D 7ICRA 3PMNA 8ICLA 4RWQA 3ISDA 4RQ0A 1SL1A 4P2HA 4MF2A 5DBAA 4I2EA 3OUYA 4UB2A 4UAWA 2ZH3A 4EYIB 3PW0A 4C8MA 4BGDA 3HT3A 3SZ2A 2BCSA 5CWRA 3MFHA 3GILA 5KG3A 2ALZA 3PY8A 4O3PA 1C7YA 3AU2A 3G6XA 4QWBA 4F5NA 5DG8A 5KFHA 5CA7A 4Z6CA 3H8SA 4KN4A 3BQ2A 2C2EA 1RZTA 3L9DA 2DR8A 2ZTDA 3ORYA 5HMMA 5DB8A 2FPLA 5CJ7A 5J0QA 4RQ8A 2W9BB 5J2IA 4ED1A 2I1QA 3T5LA 2FLNA 4DSLA 9ICXA 4KLFA 3GIMA 3MR2A 1TV9A 1X9WA 4I2CA 2P6UA 4UAZA 4P4PA 2HVHA 5J2GA 4B9SA 4KLJA 3FYHA 4JV2A 4F4ZA 4KMUA 4E8FA 1JAJA 5KFKA 3JYYA 3PX0A 2BQUA 5IIJA 1BVSA 4DSIA 4TQRA 3Q8PB 1S0VA 2A1JA 1A76A 3LWLA 1Z00B 7ICEA 7ICOA 1BPEA 1XO1A 4RUCA 5KFCA 4C8OA 4FHXA 3THVA 3B0YA 2AQ4A 4NLGA 3V6KA 2C2DA 1MQ2A 1KNYA 3OUYB 4O3OA 3KHGA 3ISBA 3HJ4A 5J0XA 2ZH6A 4EBEA 4TUQA 4IQUA 4DS5A 2ZTCA 3G6VA 2FMSA 1ZQSA 4PHPA 9ICMA 4EBCA 4B9TA 5L9XA 1TKDA 8ICSA 1ZQZA 4YFKA 2PXIA 2FLLA 5IIOA 3HP6A 1WCLA 4DF4A 1TK8A 2DPIA 4IRCA 8ICUA 4RNOA 3UPSA 3WFOA 4RQ6A 1UEUA 1BPBA 1QTMA 3RJEA 8ICGA 4M9HA 3TAPA 2KZ3A 4YD2A 2ZJ5A 4J9MA 1HUZA 2M2UA 2ZJAA 4QZCA 4DQPA 3OVBA 4GC6A 4M6WA 5CP2A 5J2BA 4XRHA 1L3VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q8L A;  3JPN A;  1SKR A;  1RPL A;  4ELU A;  4ED3 A;  4X4P A;  1WCN A;  4NLZ A;  8ICK A;  2JZB B;  5F9L A;  4F5P A;  3RTV A;  4QZF A;  5CB1 A;  4O9M A;  5KT4 A;  9ICO A;  4DL6 A;  9ICW A;  7ICS A;  3EPG A;  5KG7 A;  4I27 A;  4DSK A;  2ZH2 A;  4GXI A;  4Z6D A;  7ICN A;  3TQ1 A;  1X9S A;  3ISC A;  4TQS A;  4YXJ A;  4EYH B;  4RQ2 A;  4KLU A;  5DLG A;  5DBC A;  4DQS A;  2M2W A;  3JPO A;  1RXW A;  4M2Y A;  3KTQ A;  4J9S A;  5HRD A;  3RB0 A;  9ICG A;  3QEB Z;  1ZJM A;  2XCA A;  1D8Y A;  3H37 A;  2DR7 A;  2W9B A;  4UB5 A;  3AUO A;  3V72 A;  3QE9 Y;  2VA3 A;  1SL0 A;  5D46 A;  5KFO A;  3AU6 A;  3M8R A;  1X9M A;  4O3R A;  9ICB A;  4R65 A;  5HHH A;  4EBJ A;  1U45 A;  2NRT A;  5DQG A;  2R8G A;  5J29 A;  5HRH A;  1OU5 A;  5KFG A;  5KFN A;  5KFT A;  4YR0 A;  4I2J A;  1U49 A;  1SKS A;  5J0S A;  1S97 A;  3JPT A;  1NJW A;  4LZG A;  3MR6 A;  3H7I A;  1TFR A;  4J9P A;  2HHW A;  3HW8 A;  3PW7 A;  3RJJ A;  4P4M A;  4HYK A;  3PV8 A;  2IHM A;  3UXO A;  5KFD A;  4CCH A;  4R66 A;  4WCW A;  1ZET A;  3MBY A;  9ICR A;  2XGP A;  1V4A A;  1B43 A;  1TAU A;  4KLS A;  3C2K A;  9ICT A;  5J0W A;  4TUS A;  5JUM A;  4RPZ A;  5J2E A;  1TK5 A;  1T7P A;  9ICK A;  1ZQG A;  4Z6F A;  5HNK A;  1S0N A;  3LQC B;  1NKC A;  1Q79 A;  4YD1 A;  3H4D A;  8ICZ A;  2BE3 A;  1NK8 A;  3HX0 A;  2PFN A;  4YCX A;  2W9C A;  2ASL A;  4M9G A;  4DOC A;  1BNO A;  4E7X A;  4X4R A;  2AJQ A;  1N56 A;  9ICU A;  4X4S A;  2J6S A;  5KFJ A;  2Y1J A;  5KFF A;  2AQ0 A;  4ED0 A;  2VA8 A;  2ZUC A;  4RNN A;  3C5G A;  3RR7 A;  4QWD A;  4I29 A;  4ED6 A;  1HUO A;  1XWL A;  5KFS A;  4RQ1 A;  4QZI A;  5HML A;  5KFU A;  3SV3 A;  2OWO A;  3PX6 A;  4NKT A;  3B0X A;  4DLE A;  1L3S A;  4S3N A;  4IQT A;  2R8I A;  1H38 A;  5DDY A;  1KDH A;  4GLX A;  7ICL A;  2W9M A;  3RB6 A;  4O3N A;  2UVR A;  4F4Y A;  3SV4 A;  1U48 A;  4BDP A;  1ZQH A;  5HC9 A;  4NKU A;  9ICC A;  4GC7 A;  4QZB A;  4KLO A;  1L3T A;  4KLI A;  5KG2 A;  4X0A A;  3C66 A;  1ZQX A;  4IRD A;  7ICP A;  1ZQV A;  5J2H A;  1L5U A;  4PGQ A;  1X2I A;  2W8K A;  4FH5 A;  1ZJN A;  4YQW A;  3RH5 A;  5IIK A;  4DWI A;  3HWT A;  1NK0 A;  9ICS A;  5J2D A;  2F1I A;  5KG1 A;  4YN4 A;  4ECW A;  2J6U A;  3JZ0 A;  5KFI A;  2JEF A;  4I2G A;  4RQ5 A;  1R89 A;  5HR9 A;  5EWF A;  5J0O A;  3NYB A;  4FBU A;  2C28 A;  3BQT A;  5J2A A;  3MR3 A;  1QSS A;  4F2S A;  3BJY A;  4B9M A;  4EZ6 A;  2HHS A;  1L3U A;  5KFA A;  5BOL A;  4NM2 A;  4DQI A;  4KLM A;  4YVZ A;  3UQ0 A;  4UB1 A;  8ICC A;  4O3Q A;  5HRF A;  3H8J A;  7ICQ A;  5L1I A;  3RJK A;  3M9M B;  4J9L A;  1DGS A;  4TUP A;  2O1P A;  4RUA A;  1ZQP A;  3V7K A;  5F9N A;  1S76 D;  4FHV A;  2MUT A;  2BQR A;  5KFW A;  2V4R A;  4F5O A;  3OGU A;  3EZ5 A;  2C2R A;  2IMW P;  4I2F A;  3RAX A;  2KTQ A;  4RPX A;  4YP3 A;  4DFM A;  2ASD A;  4YMN A;  4ED2 A;  4E80 A;  9ICV A;  4PPX A;  4UQG A;  1TVA A;  4QZA A;  4F4K A;  5KFX A;  4IG8 A;  5L1J A;  2XY7 A;  1T4G A;  4NLK A;  4AT8 B;  4Q43 A;  4EBK A;  3C2M A;  4B9L A;  2NRZ A;  4QZD A;  3BQ1 A;  2C22 A;  4MFC A;  1KFT A;  2XCP A;  3GIK A;  3RH4 A;  4JK1 A;  3OSN A;  7ICU A;  5HRB A;  2V4Q A;  1LV5 A;  2HHP A;  4RZR A;  5DGA A;  4KLG A;  4YR2 A;  3KHL A;  1HJP A;  4B9U A;  3Q8M A;  4UD5 A;  5IIL A;  5BPC A;  5DGB A;  7ICT A;  5DBB A;  2ISO A;  5DB6 A;  3BDP A;  3AQN A;  1D9D A;  5IIM A;  3C2L A;  3N4M B;  3WFQ E;  4Q44 A;  1F5A A;  1NK4 A;  4DL7 A;  3G6Y A;  5HHI A;  1RXV A;  4M04 A;  5HRL A;  5J0U A;  2M9N A;  3PW5 A;  1FA0 A;  4RPY A;  2ASJ A;  1KFS A;  4PHD A;  1UT5 A;  2ID1 A;  4KLH A;  1A77 A;  4Z6E A;  4RNM A;  4BXO B;  4JV0 A;  1KFD A;  1ARO P;  5J0Y A;  1NK9 A;  2FMQ A;  3RJG A;  4G3I A;  3MAB A;  3UPQ A;  4EZ9 A;  4WC3 A;  1BPZ A;  4R8U B;  5KG6 A;  3QEA Z;  9ICN A;  3H3A A;  8ICT A;  2BCQ A;  4ATB A;  4RQ3 A;  3K4G A;  4NY8 A;  1MSW D;  2NRV A;  4XUS A;  3ETL A;  4RU9 A;  2ZH5 A;  3PR5 B;  3QZ8 A;  3LWM A;  2AU0 A;  4F4W A;  2NRX A;  5KTQ A;  2ZJ8 A;  4ECT A;  4P4O A;  3GV8 B;  8ICM A;  5DEC A;  3ZDD A;  4FBT A;  1TAQ A;  1DK2 A;  4DSF A;  3PO4 A;  2FLP A;  4J9Q A;  1JXL A;  1K1S A;  5IIN A;  3C1Z A;  1NK5 A;  4M9N A;  1MIY A;  2PBE A;  5DB7 A;  1XSP A;  5EWG A;  4ECU A;  1VJ7 A;  1ZQY A;  4ED8 A;  2VA2 A;  2HHQ A;  4B9V A;  1D9F A;  2BCU A;  4IR1 A;  2JEJ A;  2FPK A;  3GDX A;  5J2J A;  1BNP A;  2DFL A;  5L1L A;  4F3O A;  8ICJ A;  2KFZ A;  3NGD A;  1ZQE A;  5KFB A;  2FMP A;  2JEI A;  4DOB A;  2DR9 A;  9ICP A;  2B21 A;  2H5X A;  1Z00 A;  2ZTE A;  3V6H A;  4DL2 A;  2BGW A;  5CHG A;  2R8H A;  3UXN A;  5J0P A;  4FO6 A;  5J0R A;  3RB3 A;  1S10 A;  4XQ8 A;  1RYR A;  3V6J A;  4DQR A;  3RB4 A;  3OSP A;  1ZQB A;  3ZDA A;  8ICN A;  2P6R A;  5HP4 A;  4AT9 B;  4X4Q A;  8ICV A;  5KFL A;  4RQ4 A;  4X5V A;  4J9K A;  7ICI A;  2F1J A;  3SYZ A;  1R8B A;  4F50 A;  4WC0 A;  4F91 B;  3NTU A;  3RJH A;  3RR8 A;  2RDI A;  4GXK A;  1MIW A;  4ED7 A;  8ICE A;  4KLL A;  3C18 A;  1B22 A;  3LDA A;  4PGX A;  3E2E A;  1UA0 A;  3HJ1 A;  1MC8 A;  4ZH4 A;  3WFP A;  2RDJ A;  4DSE A;  4IQW A;  4JV1 A;  8ICB A;  4X4U A;  4DL3 A;  4KLT A;  2HW3 A;  4F92 B;  3ZDE A;  2JEG A;  8ICY A;  2DVI A;  2HHV A;  4UD4 A;  1UT8 A;  2XGQ A;  2BHN A;  4YG2 A;  5KT6 A;  4PHA A;  2BPG A;  4QW9 A;  1KEJ A;  1NJY A;  4I2A A;  7ICG A;  4UB4 A;  1KSP A;  2W9A A;  3AQM A;  1SL2 A;  3RRG A;  4WBZ A;  2JZB A;  4YXM A;  4KN7 A;  4QZ9 A;  3OVS A;  3KHR A;  4Q45 A;  9ICJ A;  4JWN A;  4WC4 A;  3JPS A;  2ATL A;  1DK3 A;  2UVV A;  4AT7 B;  5HRE A;  2BKE A;  5EWE A;  3EYZ A;  8ICO A;  2A1J B;  2BCV A;  8ICQ A;  4K4H A;  1BGX T;  2Q0Z X;  3PVX A;  1UET A;  4RWP A;  1ZQF A;  4F93 B;  1NZP A;  5HRI A;  4J9N A;  3EWA A;  5KFQ A;  3MR5 A;  3LK9 A;  1ZQR A;  4K4G A;  5CR0 A;  4GXJ A;  4RWN A;  4F2R A;  4DEZ A;  3TAN A;  2VAN A;  1Z3E B;  3Q8R B;  4DFP A;  4I28 A;  2KP7 A;  2M2V A;  1S77 D;  3Q8K A;  1U47 A;  4ECV A;  3PX4 A;  4DO9 A;  8ICW A;  2HHU A;  3H8W A;  1T3N A;  5J2K A;  4QZH A;  4NLN A;  4UBB A;  4R63 A;  1NJX A;  1NOM A;  4IRK A;  1KRP A;  1BPD A;  4WC2 A;  1XU4 A;  4EEY A;  3M9N B;  4FHY A;  4RQ7 A;  4DL5 A;  1ZYQ A;  2J6T A;  4WC7 A;  4J9R A;  4M6W B;  3GV7 B;  4LT6 A;  4K4I A;  4MF8 A;  2ZH7 A;  3GFK B;  3TAR A;  3M9O B;  2NRK A;  4WC6 A;  4UB3 A;  1ZQK A;  4DQQ A;  1N48 A;  4PHE A;  4DOA A;  1ZQJ A;  3OJU A;  2BDP A;  8ICP A;  4RT3 A;  8ICA A;  9ICI A;  3IM1 A;  2F1H A;  9ICE A;  4IQV A;  2AGP A;  2KN7 A;  1PX5 A;  4YMM A;  3OHA A;  1BPX A;  3QZ7 A;  2BPC A;  2ZH8 A;  5DG7 A;  4UBC A;  1JQR A;  1XC9 A;  4C8N A;  4KLQ A;  3K75 D;  1U4B A;  1MQ3 A;  3RBD A;  5KT2 A;  2ZUB A;  5DED A;  1S9F A;  7ICF A;  4PH5 A;  5J2C A;  3Q8Q B;  3M8S A;  5TZV A;  4ECQ A;  3N97 B;  3PW4 A;  2DRA A;  1ZQC A;  2I9G A;  2DR5 A;  2PI4 A;  1JXE A;  5D49 A;  3C1Y A;  4DFJ A;  2KZZ A;  1NKE A;  4MFF A;  4X0B A;  3OVA A;  4WBY A;  1COO A;  3C23 A;  1KTQ A;  5KT7 A;  4EBD A;  3MDC A;  3UQ2 A;  4ELT A;  4Q8E A;  1Q78 A;  3WFS C;  3JPQ A;  1PZN A;  4NXZ A;  2V9W A;  1CEZ A;  1ZQT A;  4YMO A;  4DFK A;  1BPY A;  2HHT A;  1S0M A;  3AQL A;  4KIT B;  1ZQM A;  1ZQU A;  4M0A A;  2BQ3 A;  1DOQ A;  3T5K A;  2AGO A;  2UVU A;  2R8K A;  3RBE A;  4KLD A;  3OV7 A;  2DRB A;  1UA1 A;  5KFP A;  1MIV A;  4BWM A;  4ECX A;  1Y88 A;  4TUR A;  2Q66 A;  4BWJ A;  2P66 A;  2R8J A;  1NJZ A;  5D4B A;  1KLN A;  4M9J A;  1ZQN A;  4B9N A;  4F8R A;  4DLG A;  2HVI A;  9ICQ A;  1R8C A;  1NO5 A;  7ICK A;  4M5D A;  1QLN A;  3V7L A;  5DQI A;  3T5J A;  3TFS A;  4ECR A;  3AQK A;  4M9L A;  3ZD8 A;  5KT5 A;  1SKW A;  4O5K A;  4WC5 A;  2LYH A;  5KFE A;  1D8L A;  3C21 A;  4FS1 A;  3RJI A;  3HIY A;  2ZH4 A;  2W9C B;  3GQC A;  3EPI A;  4LVS A;  1NK6 A;  1TFY A;  5DQH A;  4RWO A;  3HPO A;  3FDS A;  2O5A A;  2Y1I A;  2XC9 A;  3Q8S B;  4KLE A;  4F5R A;  3OHB A;  2ZH9 A;  4QW8 A;  3MFI A;  2IBK A;  8ICI A;  4QWE A;  4IR9 A;  4X4N A;  1JMS A;  1XSL A;  4WC1 A;  5DG9 A;  5KFY A;  5L1K A;  1R8A A;  5BOM A;  5KT3 A;  4Q8F A;  2IHN A;  4I2D A;  5KG4 A;  3H4B A;  8ICH A;  4MFA A;  2ZHA A;  4NM1 A;  4PGY A;  4LZD A;  2XY5 A;  1NKB A;  4O5E A;  5HRG A;  4QWC A;  3GII A;  4F4X A;  3PW2 A;  3SI8 A;  3RJF A;  2BR0 A;  2ZUD A;  3MGI A;  4FHP A;  2DPJ A;  4AT8 A;  1ZQW A;  1QSY A;  1TFW A;  2KZM A;  4X4V A;  3V7J A;  5HRK A;  2BCR A;  5DDM A;  4KTQ A;  5J2F A;  4C8K A;  4O3S A;  4QZG A;  7ICJ A;  2PI5 A;  2KFN A;  3PML A;  3H38 A;  4FH3 A;  5C5J A;  5KFR A;  3TFR A;  3PO5 A;  4FS2 A;  8ICR A;  1WOT A;  2MAX A;  4UAY A;  5DLF A;  1XSN A;  8ICF A;  2AGQ A;  4QZE A;  4F5Q A;  3MDA A;  4I2H A;  5DKW A;  1K1Q A;  4DF8 A;  3ZDB A;  1VFG A;  1ZQI A;  1ZQO A;  3JPR A;  3KHH A;  3UXP A;  1CUK A;  3BQ0 A;  4X4T A;  4JUZ A;  1ZQL A;  1JN3 A;  2IA6 A;  4X4O A;  3GV5 B;  5KFM A;  3PR4 A;  7ICH A;  3OJS A;  4J9O A;  4DS4 A;  4ELV A;  4E0D A;  4BXO A;  2BPF A;  4I2B A;  2XY6 A;  4M47 A;  3H39 A;  5J0T A;  4ECZ A;  7ICV A;  2MUT B;  4R8U A;  1ZQA A;  3ZDC A;  1RYS A;  2M2T A;  4XQ7 A;  3H40 A;  1NK7 A;  4RT2 A;  7ICM A;  5III A;  2HHX A;  3RH6 A;  9ICL A;  4QZ8 A;  3MGH A;  3T5H A;  2FPM A;  4MEY A;  3ZD9 A;  4ECS A;  3RRH A;  1IM4 A;  3TAQ A;  1S0O A;  4MEX A;  4FHW A;  2ZH1 A;  4DL4 A;  3PNC A;  2PFP A;  2UVW A;  1V9P A;  2GWS A;  5DB9 A;  2XO7 A;  4C8L A;  2W8L A;  9ICF A;  4YR3 A;  9ICH A;  3T3F A;  3TI0 A;  4EP7 A;  4I2I A;  3GIJ A;  1LB2 B;  5KFZ A;  1IXR A;  3JPP A;  2ISP A;  4O0I A;  3IHQ B;  2PFQ A;  5KFV A;  4QWA A;  4O5C A;  1QSL A;  2WTF A;  1EXN A;  1SZP A;  4XA5 A;  2PFO A;  5KG0 A;  4DSJ A;  1YLQ A;  1TK0 A;  3WFR E;  2ZHB A;  5EOZ A;  2NRW A;  1ZQQ A;  9ICA A;  3C5F A;  1JX4 A;  3RAQ A;  2RFF A;  1ZQD A;  4AT7 A;  4ECY A;  8ICX A;  1U9L A;  3EW9 A;  4R64 A;  