4FHPA

Crystal structures of the cid1 poly (u) polymerase reveal the mechanism for utp selectivity - cautp bound
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
338
structure length
323
Chain Sequence
SHKEFTKFCYEVYNEIKISDKEFKEKRAALDTLRLCLKRISPDAELVAFGSLESGLALKNSDMDLCVLMDSRVQSDTIALQFYEELIAEGFEGKFLQRARIPIIKLTSDTKNGFGASFQCDIGFNNRLAIHNTLLLSSYTKLDARLKPMVLLVKHWAKRKQINSPYFGTLSSYGYVLMVLYYLIHVIKPPVFPNLLLSPLKQEKIVDGFDVGFDDKLEDIPPSQNYSSLGSLLHGFFRFYAYKFEPREKVVTFRRPDGYLTKQEKGWTRYILAIEDPFEISHNVGRTVSSSGLYRIRGEFMAASRLLNSRSYPIPYDSLFEEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Poly(A) RNA polymerase protein cid1
publication title Crystal structures of the Cid1 poly (U) polymerase reveal the mechanism for UTP selectivity.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 112
structure length 323
sequence length 338
ec nomenclature ec 2.7.7.19: Polynucleotide adenylyltransferase.
pdb deposition date 2012-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01909 NTP_transf_2 Nucleotidyltransferase domain
A PF03828 PAP_assoc Cid1 family poly A polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.10 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain Poly(a)-polymerase, middle domain 4fhpA01
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4fhpA02
5HHHA 4QZBA 5HRLA 4F5OA 9ICPA 2ZH8A 2BE3A 4KLMA 5HR9A 4E8FA 1JQRA 2PFOA 4QZCA 7ICTA 2ZH6A 5CWRA 5EOZA 4X4OA 8ICNA 4M0AA 5HREA 4WCWA 9ICMA 4RQ8A 4I2BA 5CR0A 4PPXA 4DOBA 7ICHA 4RQ7A 4KLDA 4QZIA 8ICWA 2FMQA 5J2KA 4EBJA 4NM1A 5IIKA 3AQLA 5HHIA 5J2IA 3OV7A 4RQ6A 1F5AA 5IINA 4I27A 4I28A 4I2DA 1ZQUA 4IQUA 9ICOA 5DBAA 3HX0A 3C5FA 1R8CA 2ISPA 1KDHA 1ZQDA 4X4TA 7ICFA 3AQMA 4IQTA 3K75D 1XSNA 2B51A 8ICZA 3ISBA 3AQKA 2ZH9A 4DOCA 8ICTA 4UB3A 4UD5A 4PHEA 5HC9A 8ICXA 2FMPA 4YMOA 4PGYA 1MQ2A 3WFOA 4KLFA 5J2CA 2B4VA 9ICEA 5HRDA 3LK9A 4M9LA 4P2HA 5DBBA 5D46A 3V72A 1BPXA 1HUOA 2GWSA 8ICHA 4PGQA 2PFQA 4RPZA 4X4UA 4FH5A 1ZQQA 2DRBA 1R8AA 4RWQA 2ZHAA 1ZQFA 4NKUA 1ZQJA 3C18A 5J0QA 3WFPA 4F5RA 3LQCB 2DR7A 3JYYA 2M2TA 3UPQA 4KLSA 2BPGA 4AT9A 4R65A 4X5VA 8ICIA 3OVBA 2ZH4A 9ICNA 4FO6A 5DBCA 4ATBB 2B56A 4PHDA 4TUSA 4M9JA 3RJIA 5TZVA 4QZDA 4S3NA 2BCQA 4JWNA 4P4PA 5J2GA 2DVIA 4UB1A 1ZQIA 2BCSA 5CJ7A 9ICXA 5CB1A 1VFGA 8ICVA 1ZQWA 4X4QA 4MF8A 4RWPA 1Q78A 3MDAA 5J2BA 3L9DA 5HRKA 2ZH3A 2VANA 5IIIA 9ICSA 1ZQNA 5J2JA 7ICPA 4RWNA 7ICVA 8ICSA 4WBZA 4PHPA 4KLTA 4K4IA 9ICGA 5J2EA 4LZGA 2RFFA 3V7LA 2O5AA 1ZQEA 4RQ2A 4FHWA 3AU2A 4MF2A 4YMMA 4RT2A 2DRAA 4NKTA 3OVSA 1ZQZA 4O5CA 4M9GA 1BPYA 5D49A 5DB6A 2M2VA 4DO9A 5D4BA 9ICHA 1R8BA 4YD1A 9ICCA 4X0AA 5J2HA 1XSPA 4KLJA 4RQ4A 7ICGA 5DB7A 1KNYA 4EBKA 3UPSA 5J0RA 4I2GA 5J0OA 4O9MA 4GXIA 4WC5A 3C2LA 3H3AA 4FHXA 3JPQA 3RJKA 3HIYA 4GXKA 4M9NA 4M9HA 4QZEA 4WC2A 4UB5A 4F5NA 1TV9A 3MGHA 3C2KA 2HHPA 1ZQTA 2IHMA 3HJ1A 4KLEA 1UEUA 1ZQAA 4I2JA 5J29A 4MFAA 5BOLA 3RJFA 4KLOA 1JN3A 4ATBA 9ICVA 4NM2A 4I2IA 3WFQE 4XQ7A 4I2FA 1TFYA 8ICCA 4PH5A 1ZQGA 8ICLA 2PFPA 9ICKA 1ZQXA 5DEDA 1MIYA 5J0WA 4WC4A 1BPZA 3JPTA 2ISOA 1FA0A 4UAYA 5IIMA 1ZQMA 3RJHA 3ISCA 5DB8A 3H37A 5J2AA 4LZDA 2DR8A 3TFRA 4IQWA 4TUQA 4KLHA 5HRIA 8ICAA 4K4GA 7ICLA 2Q66A 1Q79A 5J0UA 7ICUA 4F5PA 9ICWA 7ICEA 2M2UA 4NY8A 5CA7A 1TVAA 4X0BA 2ZHBA 9ICBA 2PFNA 4I2EA 2M2WA 5J2FA 4AT7A 4X4NA 4RPYA 4QZFA 1BPEA 5CHGA 1ZQYA 4I2AA 4RQ3A 4Z6CA 4UBBA 3WFRE 1ZQHA 4M5DA 7ICOA 9ICRA 1KEJA 2BCRA 3AU6A 1ZJMA 1TFWA 4XUSA 1MIWA 4IG8A 3JZ0A 4UBCA 5HRBA 1RZTA 4P4MA 4X4VA 8ICKA 4XRHA 4FHYA 4M47A 4QZ9A 9ICLA 1ZQPA 3AQNA 5F2VO 2BCVA 4FH3A 4IQVA 4WBYA 3V7KA 4FHPA 3GDXA 9ICTA 4O5KA 4XA5A 4TURA 5IIOA 4UAWA 8ICJA 3TFSA 4UD4A 4NLKA 8ICYA 4E80A 5J0YA 4AT7B 8ICQA 1ZQRA 2BPFA 3NYBA 2DR5A 3UXNA 3HJ4A 3AUOA 2W9MA 3HW8A 5IILA 1ZQKA 7ICJA 