1UEV A;  4AT9 A;  4JWM A;  5F2V O;  1T8E A;  1JIH A;  5KG5 A;  4ATB B;  1XS9 D;  7ICR A;  3PMN A;  8ICL A;  4RWQ A;  3ISD A;  4RQ0 A;  1SL1 A;  4P2H A;  4MF2 A;  5DBA A;  4I2E A;  3OUY A;  4UB2 A;  4UAW A;  2ZH3 A;  4EYI B;  3PW0 A;  4C8M A;  4BGD A;  3HT3 A;  3SZ2 A;  2BCS A;  5CWR A;  3MFH A;  3GIL A;  5KG3 A;  2ALZ A;  3PY8 A;  4O3P A;  1C7Y A;  3AU2 A;  3G6X A;  4QWB A;  4F5N A;  5DG8 A;  5KFH A;  5CA7 A;  4Z6C A;  3H8S A;  4KN4 A;  3BQ2 A;  2C2E A;  1RZT A;  3L9D A;  2DR8 A;  2ZTD A;  3ORY A;  5HMM A;  5DB8 A;  2FPL A;  5CJ7 A;  5J0Q A;  4RQ8 A;  2W9B B;  5J2I A;  4ED1 A;  2I1Q A;  3T5L A;  2FLN A;  4DSL A;  9ICX A;  4KLF A;  3GIM A;  3MR2 A;  1TV9 A;  1X9W A;  4I2C A;  2P6U A;  4UAZ A;  4P4P A;  2HVH A;  5J2G A;  4B9S A;  4KLJ A;  3FYH A;  4JV2 A;  4F4Z A;  4KMU A;  4E8F A;  1JAJ A;  5KFK A;  3JYY A;  3PX0 A;  2BQU A;  5IIJ A;  1BVS A;  4DSI A;  4TQR A;  3Q8P B;  1S0V A;  2A1J A;  1A76 A;  3LWL A;  1Z00 B;  7ICE A;  7ICO A;  1BPE A;  1XO1 A;  4RUC A;  5KFC A;  4C8O A;  4FHX A;  3THV A;  3B0Y A;  2AQ4 A;  4NLG A;  3V6K A;  2C2D A;  1MQ2 A;  1KNY A;  3OUY B;  4O3O A;  3KHG A;  3ISB A;  3HJ4 A;  5J0X A;  2ZH6 A;  4EBE A;  4TUQ A;  4IQU A;  4DS5 A;  2ZTC A;  3G6V A;  2FMS A;  1ZQS A;  4PHP A;  9ICM A;  4EBC A;  4B9T A;  5L9X A;  1TKD A;  8ICS A;  1ZQZ A;  4YFK A;  2PXI A;  2FLL A;  5IIO A;  3HP6 A;  1WCL A;  4DF4 A;  1TK8 A;  2DPI A;  4IRC A;  8ICU A;  4RNO A;  3UPS A;  3WFO A;  4RQ6 A;  1UEU A;  1BPB A;  1QTM A;  3RJE A;  8ICG A;  4M9H A;  3TAP A;  2KZ3 A;  4YD2 A;  2ZJ5 A;  4J9M A;  1HUZ A;  2M2U A;  2ZJA A;  4QZC A;  4DQP A;  3OVB A;  4GC6 A;  4M6W A;  5CP2 A;  5J2B A;  4XRH A;  1L3V A; 
#chains in the Genus database with same CATH topology
 3Q8L A;  3JPN A;  1SKR A;  2OM6 A;  1RPL A;  3RFA A;  5GTI U;  4QZF A;  1KQQ A;  9ICW A;  4DL6 A;  5KG7 A;  4Z6D A;  3CW2 C;  1X9S A;  4NXV A;  3ISC A;  4YXJ A;  4EYH B;  4KLU A;  2M2W A;  3KTQ A;  3QU5 A;  3D2N A;  1ZJM A;  4K98 A;  5ALH A;  3V72 A;  3OTQ A;  3QU9 A;  2KMD A;  4O3R A;  2IHO A;  2EDU A;  4Y2R A;  5HR7 A;  2PMZ C;  5KFG A;  3IG8 A;  5KFT A;  5KFN A;  1T3Q A;  5ALI A;  3HW8 A;  3PW7 A;  4P4M A;  1SGG A;  5KFD A;  1ZET A;  2RRD A;  9ICR A;  1B43 A;  1MA7 A;  3SMV A;  1RQL A;  9ICK A;  4Z6F A;  2B4V A;  4US9 A;  3M6Z A;  2AJQ A;  2J6S A;  2Y1J A;  4QWD A;  4ED6 A;  5HML A;  5KFU A;  1H38 A;  1X6J A;  1LKY A;  2YQE A;  2YY6 A;  3SV4 A;  1B0X A;  3WKC A;  9ICC A;  5F3X B;  4GC7 A;  4KLI A;  1ZOL A;  2NO4 A;  2A3V A;  2W8K A;  2Z7J A;  4PL1 A;  9ICS A;  2LBO A;  4WQL A;  5HR9 A;  2ZIX B;  5J2A A;  3BJY A;  4B9M A;  1SIJ A;  3N7R C;  1L3U A;  4YVZ A;  3D2S A;  5L1I A;  5J8Y C;  4J9L A;  3F5E A;  1O03 A;  2MUT A;  2BQR A;  4F5O A;  3EZ5 A;  4I2F A;  2KTQ A;  4KB6 A;  3QUQ A;  4YMN A;  5KFX A;  2XI9 A;  2E1F A;  4IG8 A;  5L1J A;  2XY7 A;  1T4G A;  3N7P D;  4NLK A;  4EBK A;  2KD1 A;  1COK A;  1Z19 A;  5D63 A;  3GIK A;  4O69 A;  4YR2 A;  4OJO A;  4BUG A;  5G5H A;  5BPC A;  2LYA A;  7ICT A;  2ISO A;  3N4M B;  1F5A A;  2FI1 A;  1JAL A;  2DL0 A;  1NNL A;  4M04 A;  5J0U A;  2ID1 A;  4PHD A;  1UT5 A;  2VJ4 A;  1DGJ A;  4G3I A;  3MAB A;  3TAD C;  3UPQ A;  4WC3 A;  4ATB A;  2BCQ A;  2FE9 A;  3NWI A;  1O08 A;  4RQ3 A;  2LYB A;  3FAH A;  2NRV A;  3ETL A;  5AI8 A;  4RU9 A;  3QZ8 A;  1RYU A;  2NRX A;  5KTQ A;  2ZJ8 A;  5DEC A;  4IS7 A;  1J97 A;  4NWI A;  5E79 U;  3UMC A;  2I5H A;  4WQK A;  5DB7 A;  1VLB A;  4ECU A;  2YML A;  4CF3 A;  4ED8 A;  3HIL A;  4B9V A;  1D9F A;  1X9X A;  2JEJ A;  5L1L A;  2W7O A;  2B21 A;  4DL2 A;  5ALJ A;  2BGW A;  1RYR A;  1F44 A;  3UXN A;  5GTH U;  7ICN A;  8ICN A;  9ICL A;  4X0A A;  4X4Q A;  2G07 A;  5KFL A;  4RQ4 A;  7ICI A;  4F50 A;  4F91 B;  3RJH A;  2RDI A;  3H0L B;  5ALK A;  8ICE A;  5G5G A;  4NXT A;  1MC8 A;  4ZH4 A;  4X4U A;  2RDJ A;  4O68 A;  1UT8 A;  1V38 A;  4PHA A;  2BPG A;  4I2A A;  7ICG A;  2WAQ C;  3AQM A;  4QZ9 A;  5AK5 A;  4GIB A;  1DK3 A;  5EWE A;  3EYZ A;  8ICO A;  1WYG A;  3C29 A;  3QU7 A;  4UAU A;  1UET A;  4RWP A;  4J9N A;  5KFQ A;  3LK9 A;  4J03 A;  1XO0 A;  5KAI U;  3F53 A;  1ZQR A;  4K4G A;  4GXJ A;  4F2R A;  2E8O A;  2KP7 A;  3Q8R B;  2M0N A;  5J2K A;  4UBB A;  2HI0 A;  4IRK A;  2AHO B;  4C7Z A;  4FHY A;  4RQ7 A;  2VKQ A;  4DL5 A;  2ZG6 A;  4LT6 A;  2K4E A;  4EED A;  2NRK A;  3NVW A;  1N48 A;  2IUB A;  4DOA A;  8ICP A;  3L3F X;  8ICA A;  3IM1 A;  3ED5 A;  3VCB A;  1PX5 A;  3DEE A;  4KLQ A;  3K75 D;  1U4B A;  7ICF A;  5EE0 A;  3M8S A;  5TZV A;  3PW4 A;  2DR5 A;  2PI4 A;  3C1Y A;  2LM4 A;  2KJ5 A;  3UQ2 A;  1Q3V A;  3SAH A;  1BPY A;  1ZQU A;  5ALW A;  2R8K A;  1DOQ A;  2UVU A;  4KLD A;  4M0A A;  3QU4 A;  5KFP A;  2JGA A;  4ECX A;  2R8J A;  2RQ5 A;  5D4B A;  4OAF A;  4F8R A;  1P7D A;  1R8C A;  7ICK A;  4QJF B;  4OJ5 A;  4Y2V A;  4M9L A;  2QAR A;  5KT5 A;  1SKW A;  2K8C B;  4UB6 U;  4O5K A;  2EAP A;  4FS1 A;  3EPI A;  1KKX A;  1TFY A;  4OJ6 A;  5ALN A;  2RP5 A;  5DQH A;  4KLE A;  3Q8S B;  4F5R A;  5FP0 A;  2E8N A;  2K4P A;  4QW8 A;  3OHB A;  3MFI A;  2IBK A;  4QWE A;  3PZP A;  1R8A A;  5KG4 A;  8ICH A;  2XY5 A;  2QB0 A;  5AI5 A;  3PW2 A;  1N5W A;  1ZD3 A;  1J2N A;  1ZQW A;  4X4V A;  5DDM A;  4C8K A;  2KHQ A;  1OW5 A;  3PO5 A;  1SV0 A;  4CE6 A;  1X66 A;  1WOT A;  2AGQ A;  1K1Q A;  3N7S C;  4CDG A;  5B66 U;  5AM3 A;  3BQ0 A;  3NVV A;  1ZQL A;  4X4O A;  3GV5 B;  3CP8 A;  3PR4 A;  4E0D A;  4EEN A;  4BXO A;  3H39 A;  4ECZ A;  2K8A A;  2W54 A;  3ZDC A;  7ICM A;  5ALU A;  5III A;  2HHX A;  3MGH A;  2FPM A;  1S0O A;  4ECS A;  4FHW A;  2E8P A;  4MEX A;  4DL4 A;  3AEV A;  4OJL A;  2MA1 A;  2PFP A;  5ALS A;  5CEH A;  2GWS A;  4BJQ A;  1VDV A;  5JTG A;  1Q8K A;  4JLZ A;  1KL9 A;  4EP7 A;  4I2I A;  2W03 A;  3GIJ A;  3IHQ B;  5KFV A;  5ALP A;  2WTF A;  3WFR E;  3C5F A;  2GOL A;  5AKY A;  1LVH A;  4AT7 A;  1UEV A;  1NZB A;  4KM5 A;  2E5S A;  4I2E A;  4UAW A;  4EYI B;  3PW0 A;  3HT3 A;  5CWR A;  3GIL A;  2OCE A;  1ZD2 P;  3G6X A;  2F76 X;  5DG8 A;  5CA7 A;  1RZT A;  3L9D A;  1GO3 F;  5HMM A;  5DB8 A;  2W9B B;  4NY8 A;  5J2I A;  3WFS C;  3KKA C;  2OEH A;  3GIM A;  1TV9 A;  3PSF A;  2P6U A;  4P4P A;  1N62 A;  3FYH A;  4JV2 A;  2KIV A;  2JV3 A;  5ALZ A;  4O6A A;  4TQR A;  2A1J A;  1A76 A;  5F2V O;  1Z00 B;  1VFG A;  1BPE A;  4FHX A;  4PZO A;  5KFC A;  1F0M A;  2EH9 A;  3B0Y A;  3OUY B;  1MQ2 A;  3AQF A;  1JRO A;  4DS5 A;  2ZTC A;  2FMS A;  4B9T A;  8ICS A;  2FLL A;  2PXI A;  5IIO A;  4DF4 A;  4M9H A;  2KZ3 A;  4YD2 A;  4FZL A;  3N28 A;  4C4S A;  4QZC A;  4DQP A;  5CP2 A;  5J2B A;  3NUQ A;  1FFU A;  2R18 A;  5AK6 A;  8ICK A;  2JZB B;  3RTV A;  5CB1 A;  4O9M A;  9ICO A;  4DSK A;  2ZH2 A;  4GXI A;  3I76 A;  4DQS A;  2ZIU A;  3JPO A;  1D8B A;  9ICG A;  4NXX A;  2DR7 A;  3AUO A;  3ER9 B;  3QE9 Y;  2E8M A;  5D46 A;  5KFO A;  3AU6 A;  4R65 A;  5HHH A;  1SXE A;  5DQG A;  2R8G A;  3LVW A;  2KOB A;  1WWV A;  4YR0 A;  4I2J A;  5JU5 A;  1S97 A;  3JPT A;  1NJW A;  4LZG A;  3MR6 A;  5AI0 A;  1OXJ A;  1WG8 A;  3MBY A;  4WH5 A;  2RLT A;  1SZH A;  2G09 A;  1SV0 C;  2XGP A;  9ICT A;  2PKE A;  4LJX A;  5J2E A;  1TK5 A;  1T7P A;  1Q79 A;  3F2B A;  1NKC A;  3H4D A;  8ICZ A;  3HX0 A;  2ASL A;  1N56 A;  2MSN A;  2AQ0 A;  4RNN A;  1WWU A;  2E1E A;  2HHQ A;  4RQ1 A;  3RF9 A;  4QZI A;  4S3N A;  5JTI A;  3B0X A;  3UMG A;  4IQT A;  5DDY A;  4P0P A;  3RB6 A;  4OJP A;  4F4Y A;  1Q3U A;  4BDP A;  1ZQH A;  4QZB A;  2YN4 A;  2KK0 A;  1L3T A;  3C66 A;  1ZQX A;  4NLB A;  4MHV A;  1X2I A;  3NRW A;  4FH5 A;  3RH5 A;  1NK0 A;  4Y2Y A;  5KG1 A;  4YN4 A;  5J2D A;  3NS1 A;  5KFI A;  2JEF A;  4I2G A;  4RQ5 A;  1R89 A;  3WK9 A;  3MR3 A;  1QSS A;  4EZ6 A;  2HHS A;  4FFD A;  2WF7 A;  5BOL A;  4DQI A;  4UB1 A;  5HRF A;  4EEK A;  4EX6 A;  3RJK A;  3BZC A;  1DGS A;  1SXD A;  5EE9 A;  1S76 D;  3V7K A;  2KNJ A;  3OGU A;  2IMW P;  3LVV A;  5D62 A;  4ED2 A;  4PPX A;  4UQG A;  4F4K A;  2MRL A;  4AT8 B;  4Q43 A;  4B9L A;  1QCK A;  2NRZ A;  1KBU A;  2C22 A;  3ZI4 A;  4UAR A;  3CK6 A;  3OSN A;  5EE3 A;  4RZR A;  4PZN A;  5AHX A;  3Q8M A;  4OCZ A;  4LEV A;  2H3I A;  3WK8 A;  1D9D A;  3C2L A;  3J81 j;  3WFQ E;  2ES6 A;  4Q44 A;  5HHI A;  2GO7 A;  2M9N A;  4RPY A;  2JH1 A;  4KLH A;  4RNM A;  1BNP A;  1ARO P;  5KG6 A;  4C0Z A;  3QEA Z;  8ICT A;  1UQV A;  1L7P A;  1MSW D;  3GZF A;  2ZH5 A;  3PR5 B;  3LWM A;  4F4W A;  3GV8 B;  1SB3 C;  1TAQ A;  4DSF A;  2FLP A;  5IIN A;  1MIY A;  5EWG A;  3TKA A;  3TAC B;  2W3S A;  1PK1 A;  2FPK A;  3GDX A;  5J2J A;  2DFL A;  8ICJ A;  5B5E U;  3NGD A;  2KFZ A;  2F8L A;  2H5X A;  2B0C A;  4FO6 A;  8ICI A;  1S10 A;  1ZQB A;  4N7R A;  4AT9 B;  2P6R A;  1YZ6 A;  1S5L U;  4QIW F;  1R8B A;  3NTU A;  3RR8 A;  4ED7 A;  1UA0 A;  4IC9 A;  3HJ1 A;  4K99 A;  3KOO A;  4KX3 A;  4IQW A;  2LI6 A;  4DSE A;  4JV1 A;  8ICB A;  4KLT A;  2HW3 A;  4F92 B;  3ZDE A;  4CF5 A;  4UD4 A;  2HDO A;  4YG2 A;  2KG5 A;  4KN7 A;  2KSO A;  4Q45 A;  3SR6 A;  2ATL A;  2UVV A;  2BKE A;  4K4H A;  2Q0Z X;  3NVY A;  4F93 B;  2D6F C;  1S8O A;  4NL9 A;  2K60 A;  1IG6 A;  2VAN A;  4B6J A;  1Z3E B;  2M2V A;  4DFP A;  4I28 A;  2W43 A;  4DO9 A;  8ICW A;  2EAM A;  3H8W A;  3NKU A;  1NOM A;  1BPD A;  2KVC A;  4OAH A;  2ZH7 A;  3GFK B;  3M9O B;  1L7M A;  3HRD D;  4PHE A;  1NI3 A;  3OJU A;  1ZQJ A;  2F1H A;  4UAS A;  2ODG A;  2Y0S F;  4ZOH C;  4YMM A;  1YT3 A;  1XC9 A;  1MQ3 A;  3RBD A;  5KT2 A;  2ZUB A;  4P0Q B;  4PH5 A;  4ECQ A;  1Z1V A;  2HN1 A;  3OVA A;  4MFF A;  4X0B A;  1RQN A;  1M6Y A;  4Q8E A;  1Q78 A;  3MDC A;  3JPQ A;  2EWR A;  5ALM A;  3HJE A;  1ZQT A;  2G06 A;  4DFK A;  5L1M A;  1S0M A;  2W04 A;  3S6J A;  1DRG A;  4BWM A;  4FZM A;  2Q66 A;  2P66 A;  2A19 A;  3HKZ F;  2OH2 A;  2F2A B;  4USA A;  5KL1 B;  4DLG A;  9ICQ A;  2LPE A;  1N61 A;  3IG5 A;  5DQI A;  4CF4 A;  4U7C A;  3AQK A;  2L5Y A;  3ZD8 A;  4AYB F;  1Z4O A;  3RJI A;  2WF5 A;  2WB1 F;  4CNQ A;  1RDF A;  3SQI A;  2HSZ A;  4X4N A;  5KFY A;  2KJ9 A;  2IHN A;  3H4B A;  2ZHA A;  5HRG A;  4QWC A;  3GII A;  3UMB A;  5AKJ A;  3F5A A;  2BR0 A;  3MGI A;  4FHP A;  4MKP A;  2KZM A;  3V7J A;  4G9B A;  5T14 A;  2YB4 A;  4O3S A;  7ICJ A;  3PML A;  3TFR A;  2MAX A;  4UAY A;  5DLF A;  3MDA A;  2DBY A;  2XVT A;  1ZQO A;  3JPR A;  1CUK A;  4JUZ A;  1JN3 A;  7ICH A;  2W11 A;  4RQM A;  4DS4 A;  2GA9 D;  4I2B A;  2XY6 A;  2MUT B;  3QNM A;  4R8U A;  2M2T A;  1B4F A;  5AKK A;  2O6K A;  5ALV A;  4QZ8 A;  3RRH A;  3TAQ A;  3PNC A;  3QUC A;  5DB9 A;  2D3D A;  3JCF A;  2CXY A;  3WK7 A;  3NAS A;  4Y2U A;  5AI9 A;  5KFZ A;  3JPP A;  4O0I A;  2PFQ A;  2AH5 A;  1QSL A;  3ICX A;  4XA5 A;  1SZP A;  2PFO A;  4DSJ A;  1YLQ A;  2K89 A;  1TK0 A;  2ZHB A;  2EQY A;  2NRW A;  2P35 A;  3QUB A;  3K1R B;  3EW9 A;  4ATB B;  1XS9 D;  1SWV A;  2KV2 A;  4RWQ A;  1SV4 A;  4MF2 A;  5DBA A;  5CHE A;  