3C2MA 8ICRA 4WC1A 4YN4A 3V7JA 4WC3A 9ICFA 4X4RA 5HRFA 2ID1A 1HUZA 5DDMA 1BPBA 4AT8A 2O1PA 8ICGA 3PMNA 9ICUA 4R63A 3JPPA 1ZJNA 5DB9A 1OU5A 1ZQVA 1R89A 3UXPA 9ICIA 5CP2A 1VJ7A 3C5GA 4FHVA 4UAZA 1YLQA 5DKWA 4UB4A 3OUYA 4F5QA 4R66A 4NXZA 2I9GA 7ICKA 4K4HA 4KLGA 2PXIA 7ICSA 4GXJA 2FMSA 4PGXA 4RT3A 4TUPA 5J0XA 3OVAA 4RQ1A 4I2HA 4DOAA 2ZH1A 5DECA 5HRHA 2BPCA 1ZQBA 3H38A 1WOTA 4KLIA 4AT8B 8ICMA 1JAJA 3B0YA 4RPXA 3PMLA 3B0XA 4YCXA 3ISDA 4I2CA 9ICQA 4NLZA 4LT6A 1ZQLA 2P66A 4MFCA 5IIJA 1ZQOA 3RJEA 3OUYB 1MIVA 4WC7A 7ICQA 4I29A 3MBYA 8ICOA 1RPLA 3JPRA 3JPNA 5J0PA 1JMSA 3MDCA 1ZQSA 9ICAA 5J0TA 4QZ8A 2DR9A 1PX5A 4PHAA 3HWTA 4QZGA 3PNCA 4KLLA 3RJJA 1UETA 1XSLA 4E7XA 4UB2A 5BPCA 4X4PA 7ICNA 4M2YA 4KLUA 2BCUA 5HRGA 3WFSC 4JWMA 8ICEA 4RWOA 3RH4A 8ICPA 1BPDA 4EP7A 7ICRA 1NOMA 4Z6FA 4RQ5A 8ICFA 3JPOA 3UQ0A 4KLQA 9ICJA 4M04A 4QZAA 7ICMA 4YD2A 4P4OA 3UQ2A 3RH5A 3RH6A 1MQ3A 4NLNA 3OGUA 4R64A 5DDYA 4YMNA 3JPSA 4Z6DA 7ICIA 4WC6A 4X4SA 4LVSA 2ZH2A 4MFFA 4O5EA 2NRKA 8ICUA 2PBEA 5J0SA 3RJGA 5BOMA 4RQ0A 4QZHA 4AT9B 4Z6EA 4XQ8A 1ZQCA 1NO5A 3C66A 1UEVA 2ZH7A 3UXOA 3H39A 2ZH5A 4WC0A 1V4AA 8ICBA 3MGIA 5J2DA
chains in the Genus database with same CATH superfamily
5HHHA 4QZBA 5HRLA 4F5OA 9ICPA 2ZH8A 2BE3A 4WH5A 3EF2A 4KLMA 5HR9A 4N7RA 4E8FA 1JQRA 2PFOA 4K97A 4QZCA 7ICTA 2ZH6A 5CWRA 5EOZA 4X4OA 8ICNA 4M0AA 5HREA 4WCWA 9ICMA 2EWRA 4RQ8A 4I2BA 5CR0A 4PPXA 4DOBA 5CFTA 7ICHA 4RQ7A 4KLDA 4QZIA 8ICWA 2FMQA 5J2KA 4EBJA 4NM1A 5IIKA 3AQLA 5HHIA 5J2IA 3OV7A 4RQ6A 1F5AA 1GPJA 5IINA 4I27A 4I28A 3CK6A 5CFUA 4I2DA 4OAIZ 1ZQUA 4IQUA 9ICOA 5DBAA 3HX0A 4EEDA 1R8CA 3C5FA 2ISPA 3JCFA 1KDHA 1ZQDA 4X4TA 7ICFA 3AQMA 4IQTA 3K75D 1XSNA 2B51A 8ICZA 3ISBA 3AQKA 2ZH9A 4DOCA 8ICTA 4UB3A 4UD5A 4PHEA 5HC9A 8ICXA 2FMPA 4YMOA 4PGYA 1MQ2A 3WFOA 4KLFA 5J2CA 2B4VA 9ICEA 5HRDA 4OAHA 3LK9A 4M9LA 4P2HA 5DBBA 4K98A 5D46A 3V72A 1BPXA 1HUOA 2GWSA 8ICHA 4PGQA 2PFQA 4RPZA 4X4UA 4FH5A 2DRBA 1ZQQA 1R8AA 4RWQA 2ZHAA 1ZQFA 4NKUA 1ZQJA 3C18A 5J0QA 3WFPA 4F5RA 3LQCB 2DR7A 3JYYA 2M2TA 3UPQA 4KLSA 2BPGA 4AT9A 4R65A 4K9BA 4X5VA 8ICIA 4EGWA 3OVBA 5B3QA 2ZH4A 9ICNA 4FO6A 5DBCA 4ATBB 2B56A 4PHDA 4TUSA 4M9JA 3RJIA 5TZVA 4QZDA 4S3NA 2BCQA 4JWNA 4P4PA 5J2GA 2DVIA 4UB1A 4HX0A 1ZQIA 2BCSA 5CJ7A 9ICXA 5CB1A 1VFGA 8ICVA 1ZQWA 4X4QA 4MF8A 4RWPA 1Q78A 3MDAA 5J2BA 3L9DA 2ZH3A 5HRKA 2VANA 5IIIA 9ICSA 1ZQNA 5J2JA 7ICPA 4RWNA 7ICVA 8ICSA 3NVOA 4WBZA 4PHPA 4KLTA 4K4IA 4K96A 9ICGA 5J2EA 4LZGA 2RFFA 3V7LA 2O5AA 1ZQEA 4RQ2A 4FHWA 3AU2A 4MF2A 4YMMA 4RT2A 2DRAA 4NKTA 3OVSA 1ZQZA 4O5CA 4M9GA 1BPYA 5D49A 5DB6A 2M2VA 4DO9A 4WQKA 5D4BA 4NXWA 9ICHA 1R8BA 4NXVA 4YD1A 9ICCA 4X0AA 2GA9D 3NWIA 5J2HA 1XSPA 4KLJA 4RQ4A 7ICGA 5DB7A 1KNYA 4EBKA 3UPSA 5J0RA 5D63A 4I2GA 5J0OA 4O9MA 4GXIA 4WC5A 3C2LA 3H3AA 4FHXA 3JPQA 3RJKA 3HIYA 4GXKA 4M9NA 4M9HA 4QZEA 4WC2A 4UB5A 4F5NA 1TV9A 3MGHA 3C2KA 2HHPA 1ZQTA 2IHMA 3HJ1A 4KLEA 1UEUA 1ZQAA 4I2JA 5J29A 4MFAA 5BOLA 3RJFA 4KLOA 4ATBA 1JN3A 9ICVA 4NXUA 4NM2A 4I2IA 3WFQE 4XQ7A 4I2FA 1TFYA 8ICCA 4PH5A 1ZQGA 8ICLA 2PFPA 9ICKA 1ZQXA 4JLZA 5DEDA 1MIYA 5J0WA 4WC4A 1BPZA 3JPTA 2ISOA 4NXXA 3ER9B 1FA0A 4MKPA 4UAYA 5IIMA 1ZQMA 3RJHA 3ISCA 3K7DA 5DB8A 3H37A 5J2AA 4LZDA 2DR8A 3TFRA 4LEZA 4IQWA 4K9AA 4TUQA 4KLHA 5HRIA 8ICAA 4K4GA 7ICLA 4KM5A 2Q66A 1Q79A 5J0UA 4LEVA 7ICUA 4XJEA 4F5PA 9ICWA 7ICEA 2M2UA 4NY8A 5CA7A 1TVAA 4X0BA 4NXTA 2ZHBA 9ICBA 2PFNA 2HN1A 5D62A 4I2EA 2M2WA 5CFSA 5J2FA 4AT7A 4X4NA 4RPYA 4QZFA 1BPEA 5CHGA 1ZQYA 4I2AA 4RQ3A 4Z6CA 4UBBA 3WFRE 1ZQHA 4M5DA 7ICOA 9ICRA 1KEJA 2BCRA 3AU6A 4KB6A 1ZJMA 4O67A 4O69A 1TFWA 4XUSA 4WQLA 4IG8A 1MIWA 3JZ0A 4UBCA 5HRBA 1RZTA 4FO1A 4X4VA 4P4MA 8ICKA 4XRHA 4WOYA 4FHYA 4M47A 4QZ9A 9ICLA 1ZQPA 3AQNA 5F2VO 2BCVA 4FH3A 4IQVA 2GAFD 4WBYA 3V7KA 4FHPA 4K8VA 3GDXA 9ICTA 4O5KA 4XA5A 4TURA 5IIOA 5CHEA 4UAWA 4JLXA 8ICJA 3TFSA 4UD4A 3MCRA 4NLKA 8ICYA 4E80A 5J0YA 4AT7B 8ICQA 1ZQRA 2BPFA 3NYBA 2DR5A 4O68A 3UXNA 3HJ4A 3AUOA 2W9MA 3HW8A 5IILA 1ZQKA 7ICJA 3C2MA 8ICRA 4WC1A 4YN4A 3V7JA 4WC3A 9ICFA 4X4RA 5HRFA 2ID1A 1HUZA 5DDMA 4AT8A 1BPBA 2O1PA 8ICGA 3PMNA 9ICUA 4R63A 3JPPA 1ZJNA 5DB9A 1OU5A 1ZQVA 5D61A 1R89A 3UXPA 9ICIA 5CP2A 1VJ7A 3C5GA 2IHOA 4FHVA 4UAZA 1YLQA 5DKWA 4UB4A 3OUYA 4F5QA 5JTGA 4R66A 4NXZA 2I9GA 7ICKA 4K4HA 4KLGA 2PXIA 7ICSA 4GXJA 2FMSA 4PGXA 4RT3A 4TUPA 5J0XA 3OVAA 4RQ1A 4I0UA 4I2HA 4DOAA 2ZH1A 5DECA 5HRHA 2BPCA 1ZQBA 3H38A 1WOTA 4KLIA 4AT8B 8ICMA 1JAJA 3B0YA 4RPXA 4K99A 3PMLA 3B0XA 4YCXA 3ISDA 4I2CA 9ICQA 4OAGA 4NLZA 4LT6A 1ZQLA 2P66A 4MFCA 2IUBA 5IIJA 1ZQOA 3RJEA 3ERCC 3OUYB 1MIVA 4WC7A 7ICQA 3OWGA 4I29A 3MBYA 8ICOA 1RPLA 3JPRA 3JPNA 5J0PA 1JMSA 5B3PA 3MDCA 1ZQSA 4O6AA 9ICAA 5J0TA 2DR9A 4QZ8A 1PX5A 4PHAA 3HWTA 4QZGA 3PNCA 4KLLA 3RJJA 4OAFA 1UETA 1XSLA 4E7XA 4UB2A 5BPCA 4X4PA 7ICNA 4LEWA 4EV6A 4M2YA 4KLUA 2BCUA 4LEYA 5HRGA 3WFSC 4JWMA 8ICEA 4RWOA 3RH4A 8ICPA 1BPDA 4EP7A 7ICRA 1NOMA 4Z6FA 4RQ5A 8ICFA 3JPOA 3UQ0A 4KLQA 9ICJA 4M04A 4QZAA 7ICMA 2BBHA 4YD2A 4P4OA 3UQ2A 3RH5A 3RH6A 1MQ3A 4NLNA 4R64A 5DDYA 4YMNA 3OGUA 3PHZA 3JPSA 4Z6DA 7ICIA 4WC6A 4X4SA 2FCLA 4LVSA 2ZH2A 2BBJA 4MFFA 4O5EA 2NRKA 8ICUA 2PBEA 5J0SA 3RJGA 5BOMA 4RQ0A 3NKUA 4QZHA 4AT9B 4Z6EA 4EEBA 4XQ8A 1ZQCA 1NO5A 3C66A 1UEVA 2ZH7A 3UXOA 3H39A 2ZH5A 4WC0A 1V4AA 3ER8C 8ICBA 3MGIA 2HN2A 5J2DA
chains in the Genus database with same CATH topology
5HHHA 4QZBA 5HRLA 4F5OA 9ICPA 2ZH8A 2BE3A 4KLMA 5HR9A 4E8FA 1JQRA 2PFOA 4K97A 4QZCA 7ICTA 2ZH6A 5CWRA 5EOZA 4X4OA 8ICNA 4M0AA 5HREA 4WCWA 9ICMA 4RQ8A 4I2BA 5CR0A 4PPXA 4DOBA 7ICHA 4RQ7A 4KLDA 4QZIA 8ICWA 2FMQA 5J2KA 4EBJA 4NM1A 5IIKA 3AQLA 5HHIA 5J2IA 3OV7A 4RQ6A 1F5AA 5IINA 4I27A 4I28A 4I2DA 4OAIZ 1ZQUA 4IQUA 9ICOA 5DBAA 3HX0A 3C5FA 1R8CA 2ISPA 1KDHA 1ZQDA 4X4TA 7ICFA 3AQMA 4IQTA 3K75D 1XSNA 2B51A 8ICZA 3ISBA 3AQKA 2ZH9A 4DOCA 8ICTA 4UB3A 4UD5A 4PHEA 5HC9A 8ICXA 2FMPA 4YMOA 4PGYA 1MQ2A 3WFOA 4KLFA 5J2CA 2B4VA 9ICEA 5HRDA 4OAHA 3LK9A 4M9LA 4P2HA 5DBBA 4K98A 5D46A 3V72A 1BPXA 1HUOA 2GWSA 8ICHA 4PGQA 2PFQA 4RPZA 4X4UA 4FH5A 2DRBA 1ZQQA 1R8AA 4RWQA 2ZHAA 1ZQFA 4NKUA 1ZQJA 3C18A 5J0QA 3WFPA 4F5RA 3LQCB 2DR7A 3JYYA 2M2TA 3UPQA 4KLSA 2BPGA 4AT9A 4R65A 4K9BA 4X5VA 8ICIA 3OVBA 2ZH4A 9ICNA 4FO6A 5DBCA 4ATBB 2B56A 4PHDA 4TUSA 4M9JA 3RJIA 5TZVA 4QZDA 4S3NA 2BCQA 4JWNA 4P4PA 5J2GA 2DVIA 4UB1A 1ZQIA 2BCSA 5CJ7A 9ICXA 5CB1A 1VFGA 8ICVA 1ZQWA 4X4QA 4MF8A 4RWPA 1Q78A 3MDAA 5J2BA 3L9DA 2ZH3A 5HRKA 2VANA 5IIIA 9ICSA 1ZQNA 5J2JA 7ICPA 4RWNA 7ICVA 8ICSA 4WBZA 4PHPA 4KLTA 4K4IA 4K96A 9ICGA 5J2EA 4LZGA 2RFFA 3V7LA 2O5AA 1ZQEA 4RQ2A 4FHWA 3AU2A 4MF2A 4YMMA 4RT2A 2DRAA 4NKTA 3OVSA 1ZQZA 4O5CA 4M9GA 1BPYA 5D49A 5DB6A 2M2VA 4DO9A 5D4BA 4NXWA 9ICHA 1R8BA 4NXVA 4YD1A 9ICCA 4X0AA 5J2HA 1XSPA 4KLJA 4RQ4A 7ICGA 5DB7A 1KNYA 4EBKA 3UPSA 5J0RA 4I2GA 5J0OA 4O9MA 4GXIA 4WC5A 3C2LA 3H3AA 4FHXA 3JPQA 3RJKA 3HIYA 4GXKA 4M9NA 4M9HA 4QZEA 4WC2A 4UB5A 4F5NA 1TV9A 3MGHA 3C2KA 2HHPA 1ZQTA 2IHMA 3HJ1A 4KLEA 1UEUA 1ZQAA 4I2JA 5J29A 4MFAA 5BOLA 3RJFA 4KLOA 4ATBA 1JN3A 9ICVA 4NXUA 4NM2A 4I2IA 3WFQE 4XQ7A 4I2FA 1TFYA 8ICCA 4PH5A 1ZQGA 8ICLA 2PFPA 9ICKA 1ZQXA 4JLZA 5DEDA 1MIYA 5J0WA 4WC4A 1BPZA 3JPTA 2ISOA 4NXXA 1FA0A 4MKPA 4UAYA 5IIMA 1ZQMA 3RJHA 3ISCA 5DB8A 3H37A 5J2AA 4LZDA 2DR8A 3TFRA 4LEZA 4IQWA 4K9AA 4TUQA 4KLHA 5HRIA 8ICAA 4K4GA 7ICLA 4KM5A 2Q66A 1Q79A 5J0UA 4LEVA 7ICUA 4F5PA 9ICWA 7ICEA 2M2UA 4NY8A 5CA7A 1TVAA 4X0BA 4NXTA 2ZHBA 9ICBA 2PFNA 4I2EA 2M2WA 5J2FA 4AT7A 4X4NA 4RPYA 4QZFA 1BPEA 5CHGA 1ZQYA 4I2AA 4RQ3A 4Z6CA 4UBBA 3WFRE 1ZQHA 4M5DA 7ICOA 9ICRA 1KEJA 2BCRA 3AU6A 4KB6A 1ZJMA 4O67A 4O69A 1TFWA 4XUSA 