3MC1 A;  1L7O A;  4RWO A;  4F5N A;  2ZIW A;  3BQ2 A;  1L7N A;  2W3R A;  2FPL A;  3T5L A;  5J0Q A;  2FLN A;  4KLF A;  3MR2 A;  1X9W A;  4KLJ A;  5KFK A;  3JYY A;  7ICE A;  3Q8P B;  3LWL A;  4C8O A;  2G5H B;  5HC9 A;  1ECW A;  4UAV A;  4IQU A;  1ZQS A;  4EBC A;  5L9X A;  1ZQZ A;  2HBL A;  2BDU A;  1JRP A;  1JUD A;  2BBJ A;  2DPI A;  2G08 A;  3WFO A;  1UEU A;  3RJE A;  3TAP A;  4XJE A;  1HUZ A;  3GU3 A;  1CI4 A;  5AI6 A;  4M6W A;  4XRH A;  4QIW C;  5AM1 A;  4ELU A;  4ED3 A;  1WCN A;  5F9L A;  5H2F U;  4C4T A;  1IV8 A;  3EPG A;  2DUY A;  1PVQ A;  3TQ1 A;  4TQS A;  4OAI Z;  4RQ2 A;  1Z1B A;  2JH7 A;  4J9S A;  3QEB Z;  2E3T A;  2XCA A;  1D8Y A;  3FM9 A;  2W9B A;  4UB5 A;  1SL0 A;  9ICB A;  2OXO A;  3PSI A;  2NRT A;  5J29 A;  5ALE A;  5J0S A;  1SKS A;  3R9K A;  1TFR A;  2GLE A;  3WKE A;  3RJJ A;  2ZIV A;  4HYK A;  3PV8 A;  2IHM A;  2W7P A;  2Y9U A;  1V4A A;  1TAU A;  3C2K A;  5JUM A;  4RPZ A;  3LQC B;  2ZH4 A;  5HNK A;  2BE3 A;  1NK8 A;  2PFN A;  1BNO A;  4Y2T A;  4YCX A;  2W9C A;  4X4R A;  2KIW A;  4X4S A;  5KFJ A;  4ED0 A;  2VA8 A;  2ZUC A;  4I29 A;  2HBM A;  2OWO A;  2Y0S C;  5CFU A;  3PX6 A;  4NKT A;  1KDH A;  3SEI A;  2UVR A;  5ALQ A;  4US8 A;  3VC8 A;  5KL8 B;  3EUB 2;  4LEZ A;  3QX7 A;  4IRD A;  5J2H A;  1ZJN A;  5IIK A;  4DWI A;  4HX0 A;  2F1I A;  2QB1 A;  4ECW A;  2HOI A;  2J6U A;  2KEY A;  3JZ0 A;  2QAR B;  5J0O A;  3BQT A;  4F2S A;  2B6G A;  5AM5 A;  3UQ0 A;  3HKZ C;  4OO1 J;  3M9M B;  5CFS A;  2Y9T A;  2YMM A;  2O1P A;  1ZQP A;  1Z4N A;  5F9N A;  3I1Y A;  4FHV A;  2V4R A;  4AYB C;  3AQE A;  3RAX A;  4YP3 A;  2QB0 B;  5AKG A;  4DFM A;  2ASD A;  4E80 A;  1TVA A;  1XNS A;  2WB1 C;  2BZF A;  3C2M A;  4QZD A;  4MFC A;  3QXG A;  1KFT A;  3ETR A;  3RH4 A;  4JK1 A;  7ICU A;  1LV5 A;  5DGA A;  4KLG A;  5IIL A;  4DFD A;  3BDP A;  3AQN A;  5IIM A;  1NK4 A;  4DL7 A;  3G6Y A;  1RXV A;  4K8V A;  3PW5 A;  1YZ7 A;  2ASJ A;  2LKY A;  1DXS A;  4BXO B;  4JV0 A;  3RJG A;  4UAT A;  1BPZ A;  4O67 A;  2VJ5 A;  2EAO A;  5AIA A;  2IOH A;  3BS5 A;  1FIQ A;  4FBT A;  4GFJ A;  1DK2 A;  2DKX A;  4J9Q A;  1XSP A;  5ALY A;  3WK5 A;  3SAG A;  2YTU A;  4IL6 U;  2VA2 A;  4CGZ A;  4IR1 A;  1X6I A;  2JEI A;  2FMP A;  5KNI A;  2KVS A;  2WHE A;  2B56 A;  1CRX A;  2DGZ A;  3V6H A;  2R8H A;  5J0P A;  3RB3 A;  4AT7 B;  4XQ8 A;  3OSP A;  4DQR A;  3RB4 A;  3CYM A;  5HP4 A;  2OYY A;  4F71 A;  4J9K A;  2F1J A;  4WC0 A;  1MIW A;  3C18 A;  3LDA A;  3KFU F;  4PGX A;  3KBB A;  2HHV A;  2EZY A;  1FFV A;  5KT6 A;  3M1Y A;  1KEJ A;  1NJY A;  2JHD A;  3F2D A;  2W9A A;  1SL2 A;  1JI7 A;  4JWN A;  4WC4 A;  3JPS A;  4EEB A;  2A1J B;  1N5X A;  3H0R B;  3BQ7 A;  2F44 A;  5HRI A;  4F72 A;  4PL2 A;  5CFT A;  2HBJ A;  3ALR A;  1S77 D;  3Q8K A;  1U47 A;  4ECV A;  3PX4 A;  5ALR A;  4QZH A;  4EEL A;  4R63 A;  4WC2 A;  2Q4T A;  1ZYQ A;  3K1Z A;  5AKL A;  4WC7 A;  4Y2X A;  4J9R A;  3GV7 B;  4K4I A;  5J8Y A;  4MF8 A;  5CRX A;  4BX9 C;  2YX8 A;  4DQQ A;  9ICI A;  4IQV A;  2KN7 A;  4A8E A;  5TIS U;  4Y2S A;  2HCF A;  2ZH8 A;  5DG7 A;  4UBC A;  1JQR A;  3E58 A;  5DED A;  3Q8Q B;  3N97 B;  2FCL A;  2I9G A;  4DFJ A;  2KZZ A;  1NKE A;  1L8O A;  4WBY A;  4ELT A;  2KE7 A;  4EBD A;  5KT7 A;  2QLT A;  2F77 X;  2V9W A;  1RG6 A;  4YMO A;  3AQL A;  4KIT B;  1HEK A;  3OV7 A;  3RBE A;  1UPH A;  2DRB A;  2N1R A;  1MIV A;  1TE2 A;  4TUR A;  4BWJ A;  2MU2 A;  1KLN A;  1ZQN A;  1MN8 A;  1QLN A;  3TFS A;  2ZIX A;  4WC5 A;  1K5O A;  1D8L A;  3C21 A;  3BS7 A;  3FDS A;  1URJ A;  2XC9 A;  3T79 A;  4IR9 A;  1JMS A;  4KMO B;  1FO4 A;  5DG9 A;  1XSL A;  5KT3 A;  3ONN A;  4I2D A;  4P0P B;  4MFA A;  4PGY A;  1N2X A;  3K7D A;  3SI8 A;  2CPR A;  3WKB A;  2DPJ A;  1UCV A;  4P0Q A;  3F2C A;  5J2F A;  2KFN A;  4FH3 A;  3H38 A;  4RQN A;  5KFR A;  8ICR A;  4FS2 A;  4AP9 A;  5AM0 A;  1XSN A;  8ICF A;  4K9A A;  4QZE A;  3A0H U;  4PJ0 U;  5DKW A;  4DF8 A;  3UXP A;  2H3F A;  2IA6 A;  3OWG A;  3M6K A;  1KW4 A;  1PVR A;  4ACO A;  2BPF A;  3L5K A;  5AK3 A;  4I0U A;  2RHF A;  1RYS A;  4XQ7 A;  3QUT A;  3KD3 A;  3H40 A;  4RT2 A;  3RH6 A;  4MEY A;  3IP4 B;  2ZH1 A;  3WKD A;  1ZD5 A;  2UVW A;  1V9P A;  4C8L A;  2W55 A;  2W8L A;  9ICF A;  5AIB A;  9ICH A;  3T3F A;  1IXR A;  2KKP A;  3E0F A;  4QWA A;  4O5C A;  1EXN A;  3AN1 A;  3QU2 A;  2F8K A;  5EOZ A;  1ZQQ A;  9ICA A;  3RAQ A;  2RFF A;  1U9L A;  4R64 A;  1T8E A;  1JIH A;  4NV0 A;  3PMN A;  8ICL A;  3ISD A;  4RQ0 A;  1SL1 A;  4Y2J A;  2ZH3 A;  4C8M A;  3SZ2 A;  2BCS A;  4O3M A;  1FEZ A;  3H8M A;  5KG3 A;  2ALZ A;  3PY8 A;  4O3P A;  4QWB A;  4Z6C A;  2DR8 A;  4KN4 A;  2ZTD A;  4ED1 A;  2WF6 A;  2I1Q A;  5ALL A;  2HVH A;  4I2C A;  1PK1 B;  2F3N A;  5J2G A;  3CRX A;  4B9S A;  1J2M A;  5IIJ A;  4DSI A;  1XO1 A;  4RUC A;  3THV A;  1KNY A;  3V6K A;  4O3O A;  3KHG A;  3ISB A;  3HJ4 A;  5J0X A;  5EE1 A;  1TKD A;  1A0P A;  4RQ6 A;  1BPB A;  1QTM A;  8ICG A;  2ZJ5 A;  2M2U A;  3B9J A;  2ZJA A;  3K4G A;  2NV3 A;  1L3V A;  4X4P A;  4NLZ A;  4F5P A;  1LKY B;  2KSO B;  5AM4 A;  5KT4 A;  3WKA A;  7ICS A;  4EX7 A;  4I27 A;  1IIP A;  2OHF A;  5DLG A;  5DBC A;  1RXW A;  4M2Y A;  5HRD A;  3RB0 A;  3H37 A;  1A6S A;  1QQ7 A;  1VJ5 A;  2VA3 A;  1X40 A;  4K9B A;  1X9M A;  3M8R A;  4EBJ A;  1U45 A;  3PSP A;  4DCC A;  2CRX A;  5HRH A;  1OU5 A;  1U49 A;  1Q46 A;  3H7I A;  3NRZ A;  4J9P A;  2HHW A;  2NO5 A;  4CCH A;  4WCW A;  3UXO A;  4R66 