1MIWA 4IG8A 3JZ0A 4UBCA 5HRBA 1RZTA 4X4VA 4P4MA 8ICKA 4XRHA 4WOYA 4FHYA 4M47A 4QZ9A 9ICLA 1ZQPA 3AQNA 5F2VO 2BCVA 4FH3A 4IQVA 4WBYA 3V7KA 4FHPA 4K8VA 3GDXA 9ICTA 4O5KA 4XA5A 4TURA 5IIOA 4UAWA 4JLXA 8ICJA 3TFSA 4UD4A 4NLKA 8ICYA 4E80A 5J0YA 4AT7B 8ICQA 1ZQRA 2BPFA 3NYBA 2DR5A 4O68A 3UXNA 3HJ4A 3AUOA 2W9MA 3HW8A 5IILA 1ZQKA 7ICJA 3C2MA 8ICRA 4WC1A 4YN4A 3V7JA 4WC3A 9ICFA 4X4RA 5HRFA 2ID1A 1HUZA 5DDMA 4AT8A 1BPBA 2O1PA 8ICGA 3PMNA 9ICUA 4R63A 3JPPA 1ZJNA 5DB9A 1OU5A 1ZQVA 1R89A 3UXPA 9ICIA 5CP2A 1VJ7A 3C5GA 4FHVA 4UAZA 1YLQA 5DKWA 4UB4A 3OUYA 4F5QA 4R66A 4NXZA 2I9GA 7ICKA 4K4HA 4KLGA 2PXIA 7ICSA 4GXJA 2FMSA 4PGXA 4RT3A 4TUPA 5J0XA 3OVAA 4RQ1A 4I2HA 4DOAA 2ZH1A 5DECA 5HRHA 2BPCA 1ZQBA 3H38A 1WOTA 4KLIA 4AT8B 8ICMA 1JAJA 3B0YA 4RPXA 4K99A 3PMLA 3B0XA 4YCXA 3ISDA 4I2CA 9ICQA 4OAGA 4NLZA 4LT6A 1ZQLA 2P66A 4MFCA 5IIJA 1ZQOA 3RJEA 3OUYB 1MIVA 4WC7A 7ICQA 4I29A 3MBYA 8ICOA 1RPLA 3JPRA 3JPNA 5J0PA 1JMSA 3MDCA 1ZQSA 4O6AA 9ICAA 5J0TA 2DR9A 4QZ8A 1PX5A 4PHAA 3HWTA 4QZGA 3PNCA 4KLLA 3RJJA 4OAFA 1UETA 1XSLA 4E7XA 4UB2A 5BPCA 4X4PA 7ICNA 4LEWA 4M2YA 4KLUA 2BCUA 4LEYA 5HRGA 3WFSC 4JWMA 8ICEA 4RWOA 3RH4A 8ICPA 1BPDA 4EP7A 7ICRA 1NOMA 4Z6FA 4RQ5A 8ICFA 3JPOA 3UQ0A 4KLQA 9ICJA 4M04A 4QZAA 7ICMA 4YD2A 4P4OA 3UQ2A 3RH5A 3RH6A 1MQ3A 4NLNA 4R64A 5DDYA 4YMNA 3OGUA 3JPSA 4Z6DA 7ICIA 4WC6A 4X4SA 4LVSA 2ZH2A 4MFFA 4O5EA 2NRKA 8ICUA 2PBEA 5J0SA 3RJGA 5BOMA 4RQ0A 4QZHA 4AT9B 4Z6EA 4XQ8A 1ZQCA 1NO5A 3C66A 1UEVA 2ZH7A 3UXOA 3H39A 2ZH5A 4WC0A 1V4AA 8ICBA 3MGIA 5J2DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HHH A;  4QZB A;  5HRL A;  4F5O A;  9ICP A;  2ZH8 A;  2BE3 A;  4KLM A;  5HR9 A;  4E8F A;  1JQR A;  2PFO A;  4QZC A;  7ICT A;  2ZH6 A;  5CWR A;  5EOZ A;  4X4O A;  8ICN A;  4M0A A;  5HRE A;  4WCW A;  9ICM A;  4RQ8 A;  4I2B A;  5CR0 A;  4PPX A;  4DOB A;  7ICH A;  4RQ7 A;  4KLD A;  4QZI A;  8ICW A;  2FMQ A;  5J2K A;  4EBJ A;  4NM1 A;  5IIK A;  3AQL A;  5HHI A;  5J2I A;  3OV7 A;  4RQ6 A;  1F5A A;  5IIN A;  4I27 A;  4I28 A;  4I2D A;  1ZQU A;  4IQU A;  9ICO A;  5DBA A;  3HX0 A;  3C5F A;  1R8C A;  2ISP A;  1KDH A;  1ZQD A;  4X4T A;  7ICF A;  3AQM A;  4IQT A;  3K75 D;  1XSN A;  2B51 A;  8ICZ A;  3ISB A;  3AQK A;  2ZH9 A;  4DOC A;  8ICT A;  4UB3 A;  4UD5 A;  4PHE A;  5HC9 A;  8ICX A;  2FMP A;  4YMO A;  4PGY A;  1MQ2 A;  3WFO A;  4KLF A;  5J2C A;  2B4V A;  9ICE A;  5HRD A;  3LK9 A;  4M9L A;  4P2H A;  5DBB A;  5D46 A;  3V72 A;  1BPX A;  1HUO A;  2GWS A;  8ICH A;  4PGQ A;  2PFQ A;  4RPZ A;  4X4U A;  4FH5 A;  1ZQQ A;  2DRB A;  1R8A A;  4RWQ A;  2ZHA A;  1ZQF A;  4NKU A;  1ZQJ A;  3C18 A;  5J0Q A;  3WFP A;  4F5R A;  3LQC B;  2DR7 A;  3JYY A;  2M2T A;  3UPQ A;  4KLS A;  2BPG A;  4AT9 A;  4R65 A;  4X5V A;  8ICI A;  3OVB A;  2ZH4 A;  9ICN A;  4FO6 A;  5DBC A;  4ATB B;  2B56 A;  4PHD A;  4TUS A;  4M9J A;  3RJI A;  5TZV A;  4QZD A;  4S3N A;  2BCQ A;  4JWN A;  4P4P A;  5J2G A;  2DVI A;  4UB1 A;  1ZQI A;  2BCS A;  5CJ7 A;  9ICX A;  5CB1 A;  1VFG A;  8ICV A;  1ZQW A;  4X4Q A;  4MF8 A;  4RWP A;  1Q78 A;  3MDA A;  5J2B A;  3L9D A;  5HRK A;  2ZH3 A;  2VAN A;  5III A;  9ICS A;  1ZQN A;  5J2J A;  7ICP A;  4RWN A;  7ICV A;  8ICS A;  4WBZ A;  4PHP A;  4KLT A;  4K4I A;  9ICG A;  5J2E A;  4LZG A;  2RFF A;  3V7L A;  2O5A A;  1ZQE A;  4RQ2 A;  4FHW A;  3AU2 A;  4MF2 A;  4YMM A;  4RT2 A;  2DRA A;  4NKT A;  3OVS A;  1ZQZ A;  4O5C A;  4M9G A;  1BPY A;  5D49 A;  5DB6 A;  2M2V A;  4DO9 A;  5D4B A;  9ICH A;  1R8B A;  4YD1 A;  9ICC A;  4X0A A;  5J2H A;  1XSP A;  4KLJ A;  4RQ4 A;  7ICG A;  5DB7 A;  1KNY A;  4EBK A;  3UPS A;  5J0R A;  4I2G A;  5J0O A;  4O9M A;  4GXI A;  4WC5 A;  3C2L A;  3H3A A;  4FHX A;  3JPQ A;  3RJK A;  3HIY A;  4GXK A;  4M9N A;  4M9H A;  4QZE A;  4WC2 A;  4UB5 A;  4F5N A;  1TV9 A;  3MGH A;  3C2K A;  2HHP A;  1ZQT A;  2IHM A;  3HJ1 A;  4KLE A;  1UEU A;  1ZQA A;  4I2J A;  5J29 A;  4MFA A;  5BOL A;  3RJF A;  4KLO A;  1JN3 A;  4ATB A;  9ICV A;  4NM2 A;  4I2I A;  3WFQ E;  4XQ7 A;  4I2F A;  1TFY A;  8ICC A;  4PH5 A;  1ZQG A;  8ICL A;  2PFP A;  9ICK A;  1ZQX A;  5DED A;  1MIY A;  5J0W A;  4WC4 A;  1BPZ A;  3JPT A;  2ISO A;  1FA0 A;  4UAY A;  5IIM A;  1ZQM A;  3RJH A;  3ISC A;  5DB8 A;  3H37 A;  5J2A A;  4LZD A;  2DR8 A;  3TFR A;  4IQW A;  4TUQ A;  4KLH A;  5HRI A;  8ICA A;  4K4G A;  7ICL A;  2Q66 A;  1Q79 A;  5J0U A;  7ICU A;  4F5P A;  9ICW A;  7ICE A;  2M2U A;  4NY8 A;  5CA7 A;  1TVA A;  4X0B A;  2ZHB A;  9ICB A;  2PFN A;  4I2E A;  2M2W A;  5J2F A;  4AT7 A;  4X4N A;  4RPY A;  4QZF A;  1BPE A;  5CHG A;  1ZQY A;  4I2A A;  4RQ3 A;  4Z6C A;  4UBB A;  3WFR E;  1ZQH A;  4M5D A;  7ICO A;  9ICR A;  1KEJ A;  2BCR A;  3AU6 A;  1ZJM A;  1TFW A;  4XUS A;  1MIW A;  4IG8 A;  3JZ0 A;  4UBC A;  5HRB A;  1RZT A;  4P4M A;  4X4V A;  8ICK A;  4XRH A;  4FHY A;  4M47 A;  4QZ9 A;  9ICL A;  1ZQP A;  3AQN A;  5F2V O;  2BCV A;  4FH3 A;  4IQV A;  4WBY A;  3V7K A;  4FHP A;  3GDX A;  9ICT A;  4O5K A;  4XA5 A;  4TUR A;  5IIO A;  4UAW A;  8ICJ A;  3TFS A;  4UD4 A;  4NLK A;  8ICY A;  4E80 A;  5J0Y A;  4AT7 B;  8ICQ A;  1ZQR A;  2BPF A;  3NYB A;  2DR5 A;  3UXN A;  3HJ4 A;  3AUO A;  2W9M A;  3HW8 A;  5IIL A;  1ZQK A;  7ICJ A;  3C2M A;  8ICR A;  4WC1 A;  4YN4 A;  3V7J A;  4WC3 A;  9ICF A;  4X4R A;  5HRF A;  2ID1 A;  1HUZ A;  5DDM A;  1BPB A;  4AT8 A;  2O1P A;  8ICG A;  3PMN A;  9ICU A;  4R63 A;  3JPP A;  1ZJN A;  5DB9 A;  1OU5 A;  1ZQV A;  1R89 A;  3UXP A;  9ICI A;  5CP2 A;  1VJ7 A;  3C5G A;  4FHV A;  4UAZ A;  1YLQ A;  5DKW A;  4UB4 A;  3OUY A;  4F5Q A;  4R66 A;  4NXZ A;  2I9G A;  7ICK A;  4K4H A;  4KLG A;  2PXI A;  7ICS A;  4GXJ A;  2FMS A;  4PGX A;  4RT3 A;  4TUP A;  5J0X A;  3OVA A;  4RQ1 A;  4I2H A;  4DOA A;  2ZH1 A;  5DEC A;  5HRH A;  2BPC A;  1ZQB A;  3H38 A;  1WOT A;  4KLI A;  4AT8 B;  8ICM A;  1JAJ A;  3B0Y A;  4RPX A;  3PML A;  3B0X A;  4YCX A;  3ISD A;  4I2C A;  9ICQ A;  4NLZ A;  4LT6 A;  1ZQL A;  2P66 A;  4MFC A;  5IIJ A;  1ZQO A;  3RJE A;  3OUY B;  1MIV A;  4WC7 A;  7ICQ A;  4I29 A;  3MBY A;  8ICO A;  1RPL A;  3JPR A;  3JPN A;  5J0P A;  1JMS A;  3MDC A;  1ZQS A;  9ICA A;  5J0T A;  4QZ8 A;  2DR9 A;  1PX5 A;  4PHA A;  3HWT A;  4QZG A;  3PNC A;  4KLL A;  3RJJ A;  1UET A;  1XSL A;  4E7X A;  4UB2 A;  5BPC A;  4X4P A;  7ICN A;  4M2Y A;  4KLU A;  2BCU A;  5HRG A;  3WFS C;  4JWM A;  8ICE A;  4RWO A;  3RH4 A;  8ICP A;  1BPD A;  4EP7 A;  7ICR A;  1NOM A;  4Z6F A;  4RQ5 A;  8ICF A;  3JPO A;  3UQ0 A;  4KLQ A;  9ICJ A;  4M04 A;  4QZA A;  7ICM A;  4YD2 A;  4P4O A;  3UQ2 A;  3RH5 A;  3RH6 A;  1MQ3 A;  4NLN A;  3OGU A;  4R64 A;  5DDY A;  4YMN A;  3JPS A;  4Z6D A;  7ICI A;  4WC6 A;  4X4S A;  4LVS A;  2ZH2 A;  4MFF A;  4O5E A;  2NRK A;  8ICU A;  2PBE A;  5J0S A;  3RJG A;  5BOM A;  4RQ0 A;  4QZH A;  4AT9 B;  4Z6E A;  4XQ8 A;  1ZQC A;  1NO5 A;  3C66 A;  1UEV A;  2ZH7 A;  3UXO A;  3H39 A;  2ZH5 A;  4WC0 A;  1V4A A;  8ICB A;  3MGI A;  5J2D A; 
#chains in the Genus database with same CATH topology