A;  4EV6 A;  4UB8 U;  3IRU A;  3SAF A;  2VIX A;  4KLS A;  5J0W A;  4TUS A;  5AKZ A;  1AQ6 A;  1ZQG A;  2LMR A;  1S0N A;  3H0M B;  4YD1 A;  4E7X A;  4M9G A;  2H3V A;  4DOC A;  2HOQ A;  9ICU A;  4EGW A;  5KFF A;  3C5G A;  3RR7 A;  1HUO A;  1XWL A;  5KFS A;  3SV3 A;  4JMU A;  2DF4 B;  4DLE A;  1L3S A;  4CRX A;  2R8I A;  1KN5 A;  7ICL A;  4GLX A;  2W9M A;  4O3N A;  2B51 A;  1U48 A;  1C20 A;  4NKU A;  4KLO A;  2DWQ A;  5KG2 A;  7ICP A;  1ZQV A;  1L5U A;  5JRT A;  5ALF A;  4PGQ A;  3U26 A;  2GAF D;  3WU2 U;  4NL9 C;  4YQW A;  5K4L A;  3HWT A;  1RM6 C;  3LYS A;  1ZRM A;  2JXJ A;  3NYB A;  5EWF A;  4FBU A;  2C28 A;  2K4I A;  3DV9 A;  4FE3 A;  5KFA A;  4KLM A;  4NM2 A;  8ICC A;  4O3Q A;  3H8J A;  7ICQ A;  5AKE A;  3KKA A;  4TUP A;  3FC4 A;  4RUA A;  5KFW A;  2C2R A;  2K4H A;  4RPX A;  3AL0 B;  1N63 A;  1PUZ A;  9ICV A;  4QZA A;  3PST A;  3BQ1 A;  2XCP A;  2NYV A;  2LHT A;  5HRB A;  2V4Q A;  2HHP A;  3KHL A;  1HJP A;  4B9U A;  4UD5 A;  5DGB A;  4U6P A;  5DBB A;  5DB6 A;  1PK3 A;  1N60 A;  5HRL A;  1FA0 A;  1KFS A;  1A77 A;  4Z6E A;  1KFD A;  5J0Y A;  2FMQ A;  1NK9 A;  4EZ9 A;  2KIC A;  4R8U B;  3H3A A;  9ICN A;  1ZRN A;  3BZK A;  4XUS A;  2AU0 A;  4ECT A;  4UW9 A;  1WUD A;  8ICM A;  4P4O A;  2YB1 A;  1QQ5 A;  2IOF A;  3ZDD A;  4Y2Q A;  3PO4 A;  5AKX A;  1JXL A;  1K1S A;  4C7Y A;  1NK5 A;  3C1Z A;  4M9N A;  2PBE A;  4C80 A;  1VJ7 A;  3IDW A;  1SWW A;  2EAN A;  1ZQY A;  3SD7 A;  2BCU A;  4OAG A;  4F3O A;  1ZQE A;  5KFB A;  4DOB A;  2DR9 A;  3WK4 A;  9ICP A;  3MCR A;  1Z00 A;  2ZTE A;  8ICX A;  3AMZ A;  5A0L A;  5CHG A;  3OUY A;  5J0R A;  3V6J A;  3ZDA A;  8ICV A;  4X5V A;  2WF8 A;  3SYZ A;  2H3Z A;  4C4R A;  1ZQ1 C;  2GH1 A;  3QYP A;  4GXK A;  4KLL A;  3D2Q A;  1B22 A;  3E2E A;  2ZXH A;  3WFP A;  2ZIW B;  4DL3 A;  5AM2 A;  2DVI A;  8ICY A;  2JEG A;  3L4P A;  2ESE A;  2XGQ A;  2BHN A;  4QW9 A;  5ALG A;  4UB4 A;  1KSP A;  4WBZ A;  4KX5 A;  3RRG A;  3OVS A;  1T94 A;  2JZB A;  4YXM A;  3KHR A;  9ICJ A;  2K8B B;  5HRE A;  4LEW A;  2BCV A;  8ICQ A;  1BGX T;  3O0F A;  2PMZ F;  1ED1 A;  3PVX A;  1ZQF A;  1NZP A;  3CNH A;  3MR5 A;  3EWA A;  2FJ6 A;  5CR0 A;  4RWN A;  3D6J A;  4DEZ A;  3TAN A;  5ALO A;  2HHU A;  1T3N A;  4NLN A;  1NJX A;  1KRP A;  1XU4 A;  4EEY A;  3M9N B;  3NVO A;  2J6T A;  4M6W B;  3TAR A;  4WC6 A;  4UB3 A;  1ZQK A;  5C0Y A;  2WFA A;  2XID A;  2BDP A;  4RT3 A;  5AKH A;  9ICE A;  2AGP A;  4FO1 A;  2ZXI A;  4Y2P A;  4NXW A;  3OPX A;  3OHA A;  1BPX A;  3QZ7 A;  2BPC A;  3KZI U;  1QQ6 A;  4C8N A;  5AK4 A;  1S9F A;  5J2C A;  3SEN A;  2DRA A;  2EZZ A;  4ICA A;  1ZQC A;  1JXE A;  5D49 A;  5D61 A;  1COO A;  3C23 A;  1KTQ A;  1TAM A;  1PZN A;  4NXZ A;  1ZXI A;  4WOY A;  1CEZ A;  2HHT A;  2H3Q A;  1ZQM A;  2QKQ A;  2BQ3 A;  3T5K A;  2AGO A;  1UA1 A;  2YMQ A;  2HMX A;  1Y88 A;  3DDH A;  1NJZ A;  2ZIV B;  4M9J A;  2I6X A;  5AKI A;  1HIW A;  2IOF K;  4B9N A;  2HVI A;  1NO5 A;  4M5D A;  3V7L A;  3T5J A;  4ECR A;  1V97 A;  1X42 A;  3M7D A;  5ALT A;  2LYH A;  5KFE A;  3HIY A;  2W9C B;  3GQC A;  4LVS A;  1OUQ A;  4WJ3 B;  3MGV A;  1NK6 A;  3HPO A;  2KJ8 A;  2O5A A;  2Y1I A;  1L6N A;  3I28 A;  1F5S A;  3KZX A;  4NXU A;  2ZH9 A;  4WC1 A;  1ZD4 A;  5L1K A;  5BOM A;  4Q8F A;  1QH9 A;  2EZX A;  4NM1 A;  4LZD A;  1NKB A;  4O5E A;  4F4X A;  3RJF A;  2ZUD A;  2WF9 A;  2LM1 A;  4AT8 A;  1QSY A;  1TFW A;  5HRK A;  2BCR A;  2G5I B;  4KTQ A;  2FDR A;  4QZG A;  2PI5 A;  2HN2 A;  5C5J A;  3PHZ A;  2CN1 A;  4F5Q A;  4I2H A;  3ZDB A;  1ZQI A;  3KHH A;  1L8L A;  4X4T A;  5ALX A;  2BBH A;  4JB3 A;  3IV6 A;  5KFM A;  2JRZ A;  2JR5 A;  4OD0 A;  3OJS A;  4J9O A;  4ELV A;  4FZN A;  2G0A A;  4M47 A;  5KAF U;  5AI4 A;  5J0T A;  4K97 A;  7ICV A;  2JMG A;  1ZQA A;  2XIC A;  1NK7 A;  3T5H A;  3ZD9 A;  1IM4 A;  4JLX A;  1GPJ A;  2XO7 A;  5B3P A;  4YR3 A;  2DQN B;  3TI0 A;  2AXT U;  1LB2 B;  2ISP A;  2DKZ A;  4QNL A;  3IN5 A;  5KG0 A;  3UM9 A;  5ALD A;  4NJ8 A;  1JX4 A;  1ZQD A;  4ECY A;  4AT9 A;  4JWM A;  3A0B U;  5KG5 A;  2KHV A;  2HOF A;  7ICR A;  4K96 A;  4P2H A;  2WAQ F;  4UB2 A;  1UHU A;  4LEY A;  2HBK A;  3BS5 B;  4BGD A;  3MFH A;  2YMP A;  2ZIU B;  1C7Y A;  3AU2 A;  5KFH A;  5HR6 A;  3H8S A;  2C2E A;  3ORY A;  4RQ8 A;  5CJ7 A;  1PVP A;  4DSL A;  9ICX A;  4NLC A;  5AIC A;  5B3Q A;  4UAZ A;  2D8C A;  4F4Z A;  2KKV A;  4KMU A;  4E8F A;  1JAJ A;  3PX0 A;  2BQU A;  1BVS A;  1S0V A;  7ICO A;  4NLG A;  2AQ4 A;  2C2D A;  3TAD A;  3AM9 A;  2ZH6 A;  4EBE A;  4TUQ A;  3C28 A;  1V85 A;  3G6V A;  9ICM A;  4PHP A;  3EF2 A;  4YFK A;  3HP6 A;  1WCL A;  1TK8 A;  8ICU A;  4IRC A;  2A1A A;  4RNO A;  3UPS A;  4J9M A;  4HAI A;  3OVB A;  4GC6 A;  3ER8 C;  3WK6 A;  3NVZ A;  3ERC C; 
#chains in the Genus database with same CATH homology