 5HHH A;  4QZB A;  5HRL A;  4F5O A;  9ICP A;  2ZH8 A;  2BE3 A;  4WH5 A;  3EF2 A;  4KLM A;  5HR9 A;  4N7R A;  4E8F A;  1JQR A;  2PFO A;  4K97 A;  4QZC A;  7ICT A;  2ZH6 A;  5CWR A;  5EOZ A;  4X4O A;  8ICN A;  4M0A A;  5HRE A;  4WCW A;  9ICM A;  2EWR A;  4RQ8 A;  4I2B A;  5CR0 A;  4PPX A;  4DOB A;  5CFT A;  7ICH A;  4RQ7 A;  4KLD A;  4QZI A;  8ICW A;  2FMQ A;  5J2K A;  4EBJ A;  4NM1 A;  5IIK A;  3AQL A;  5HHI A;  5J2I A;  3OV7 A;  4RQ6 A;  1F5A A;  1GPJ A;  5IIN A;  4I27 A;  4I28 A;  3CK6 A;  5CFU A;  4I2D A;  4OAI Z;  1ZQU A;  4IQU A;  9ICO A;  5DBA A;  3HX0 A;  4EED A;  1R8C A;  3C5F A;  2ISP A;  3JCF A;  1KDH A;  1ZQD A;  4X4T A;  7ICF A;  3AQM A;  4IQT A;  3K75 D;  1XSN A;  2B51 A;  8ICZ A;  3ISB A;  3AQK A;  2ZH9 A;  4DOC A;  8ICT A;  4UB3 A;  4UD5 A;  4PHE A;  5HC9 A;  8ICX A;  2FMP A;  4YMO A;  4PGY A;  1MQ2 A;  3WFO A;  4KLF A;  5J2C A;  2B4V A;  9ICE A;  5HRD A;  4OAH A;  3LK9 A;  4M9L A;  4P2H A;  5DBB A;  4K98 A;  5D46 A;  3V72 A;  1BPX A;  1HUO A;  2GWS A;  8ICH A;  4PGQ A;  2PFQ A;  4RPZ A;  4X4U A;  4FH5 A;  2DRB A;  1ZQQ A;  1R8A A;  4RWQ A;  2ZHA A;  1ZQF A;  4NKU A;  1ZQJ A;  3C18 A;  5J0Q A;  3WFP A;  4F5R A;  3LQC B;  2DR7 A;  3JYY A;  2M2T A;  3UPQ A;  4KLS A;  2BPG A;  4AT9 A;  4R65 A;  4K9B A;  4X5V A;  8ICI A;  4EGW A;  3OVB A;  5B3Q A;  2ZH4 A;  9ICN A;  4FO6 A;  5DBC A;  4ATB B;  2B56 A;  4PHD A;  4TUS A;  4M9J A;  3RJI A;  5TZV A;  4QZD A;  4S3N A;  2BCQ A;  4JWN A;  4P4P A;  5J2G A;  2DVI A;  4UB1 A;  4HX0 A;  1ZQI A;  2BCS A;  5CJ7 A;  9ICX A;  5CB1 A;  1VFG A;  8ICV A;  1ZQW A;  4X4Q A;  4MF8 A;  4RWP A;  1Q78 A;  3MDA A;  5J2B A;  3L9D A;  2ZH3 A;  5HRK A;  2VAN A;  5III A;  9ICS A;  1ZQN A;  5J2J A;  7ICP A;  4RWN A;  7ICV A;  8ICS A;  3NVO A;  4WBZ A;  4PHP A;  4KLT A;  4K4I A;  4K96 A;  9ICG A;  5J2E A;  4LZG A;  2RFF A;  3V7L A;  2O5A A;  1ZQE A;  4RQ2 A;  4FHW A;  3AU2 A;  4MF2 A;  4YMM A;  4RT2 A;  2DRA A;  4NKT A;  3OVS A;  1ZQZ A;  4O5C A;  4M9G A;  1BPY A;  5D49 A;  5DB6 A;  2M2V A;  4DO9 A;  4WQK A;  5D4B A;  4NXW A;  9ICH A;  1R8B A;  4NXV A;  4YD1 A;  9ICC A;  4X0A A;  2GA9 D;  3NWI A;  5J2H A;  1XSP A;  4KLJ A;  4RQ4 A;  7ICG A;  5DB7 A;  1KNY A;  4EBK A;  3UPS A;  5J0R A;  5D63 A;  4I2G A;  5J0O A;  4O9M A;  4GXI A;  4WC5 A;  3C2L A;  3H3A A;  4FHX A;  3JPQ A;  3RJK A;  3HIY A;  4GXK A;  4M9N A;  4M9H A;  4QZE A;  4WC2 A;  4UB5 A;  4F5N A;  1TV9 A;  3MGH A;  3C2K A;  2HHP A;  1ZQT A;  2IHM A;  3HJ1 A;  4KLE A;  1UEU A;  1ZQA A;  4I2J A;  5J29 A;  4MFA A;  5BOL A;  3RJF A;  4KLO A;  4ATB A;  1JN3 A;  9ICV A;  4NXU A;  4NM2 A;  4I2I A;  3WFQ E;  4XQ7 A;  4I2F A;  1TFY A;  8ICC A;  4PH5 A;  1ZQG A;  8ICL A;  2PFP A;  9ICK A;  1ZQX A;  4JLZ A;  5DED A;  1MIY A;  5J0W A;  4WC4 A;  1BPZ A;  3JPT A;  2ISO A;  4NXX A;  3ER9 B;  1FA0 A;  4MKP A;  4UAY A;  5IIM A;  1ZQM A;  3RJH A;  3ISC A;  3K7D A;  5DB8 A;  3H37 A;  5J2A A;  4LZD A;  2DR8 A;  3TFR A;  4LEZ A;  4IQW A;  4K9A A;  4TUQ A;  4KLH A;  5HRI A;  8ICA A;  4K4G A;  7ICL A;  4KM5 A;  2Q66 A;  1Q79 A;  5J0U A;  4LEV A;  7ICU A;  4XJE A;  4F5P A;  9ICW A;  7ICE A;  2M2U A;  4NY8 A;  5CA7 A;  1TVA A;  4X0B A;  4NXT A;  2ZHB A;  9ICB A;  2PFN A;  2HN1 A;  5D62 A;  4I2E A;  2M2W A;  5CFS A;  5J2F A;  4AT7 A;  4X4N A;  4RPY A;  4QZF A;  1BPE A;  5CHG A;  1ZQY A;  4I2A A;  4RQ3 A;  4Z6C A;  4UBB A;  3WFR E;  1ZQH A;  4M5D A;  7ICO A;  9ICR A;  1KEJ A;  2BCR A;  3AU6 A;  4KB6 A;  1ZJM A;  4O67 A;  4O69 A;  1TFW A;  4XUS A;  4WQL A;  4IG8 A;  1MIW A;  3JZ0 A;  4UBC A;  5HRB A;  1RZT A;  4FO1 A;  4X4V A;  4P4M A;  8ICK A;  4XRH A;  4WOY A;  4FHY A;  4M47 A;  4QZ9 A;  9ICL A;  1ZQP A;  3AQN A;  5F2V O;  2BCV A;  4FH3 A;  4IQV A;  2GAF D;  4WBY A;  3V7K A;  4FHP A;  4K8V A;  3GDX A;  9ICT A;  4O5K A;  4XA5 A;  4TUR A;  5IIO A;  5CHE A;  4UAW A;  4JLX A;  8ICJ A;  3TFS A;  4UD4 A;  3MCR A;  4NLK A;  8ICY A;  4E80 A;  5J0Y A;  4AT7 B;  8ICQ A;  1ZQR A;  2BPF A;  3NYB A;  2DR5 A;  4O68 A;  3UXN A;  3HJ4 A;  3AUO A;  2W9M A;  3HW8 A;  5IIL A;  1ZQK A;  7ICJ A;  3C2M A;  8ICR A;  4WC1 A;  4YN4 A;  3V7J A;  4WC3 A;  9ICF A;  4X4R A;  5HRF A;  2ID1 A;  1HUZ A;  5DDM A;  4AT8 A;  1BPB A;  2O1P A;  8ICG A;  3PMN A;  9ICU A;  4R63 A;  3JPP A;  1ZJN A;  5DB9 A;  1OU5 A;  1ZQV A;  5D61 A;  1R89 A;  3UXP A;  9ICI A;  5CP2 A;  1VJ7 A;  3C5G A;  2IHO A;  4FHV A;  4UAZ A;  1YLQ A;  5DKW A;  4UB4 A;  3OUY A;  4F5Q A;  5JTG A;  4R66 A;  4NXZ A;  2I9G A;  7ICK A;  4K4H A;  4KLG A;  2PXI A;  7ICS A;  4GXJ A;  2FMS A;  4PGX A;  4RT3 A;  4TUP A;  5J0X A;  3OVA A;  4RQ1 A;  4I0U A;  4I2H A;  4DOA A;  2ZH1 A;  5DEC A;  5HRH A;  2BPC A;  1ZQB A;  3H38 A;  1WOT A;  4KLI A;  4AT8 B;  8ICM A;  1JAJ A;  3B0Y A;  4RPX A;  4K99 A;  3PML A;  3B0X A;  4YCX A;  3ISD A;  4I2C A;  9ICQ A;  4OAG A;  4NLZ A;  4LT6 A;  1ZQL A;  2P66 A;  4MFC A;  2IUB A;  5IIJ A;  1ZQO A;  3RJE A;  3ERC C;  3OUY B;  1MIV A;  4WC7 A;  7ICQ A;  3OWG A;  4I29 A;  3MBY A;  8ICO A;  1RPL A;  3JPR A;  3JPN A;  5J0P A;  1JMS A;  5B3P A;  3MDC A;  1ZQS A;  4O6A A;  9ICA A;  5J0T A;  2DR9 A;  4QZ8 A;  1PX5 A;  4PHA A;  3HWT A;  4QZG A;  3PNC A;  4KLL A;  3RJJ A;  4OAF A;  1UET A;  1XSL A;  4E7X A;  4UB2 A;  5BPC A;  4X4P A;  7ICN A;  4LEW A;  4EV6 A;  4M2Y A;  4KLU A;  2BCU A;  4LEY A;  5HRG A;  3WFS C;  4JWM A;  8ICE A;  4RWO A;  3RH4 A;  8ICP A;  1BPD A;  4EP7 A;  7ICR A;  1NOM A;  4Z6F A;  4RQ5 A;  8ICF A;  3JPO A;  3UQ0 A;  4KLQ A;  9ICJ A;  4M04 A;  4QZA A;  7ICM A;  2BBH A;  4YD2 A;  4P4O A;  3UQ2 A;  3RH5 A;  3RH6 A;  1MQ3 A;  4NLN A;  4R64 A;  5DDY A;  4YMN A;  3OGU A;  3PHZ A;  3JPS A;  4Z6D A;  7ICI A;  4WC6 A;  4X4S A;  2FCL A;  4LVS A;  2ZH2 A;  2BBJ A;  4MFF A;  4O5E A;  2NRK A;  8ICU A;  2PBE A;  5J0S A;  3RJG A;  5BOM A;  4RQ0 A;  3NKU A;  4QZH A;  4AT9 B;  4Z6E A;  4EEB A;  4XQ8 A;  1ZQC A;  1NO5 A;  3C66 A;  1UEV A;  2ZH7 A;  3UXO A;  3H39 A;  2ZH5 A;  4WC0 A;  1V4A A;  3ER8 C;  8ICB A;  3MGI A;  2HN2 A;  5J2D A; 
#chains in the Genus database with same CATH homology
 5HHH A;  4QZB A;  5HRL A;  4F5O A;  9ICP A;  2ZH8 A;  2BE3 A;  4KLM A;  5HR9 A;  4E8F A;  1JQR A;  2PFO A;  4K97 A;  4QZC A;  7ICT A;  2ZH6 A;  5CWR A;  5EOZ A;  4X4O A;  8ICN A;  4M0A A;  5HRE A;  4WCW A;  9ICM A;  4RQ8 A;  4I2B A;  5CR0 A;  4PPX A;  4DOB A;  7ICH A;  4RQ7 A;  4KLD A;  4QZI A;  8ICW A;  2FMQ A;  5J2K A;  4EBJ A;  4NM1 A;  5IIK A;  3AQL A;  5HHI A;  5J2I A;  3OV7 A;  4RQ6 A;  1F5A A;  5IIN A;  4I27 A;  4I28 A;  4I2D A;  4OAI Z;  1ZQU A;  4IQU A;  9ICO A;  5DBA A;  3HX0 A;  3C5F A;  1R8C A;  2ISP A;  1KDH A;  1ZQD A;  4X4T A;  7ICF A;  3AQM A;  4IQT A;  3K75 D;  1XSN A;  2B51 A;  8ICZ A;  3ISB A;  3AQK A;  2ZH9 A;  4DOC A;  8ICT A;  4UB3 A;  4UD5 A;  4PHE A;  5HC9 A;  8ICX A;  2FMP A;  4YMO A;  4PGY A;  1MQ2 A;  3WFO A;  4KLF A;  5J2C A;  2B4V A;  9ICE A;  5HRD A;  4OAH A;  3LK9 A;  4M9L A;  4P2H A;  5DBB A;  4K98 A;  5D46 A;  3V72 A;  1BPX A;  1HUO A;  2GWS A;  8ICH A;  4PGQ A;  2PFQ A;  4RPZ A;  4X4U A;  4FH5 A;  2DRB A;  1ZQQ A;  1R8A A;  4RWQ A;  2ZHA A;  1ZQF A;  4NKU A;  1ZQJ A;  3C18 A;  5J0Q A;  3WFP A;  4F5R A;  3LQC B;  2DR7 A;  3JYY A;  2M2T A;  3UPQ A;  4KLS A;  2BPG A;  4AT9 A;  4R65 A;  4K9B A;  4X5V A;  8ICI A;  3OVB A;  2ZH4 A;  9ICN A;  4FO6 A;  5DBC A;  4ATB B;  2B56 A;  4PHD A;  4TUS A;  4M9J A;  3RJI A;  5TZV A;  4QZD A;  4S3N A;  2BCQ A;  4JWN A;  4P4P A;  5J2G A;  2DVI A;  4UB1 A;  1ZQI A;  2BCS A;  5CJ7 A;  9ICX A;  5CB1 A;  1VFG A;  8ICV A;  1ZQW A;  4X4Q A;  4MF8 A;  4RWP A;  1Q78 A;  3MDA A;  5J2B A;  3L9D A;  2ZH3 A;  5HRK A;  2VAN A;  5III A;  9ICS A;  1ZQN A;  5J2J A;  7ICP A;  4RWN A;  7ICV A;  8ICS A;  4WBZ A;  4PHP A;  4KLT A;  4K4I A;  4K96 A;  9ICG A;  5J2E A;  4LZG A;  2RFF A;  3V7L A;  2O5A A;  1ZQE A;  4RQ2 A;  4FHW A;  3AU2 A;  4MF2 A;  4YMM A;  4RT2 A;  2DRA A;  4NKT A;  3OVS A;  1ZQZ A;  4O5C A;  4M9G A;  1BPY A;  5D49 A;  5DB6 A;  2M2V