 3Q8L A;  3JPN A;  1SKR A;  1RPL A;  4ELU A;  4ED3 A;  4X4P A;  1WCN A;  4NLZ A;  8ICK A;  2JZB B;  5F9L A;  4F5P A;  3RTV A;  4QZF A;  5CB1 A;  4O9M A;  5KT4 A;  9ICO A;  4DL6 A;  9ICW A;  7ICS A;  3EPG A;  5KG7 A;  4I27 A;  4DSK A;  2ZH2 A;  4GXI A;  4Z6D A;  7ICN A;  3TQ1 A;  1X9S A;  3ISC A;  4TQS A;  4YXJ A;  4EYH B;  4RQ2 A;  4KLU A;  5DLG A;  5DBC A;  4DQS A;  2M2W A;  3JPO A;  1RXW A;  4M2Y A;  3KTQ A;  4J9S A;  5HRD A;  3RB0 A;  9ICG A;  3QEB Z;  1ZJM A;  2XCA A;  1D8Y A;  3H37 A;  2DR7 A;  2W9B A;  4UB5 A;  3AUO A;  3V72 A;  3QE9 Y;  2VA3 A;  1SL0 A;  5D46 A;  5KFO A;  3AU6 A;  3M8R A;  1X9M A;  4O3R A;  9ICB A;  4R65 A;  5HHH A;  4EBJ A;  1U45 A;  2NRT A;  5DQG A;  2R8G A;  5J29 A;  5HRH A;  1OU5 A;  5KFG A;  5KFN A;  5KFT A;  4YR0 A;  4I2J A;  1U49 A;  1SKS A;  5J0S A;  1S97 A;  3JPT A;  1NJW A;  4LZG A;  3MR6 A;  3H7I A;  1TFR A;  4J9P A;  2HHW A;  3HW8 A;  3PW7 A;  3RJJ A;  4P4M A;  4HYK A;  3PV8 A;  2IHM A;  3UXO A;  5KFD A;  4CCH A;  4R66 A;  4WCW A;  1ZET A;  3MBY A;  9ICR A;  2XGP A;  1V4A A;  1B43 A;  1TAU A;  4KLS A;  3C2K A;  9ICT A;  5J0W A;  4TUS A;  5JUM A;  4RPZ A;  5J2E A;  1TK5 A;  1T7P A;  9ICK A;  1ZQG A;  4Z6F A;  5HNK A;  1S0N A;  3LQC B;  1NKC A;  1Q79 A;  4YD1 A;  3H4D A;  8ICZ A;  2BE3 A;  1NK8 A;  3HX0 A;  2PFN A;  4YCX A;  2W9C A;  2ASL A;  4M9G A;  4DOC A;  1BNO A;  4E7X A;  4X4R A;  2AJQ A;  1N56 A;  9ICU A;  4X4S A;  2J6S A;  5KFJ A;  2Y1J A;  5KFF A;  2AQ0 A;  4ED0 A;  2VA8 A;  2ZUC A;  4RNN A;  3C5G A;  3RR7 A;  4QWD A;  4I29 A;  4ED6 A;  1HUO A;  1XWL A;  5KFS A;  4RQ1 A;  4QZI A;  5HML A;  5KFU A;  3SV3 A;  2OWO A;  3PX6 A;  4NKT A;  3B0X A;  4DLE A;  1L3S A;  4S3N A;  4IQT A;  2R8I A;  1H38 A;  5DDY A;  1KDH A;  4GLX A;  7ICL A;  2W9M A;  3RB6 A;  4O3N A;  2UVR A;  4F4Y A;  3SV4 A;  1U48 A;  4BDP A;  1ZQH A;  5HC9 A;  4NKU A;  9ICC A;  4GC7 A;  4QZB A;  4KLO A;  1L3T A;  4KLI A;  5KG2 A;  4X0A A;  3C66 A;  1ZQX A;  4IRD A;  7ICP A;  1ZQV A;  5J2H A;  1L5U A;  4PGQ A;  1X2I A;  2W8K A;  4FH5 A;  1ZJN A;  4YQW A;  3RH5 A;  5IIK A;  4DWI A;  3HWT A;  1NK0 A;  9ICS A;  5J2D A;  2F1I A;  5KG1 A;  4YN4 A;  4ECW A;  2J6U A;  3JZ0 A;  5KFI A;  2JEF A;  4I2G A;  4RQ5 A;  1R89 A;  5HR9 A;  5EWF A;  5J0O A;  3NYB A;  4FBU A;  2C28 A;  3BQT A;  5J2A A;  3MR3 A;  1QSS A;  4F2S A;  3BJY A;  4B9M A;  4EZ6 A;  2HHS A;  1L3U A;  5KFA A;  5BOL A;  4NM2 A;  4DQI A;  4KLM A;  4YVZ A;  3UQ0 A;  4UB1 A;  8ICC A;  4O3Q A;  5HRF A;  3H8J A;  7ICQ A;  5L1I A;  3RJK A;  3M9M B;  4J9L A;  1DGS A;  4TUP A;  2O1P A;  4RUA A;  1ZQP A;  3V7K A;  5F9N A;  1S76 D;  4FHV A;  2MUT A;  2BQR A;  5KFW A;  2V4R A;  4F5O A;  3OGU A;  3EZ5 A;  2C2R A;  2IMW P;  4I2F A;  3RAX A;  2KTQ A;  4RPX A;  4YP3 A;  4DFM A;  2ASD A;  4YMN A;  4ED2 A;  4E80 A;  9ICV A;  4PPX A;  4UQG A;  1TVA A;  4QZA A;  4F4K A;  5KFX A;  4IG8 A;  5L1J A;  2XY7 A;  1T4G A;  4NLK A;  4AT8 B;  4Q43 A;  4EBK A;  3C2M A;  4B9L A;  2NRZ A;  4QZD A;  3BQ1 A;  2C22 A;  4MFC A;  1KFT A;  2XCP A;  3GIK A;  3RH4 A;  4JK1 A;  3OSN A;  7ICU A;  5HRB A;  2V4Q A;  1LV5 A;  2HHP A;  4RZR A;  5DGA A;  4KLG A;  4YR2 A;  3KHL A;  1HJP A;  4B9U A;  3Q8M A;  4UD5 A;  5IIL A;  5BPC A;  5DGB A;  7ICT A;  5DBB A;  2ISO A;  5DB6 A;  3BDP A;  3AQN A;  1D9D A;  5IIM A;  3C2L A;  3N4M B;  3WFQ E;  4Q44 A;  1F5A A;  1NK4 A;  4DL7 A;  3G6Y A;  5HHI A;  1RXV A;  4M04 A;  5HRL A;  5J0U A;  2M9N A;  3PW5 A;  1FA0 A;  4RPY A;  2ASJ A;  1KFS A;  4PHD A;  1UT5 A;  2ID1 A;  4KLH A;  1A77 A;  4Z6E A;  4RNM A;  4BXO B;  4JV0 A;  1KFD A;  1ARO P;  5J0Y A;  1NK9 A;  2FMQ A;  3RJG A;  4G3I A;  3MAB A;  3UPQ A;  4EZ9 A;  4WC3 A;  1BPZ A;  4R8U B;  5KG6 A;  3QEA Z;  9ICN A;  3H3A A;  8ICT A;  2BCQ A;  4ATB A;  4RQ3 A;  3K4G A;  4NY8 A;  1MSW D;  2NRV A;  4XUS A;  3ETL A;  4RU9 A;  2ZH5 A;  3PR5 B;  3QZ8 A;  3LWM A;  2AU0 A;  4F4W A;  2NRX A;  5KTQ A;  2ZJ8 A;  4ECT A;  4P4O A;  3GV8 B;  8ICM A;  5DEC A;  3ZDD A;  4FBT A;  1TAQ A;  1DK2 A;  4DSF A;  3PO4 A;  2FLP A;  4J9Q A;  1JXL A;  1K1S A;  5IIN A;  3C1Z A;  1NK5 A;  4M9N A;  1MIY A;  2PBE A;  5DB7 A;  1XSP A;  5EWG A;  4ECU A;  1VJ7 A;  1ZQY A;  4ED8 A;  2VA2 A;  2HHQ A;  4B9V A;  1D9F A;  2BCU A;  4IR1 A;  2JEJ A;  2FPK A;  3GDX A;  5J2J A;  1BNP A;  2DFL A;  5L1L A;  4F3O A;  8ICJ A;  2KFZ A;  3NGD A;  1ZQE A;  5KFB A;  2FMP A;  2JEI A;  4DOB A;  2DR9 A;  9ICP A;  2B21 A;  2H5X A;  1Z00 A;  2ZTE A;  3V6H A;  4DL2 A;  2BGW A;  5CHG A;  2R8H A;  3UXN A;  5J0P A;  4FO6 A;  5J0R A;  3RB3 A;  1S10 A;  4XQ8 A;  1RYR A;  3V6J A;  4DQR A;  3RB4 A;  3OSP A;  1ZQB A;  3ZDA A;  8ICN A;  2P6R A;  5HP4 A;  4AT9 B;  4X4Q A;  8ICV A;  5KFL A;  4RQ4 A;  4X5V A;  4J9K A;  7ICI A;  2F1J A;  3SYZ A;  1R8B A;  4F50 A;  4WC0 A;  4F91 B;  3NTU A;  3RJH A;  3RR8 A;  2RDI A;  4GXK A;  1MIW A;  4ED7 A;  8ICE A;  4KLL A;  3C18 A;  1B22 A;  3LDA A;  4PGX A;  3E2E A;  1UA0 A;  3HJ1 A;  1MC8 A;  4ZH4 A;  3WFP A;  2RDJ A;  4DSE A;  4IQW A;  4JV1 A;  8ICB A;  4X4U A;  4DL3 A;  4KLT A;  2HW3 A;  4F92 B;  3ZDE A;  2JEG A;  8ICY A;  2DVI A;  2HHV A;  4UD4 A;  1UT8 A;  2XGQ A;  2BHN A;  4YG2 A;  5KT6 A;  4PHA A;  2BPG A;  4QW9 A;  1KEJ A;  1NJY A;  4I2A A;  7ICG A;  4UB4 A;  1KSP A;  2W9A A;  3AQM A;  1SL2 A;  3RRG A;  4WBZ A;  2JZB A;  4YXM A;  4KN7 A;  4QZ9 A;  3OVS A;  3KHR A;  4Q45 A;  9ICJ A;  4JWN A;  4WC4 A;  3JPS A;  2ATL A;  1DK3 A;  2UVV A;  4AT7 B;  5HRE A;  2BKE A;  5EWE A;  3EYZ A;  8ICO A;  2A1J B;  2BCV A;  8ICQ A;  4K4H A;  1BGX T;  2Q0Z X;  3PVX A;  1UET A;  4RWP A;  1ZQF A;  4F93 B;  1NZP A;  5HRI A;  4J9N A;  3EWA A;  5KFQ A;  3MR5 A;  3LK9 A;  1ZQR A;  4K4G A;  5CR0 A;  4GXJ A;  4RWN A;  4F2R A;  4DEZ A;  3TAN A;  2VAN A;  1Z3E B;  3Q8R B;  4DFP A;  4I28 A;  2KP7 A;  2M2V A;  1S77 D;  3Q8K A;  1U47 A;  4ECV A;  3PX4 A;  4DO9 A;  8ICW A;  2HHU A;  3H8W A;  1T3N A;  5J2K A;  4QZH A;  4NLN A;  4UBB A;  4R63 A;  1NJX A;  1NOM A;  4IRK A;  1KRP A;  1BPD A;  4WC2 A;  1XU4 A;  4EEY A;  3M9N B;  4FHY A;  4RQ7 A;  4DL5 A;  1ZYQ A;  2J6T A;  4WC7 A;  4J9R A;  4M6W B;  3GV7 B;  4LT6 A;  4K4I A;  4MF8 A;  2ZH7 A;  3GFK B;  3TAR A;  3M9O B;  2NRK A;  4WC6 A;  4UB3 A;  1ZQK A;  4DQQ A;  1N48 A;  4PHE A;  4DOA A;  1ZQJ A;  3OJU A;  2BDP A;  8ICP A;  4RT3 A;  8ICA A;  9ICI A;  3IM1 A;  2F1H A;  9ICE A;  4IQV A;  2AGP A;  2KN7 A;  1PX5 A;  4YMM A;  3OHA A;  1BPX A;  3QZ7 A;  2BPC A;  2ZH8 A;  5DG7 A;  4UBC A;  1JQR A;  1XC9 A;  4C8N A;  4KLQ A;  3K75 D;  1U4B A;  1MQ3 A;  3RBD A;  5KT2 A;  2ZUB A;  5DED A;  1S9F A;  7ICF A;  4PH5 A;  5J2C A;  3Q8Q B;  3M8S A;  5TZV A;  4ECQ A;  3N97 B;  3PW4 A;  2DRA A;  1ZQC A;  2I9G A;  2DR5 A;  2PI4 A;  1JXE A;  5D49 A;  3C1Y A;  4DFJ A;  2KZZ A;  1NKE A;  4MFF A;  4X0B A;  3OVA A;  4WBY A;  1COO A;  3C23 A;  1KTQ A;  5KT7 A;  4EBD A;  3MDC A;  3UQ2 A;  4ELT A;  4Q8E A;  1Q78 A;  3WFS C;  3JPQ A;  1PZN A;  4NXZ A;  2V9W A;  1CEZ A;  1ZQT A;  4YMO A;  4DFK A;  1BPY A;  2HHT A;  1S0M A;  3AQL A;  4KIT B;  1ZQM A;  1ZQU A;  4M0A A;  2BQ3 A;  1DOQ A;  3T5K A;  2AGO A;  2UVU A;  2R8K A;  3RBE A;  4KLD A;  3OV7 A;  2DRB A;  1UA1 A;  5KFP A;  1MIV A;  4BWM A;  4ECX A;  1Y88 A;  4TUR A;  2Q66 A;  4BWJ A;  2P66 A;  2R8J A;  1NJZ A;  5D4B A;  1KLN A;  4M9J A;  1ZQN A;  4B9N A;  4F8R A;  4DLG A;  2HVI A;  9ICQ A;  1R8C A;  1NO5 A;  7ICK A;  4M5D A;  1QLN A;  3V7L A;  5DQI A;  3T5J A;  3TFS A;  4ECR A;  3AQK A;  4M9L A;  3ZD8 A;  5KT5 A;  1SKW A;  4O5K A;  4WC5 A;  2LYH A;  5KFE A;  1D8L A;  3C21 A;  4FS1 A;  3RJI A;  3HIY A;  2ZH4 A;  2W9C B;  3GQC A;  3EPI A;  4LVS A;  1NK6 A;  1TFY A;  5DQH A;  4RWO A;  3HPO A;  3FDS A;  2O5A A;  2Y1I A;  2XC9 A;  3Q8S B;  4KLE A;  4F5R A;  3OHB A;  2ZH9 A;  4QW8 A;  3MFI A;  2IBK A;  8ICI A;  4QWE A;  4IR9 A;  4X4N A;  1JMS A;  1XSL A;  4WC1 A;  5DG9 A;  5KFY A;  5L1K A;  1R8A A;  5BOM A;  5KT3 A;  4Q8F A;  2IHN A;  4I2D A;  5KG4 A;  3H4B A;  8ICH A;  4MFA A;  2ZHA A;  4NM1 A;  4PGY A;  4LZD A;  2XY5 A;  1NKB A;  4O5E A;  5HRG A;  4QWC A;  3GII A;  4F4X A;  3PW2 A;  3SI8 A;  3RJF A;  2BR0 A;  2ZUD A;  3MGI A;  4FHP A;  2DPJ A;  4AT8 A;  1ZQW A;  1QSY A;  1TFW A;  2KZM A;  4X4V A;  3V7J A;  5HRK A;  2BCR A;  5DDM A;  4KTQ A;  5J2F A;  4C8K A;  4O3S A;  4QZG A;  7ICJ A;  2PI5 A;  2KFN A;  3PML A;  3H38 A;  4FH3 A;  5C5J A;  5KFR A;  3TFR A;  3PO5 A;  4FS2 A;  8ICR A;  1WOT A;  2MAX A;  4UAY A;  5DLF A;  1XSN A;  8ICF A;  2AGQ A;  4QZE A;  4F5Q A;  3MDA A;  4I2H A;  5DKW A;  1K1Q A;  4DF8 A;  3ZDB A;  1VFG A;  1ZQI A;  1ZQO A;  3JPR A;  3KHH A;  3UXP A;  1CUK A;  3BQ0 A;  4X4T A;  4JUZ A;  1ZQL A;  1JN3 A;  2IA6 A;  4X4O A;  3GV5 B;  5KFM A;  3PR4 A;  7ICH A;  3OJS A;  4J9O A;  4DS4 A;  4ELV A;  4E0D A;  4BXO A;  2BPF A;  4I2B A;  2XY6 A;  4M47 A;  3H39 A;  5J0T A;  4ECZ A;  7ICV A;  2MUT B;  4R8U A;  1ZQA A;  3ZDC A;  1RYS A;  2M2T A;  4XQ7 A;  3H40 A;  1NK7 A;  4RT2 A;  7ICM A;  5III A;  2HHX A;  3RH6 A;  9ICL A;  4QZ8 A;  3MGH A;  3T5H A;  2FPM A;  4MEY A;  3ZD9 A;  4ECS A;  3RRH A;  1IM4 A;  3TAQ A;  1S0O A;  4MEX A;  4FHW A;  2ZH1 A;  4DL4 A;  3PNC A;  2PFP A;  2UVW A;  1V9P A;  2GWS A;  5DB9 A;  2XO7 A;  4C8L A;  2W8L A;  9ICF A;  4YR3 A;  9ICH A;  3T3F A;  3TI0 A;  4EP7 A;  4I2I A;  3GIJ A;  1LB2 B;  5KFZ A;  1IXR A;  3JPP A;  2ISP A;  4O0I A;  3IHQ B;  2PFQ A;  5KFV A;  4QWA A;  4O5C A;  1QSL A;  2WTF A;  1EXN A;  1SZP A;  4XA5 A;  2PFO A;  5KG0 A;  4DSJ A;  1YLQ A;  1TK0 A;  3WFR E;  2ZHB A;  5EOZ A;  2NRW A;  1ZQQ A;  9ICA A;  3C5F A;  1JX4 A;  3RAQ A;  2RFF A;  1ZQD A;  4AT7 A;  4ECY A;  8ICX A;  1U9L A;  3EW9 A;  4R64 A;  1UEV A;  4AT9 A;  4JWM A;  5F2V O;  1T8E A;  1JIH A;  5KG5 A;  4ATB B;  1XS9 D;  7ICR A;  3PMN A;  8ICL A;  4RWQ A;  3ISD A;  4RQ0 A;  1SL1 A;  4P2H A;  4MF2 A;  5DBA A;  4I2E A;  3OUY A;  4UB2 A;  4UAW A;  2ZH3 A;  4EYI B;  3PW0 A;  4C8M A;  4BGD A;  3HT3 A;  3SZ2 A;  2BCS A;  5CWR A;  3MFH A;  3GIL A;  5KG3 A;  2ALZ A;  3PY8 A;  4O3P A;  1C7Y A;  3AU2 A;  3G6X A;  4QWB A;  4F5N A;  5DG8 A;  5KFH A;  5CA7 A;  4Z6C A;  3H8S A;  4KN4 A;  3BQ2 A;  2C2E A;  1RZT A;  3L9D A;  2DR8 A;  2ZTD A;  3ORY A;  5HMM A;  5DB8 A;  2FPL A;  5CJ7 A;  5J0Q A;  4RQ8 A;  2W9B B;  5J2I A;  4ED1 A;  2I1Q A;  3T5L A;  2FLN A;  4DSL A;  9ICX A;  4KLF A;  3GIM A;  3MR2 A;  1TV9 A;  1X9W A;  4I2C A;  2P6U A;  4UAZ A;  4P4P A;  2HVH A;  5J2G A;  4B9S A;  4KLJ A;  3FYH A;  4JV2 A;  4F4Z A;  4KMU A;  4E8F A;  1JAJ A;  5KFK A;  3JYY A;  3PX0 A;  2BQU A;  5IIJ A;  1BVS A;  4DSI A;  4TQR A;  3Q8P B;  1S0V A;  2A1J A;  1A76 A;  3LWL A;  1Z00 B;  7ICE A;  7ICO A;  1BPE A;  1XO1 A;  4RUC A;  5KFC A;  4C8O A;  4FHX A;  3THV A;  3B0Y A;  2AQ4 A;  4NLG A;  3V6K A;  2C2D A;  1MQ2 A;  1KNY A;  3OUY B;  4O3O A;  3KHG A;  3ISB A;  3HJ4 A;  5J0X A;  2ZH6 A;  4EBE A;  4TUQ A;  4IQU A;  4DS5 A;  2ZTC A;  3G6V A;  2FMS A;  1ZQS A;  4PHP A;  9ICM A;  4EBC A;  4B9T A;  5L9X A;  1TKD A;  8ICS A;  1ZQZ A;  4YFK A;  2PXI A;  2FLL A;  5IIO A;  3HP6 A;  1WCL A;  4DF4 A;  1TK8 A;  2DPI A;  4IRC A;  8ICU A;  4RNO A;  3UPS A;  3WFO A;  4RQ6 A;  1UEU A;  1BPB A;  1QTM A;  3RJE A;  8ICG A;  4M9H A;  3TAP A;  2KZ3 A;  4YD2 A;  2ZJ5 A;  4J9M A;  1HUZ A;  2M2U A;  2ZJA A;  4QZC A;  4DQP A;  3OVB A;  4GC6 A;  4M6W A;  5CP2 A;  5J2B A;  4XRH A;  1L3V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...