A;  4DO9 A;  5D4B A;  4NXW A;  9ICH A;  1R8B A;  4NXV A;  4YD1 A;  9ICC A;  4X0A A;  5J2H A;  1XSP A;  4KLJ A;  4RQ4 A;  7ICG A;  5DB7 A;  1KNY A;  4EBK A;  3UPS A;  5J0R A;  4I2G A;  5J0O A;  4O9M A;  4GXI A;  4WC5 A;  3C2L A;  3H3A A;  4FHX A;  3JPQ A;  3RJK A;  3HIY A;  4GXK A;  4M9N A;  4M9H A;  4QZE A;  4WC2 A;  4UB5 A;  4F5N A;  1TV9 A;  3MGH A;  3C2K A;  2HHP A;  1ZQT A;  2IHM A;  3HJ1 A;  4KLE A;  1UEU A;  1ZQA A;  4I2J A;  5J29 A;  4MFA A;  5BOL A;  3RJF A;  4KLO A;  4ATB A;  1JN3 A;  9ICV A;  4NXU A;  4NM2 A;  4I2I A;  3WFQ E;  4XQ7 A;  4I2F A;  1TFY A;  8ICC A;  4PH5 A;  1ZQG A;  8ICL A;  2PFP A;  9ICK A;  1ZQX A;  4JLZ A;  5DED A;  1MIY A;  5J0W A;  4WC4 A;  1BPZ A;  3JPT A;  2ISO A;  4NXX A;  1FA0 A;  4MKP A;  4UAY A;  5IIM A;  1ZQM A;  3RJH A;  3ISC A;  5DB8 A;  3H37 A;  5J2A A;  4LZD A;  2DR8 A;  3TFR A;  4LEZ A;  4IQW A;  4K9A A;  4TUQ A;  4KLH A;  5HRI A;  8ICA A;  4K4G A;  7ICL A;  4KM5 A;  2Q66 A;  1Q79 A;  5J0U A;  4LEV A;  7ICU A;  4F5P A;  9ICW A;  7ICE A;  2M2U A;  4NY8 A;  5CA7 A;  1TVA A;  4X0B A;  4NXT A;  2ZHB A;  9ICB A;  2PFN A;  4I2E A;  2M2W A;  5J2F A;  4AT7 A;  4X4N A;  4RPY A;  4QZF A;  1BPE A;  5CHG A;  1ZQY A;  4I2A A;  4RQ3 A;  4Z6C A;  4UBB A;  3WFR E;  1ZQH A;  4M5D A;  7ICO A;  9ICR A;  1KEJ A;  2BCR A;  3AU6 A;  4KB6 A;  1ZJM A;  4O67 A;  4O69 A;  1TFW A;  4XUS A;  1MIW A;  4IG8 A;  3JZ0 A;  4UBC A;  5HRB A;  1RZT A;  4X4V A;  4P4M A;  8ICK A;  4XRH A;  4WOY A;  4FHY A;  4M47 A;  4QZ9 A;  9ICL A;  1ZQP A;  3AQN A;  5F2V O;  2BCV A;  4FH3 A;  4IQV A;  4WBY A;  3V7K A;  4FHP A;  4K8V A;  3GDX A;  9ICT A;  4O5K A;  4XA5 A;  4TUR A;  5IIO A;  4UAW A;  4JLX A;  8ICJ A;  3TFS A;  4UD4 A;  4NLK A;  8ICY A;  4E80 A;  5J0Y A;  4AT7 B;  8ICQ A;  1ZQR A;  2BPF A;  3NYB A;  2DR5 A;  4O68 A;  3UXN A;  3HJ4 A;  3AUO A;  2W9M A;  3HW8 A;  5IIL A;  1ZQK A;  7ICJ A;  3C2M A;  8ICR A;  4WC1 A;  4YN4 A;  3V7J A;  4WC3 A;  9ICF A;  4X4R A;  5HRF A;  2ID1 A;  1HUZ A;  5DDM A;  4AT8 A;  1BPB A;  2O1P A;  8ICG A;  3PMN A;  9ICU A;  4R63 A;  3JPP A;  1ZJN A;  5DB9 A;  1OU5 A;  1ZQV A;  1R89 A;  3UXP A;  9ICI A;  5CP2 A;  1VJ7 A;  3C5G A;  4FHV A;  4UAZ A;  1YLQ A;  5DKW A;  4UB4 A;  3OUY A;  4F5Q A;  4R66 A;  4NXZ A;  2I9G A;  7ICK A;  4K4H A;  4KLG A;  2PXI A;  7ICS A;  4GXJ A;  2FMS A;  4PGX A;  4RT3 A;  4TUP A;  5J0X A;  3OVA A;  4RQ1 A;  4I2H A;  4DOA A;  2ZH1 A;  5DEC A;  5HRH A;  2BPC A;  1ZQB A;  3H38 A;  1WOT A;  4KLI A;  4AT8 B;  8ICM A;  1JAJ A;  3B0Y A;  4RPX A;  4K99 A;  3PML A;  3B0X A;  4YCX A;  3ISD A;  4I2C A;  9ICQ A;  4OAG A;  4NLZ A;  4LT6 A;  1ZQL A;  2P66 A;  4MFC A;  5IIJ A;  1ZQO A;  3RJE A;  3OUY B;  1MIV A;  4WC7 A;  7ICQ A;  4I29 A;  3MBY A;  8ICO A;  1RPL A;  3JPR A;  3JPN A;  5J0P A;  1JMS A;  3MDC A;  1ZQS A;  4O6A A;  9ICA A;  5J0T A;  2DR9 A;  4QZ8 A;  1PX5 A;  4PHA A;  3HWT A;  4QZG A;  3PNC A;  4KLL A;  3RJJ A;  4OAF A;  1UET A;  1XSL A;  4E7X A;  4UB2 A;  5BPC A;  4X4P A;  7ICN A;  4LEW A;  4M2Y A;  4KLU A;  2BCU A;  4LEY A;  5HRG A;  3WFS C;  4JWM A;  8ICE A;  4RWO A;  3RH4 A;  8ICP A;  1BPD A;  4EP7 A;  7ICR A;  1NOM A;  4Z6F A;  4RQ5 A;  8ICF A;  3JPO A;  3UQ0 A;  4KLQ A;  9ICJ A;  4M04 A;  4QZA A;  7ICM A;  4YD2 A;  4P4O A;  3UQ2 A;  3RH5 A;  3RH6 A;  1MQ3 A;  4NLN A;  4R64 A;  5DDY A;  4YMN A;  3OGU A;  3JPS A;  4Z6D A;  7ICI A;  4WC6 A;  4X4S A;  4LVS A;  2ZH2 A;  4MFF A;  4O5E A;  2NRK A;  8ICU A;  2PBE A;  5J0S A;  3RJG A;  5BOM A;  4RQ0 A;  4QZH A;  4AT9 B;  4Z6E A;  4XQ8 A;  1ZQC A;  1NO5 A;  3C66 A;  1UEV A;  2ZH7 A;  3UXO A;  3H39 A;  2ZH5 A;  4WC0 A;  1V4A A;  8ICB A;  3MGI A;  5J2D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...