4FHPA

Crystal structures of the cid1 poly (u) polymerase reveal the mechanism for utp selectivity - cautp bound
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
338
structure length
323
Chain Sequence
SHKEFTKFCYEVYNEIKISDKEFKEKRAALDTLRLCLKRISPDAELVAFGSLESGLALKNSDMDLCVLMDSRVQSDTIALQFYEELIAEGFEGKFLQRARIPIIKLTSDTKNGFGASFQCDIGFNNRLAIHNTLLLSSYTKLDARLKPMVLLVKHWAKRKQINSPYFGTLSSYGYVLMVLYYLIHVIKPPVFPNLLLSPLKQEKIVDGFDVGFDDKLEDIPPSQNYSSLGSLLHGFFRFYAYKFEPREKVVTFRRPDGYLTKQEKGWTRYILAIEDPFEISHNVGRTVSSSGLYRIRGEFMAASRLLNSRSYPIPYDSLFEEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Poly(A) RNA polymerase protein cid1
publication title Crystal structures of the Cid1 poly (U) polymerase reveal the mechanism for UTP selectivity.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transferase
total genus 112
structure length 323
sequence length 338
ec nomenclature ec 2.7.7.19: Polynucleotide adenylyltransferase.
pdb deposition date 2012-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01909 NTP_transf_2 Nucleotidyltransferase domain
A PF03828 PAP_assoc Cid1 family poly A polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.10 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain Poly(a)-polymerase, middle domain 4fhpA01
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4fhpA02
1ZQHA 4QZGA 4QZHA 5HHIA 2FMPA 8ICFA 5DECA 5HC9A 4QZCA 5J0YA 4RWQA 3MGIA 4KLOA 1UEVA 3UQ2A 4UBCA 5HRIA 4XRHA 7ICVA 1VFGA 2ZH6A 3RJJA 3OVSA 4UB5A 7ICRA 1PX5A 4XQ8A 4X4UA 4X4QA 4M9HA 5IIOA 3C5FA 3PNCA 5DDMA 2O1PA 2RFFA 4X4PA 4FHPA 2ZH5A 3C2LA 8ICSA 3L9DA 4KLFA 3AQKA 2ZHBA 3H39A 3HWTA 4AT7B 3WFOA 4WC6A 8ICAA 4YCXA 1ZQUA 8ICQA 4JWNA 5HREA 1ZQPA 4PH5A 3ISBA 5J2BA 4I2CA 1BPYA 7ICUA 4EBJA 4RPYA 2M2UA 2ZH3A 1RPLA 4I2EA 1ZQQA 9ICVA 4KLTA 5CA7A 4PGXA 4I2AA 3V7LA 7ICPA 8ICTA 3B0XA 2ZHAA 3JYYA 7ICMA 1R8BA 2W9MA 7ICNA 1JMSA 4LVSA 5J2DA 4ATBA 1ZQAA 4R64A 5CJ7A 5J0TA 1ZQCA 2PBEA 5DDYA 1KDHA 1R8CA 1ZQRA 4GXIA 1Q79A 2ZH4A 1ZQOA 5J2KA 4RQ5A 4KLJA 5IIKA 4TUSA 4DO9A 4Z6CA 1V4AA 4Z6DA 2DRBA 5BOLA 4KLDA 8ICGA 8ICUA 2P66A 2PXIA 4KLGA 8ICRA 4IQVA 3MGHA 4M9JA 4PHPA 4F5PA 1WOTA 5HRLA 4DOBA 5J0XA 5D4BA 1OU5A 3RJGA 3UPSA 9ICNA 1ZQMA 2Q66A 4MFCA 3HIYA 3H37A 4RQ1A 1ZQVA 3RJEA 1HUOA 3HJ4A 4UD4A 5DBCA 9ICXA 3HJ1A 2PFOA 5CP2A 4WC3A 4M9NA 2BE3A 9ICHA 1ZQJA 4WC7A 4AT8A 7ICJA 4RT2A 7ICLA 3JPOA 8ICIA 3UXNA 4LZGA 3OGUA 5J0OA 8ICBA 3JZ0A 5TZVA 3JPNA 4RPXA 3OVAA 8ICHA 9ICKA 1MIYA 4DOCA 2ISOA 4WBYA 9ICIA 4YMMA 5J0QA 4GXJA 5HRBA 8ICZA 1TV9A 4IQUA 2ZH7A 1ZQSA 2IHMA 3V7KA 4QZ8A 1ZQDA 1XSNA 3MBYA 5BPCA 4XA5A 4RWOA 4TUQA 9ICBA 4X4TA 9ICMA 3ISDA 1VJ7A 4I2GA 1MQ3A 1ZQGA 3RH4A 5CWRA 7ICQA 4E8FA 4PPXA 8ICLA 3JPPA 2DR5A 4O5EA 4X4RA 5DBAA 3OUYA 3HX0A 4P4PA 4JWMA 4P2HA 4F5NA 4WCWA 3H3AA 2NRKA 4RT3A 4YD1A 4YMNA 4WC2A 9ICSA 9ICCA 9ICUA 5HRHA 5J2CA 3AU2A 3TFSA 1BPXA 5D46A 1KNYA 3C18A 5DEDA 1JQRA 3WFSC 2ZH2A 4WC4A 4NXZA 3HW8A 3RH6A 9ICGA 8ICCA 4FH5A 4M2YA 4FH3A 3UXPA 4I29A 7ICKA 3LK9A 1KEJA 4LT6A 9ICWA 4Z6FA 3AQMA 4E80A 1JAJA 4KLSA 1ZQBA 2M2TA 4RQ6A 3AQLA 4UBBA 3RH5A 8ICNA 8ICOA 4KLUA 9ICPA 4PHDA 3UPQA 4X4VA 1ZQLA 4WC5A 4M9GA 4WBZA 4WC1A 4QZAA 5J2JA 3JPSA 1ZQYA 5CHGA 4RWPA 4UAYA 8ICMA 3RJKA 4UB3A 5J0PA 1ZQNA 4QZ9A 4X4OA 4AT9A 4F5OA 2ZH9A 3MDCA 1XSPA 4NKUA 4FO6A 3JPTA 3V72A 1UEUA 2FMSA 1FA0A 1ZQKA 3NYBA 4RQ8A 3PMLA 4DOAA 2DR8A 5HRGA 3WFRE 2DRAA 4EP7A 3H38A 5J0UA 2PFNA 5HRFA 5D49A 5J2AA 4R63A 5CR0A 2B56A 4ATBB 7ICIA 4PHEA 2BCRA 5HRKA 4XUSA 4I2JA 4YN4A 5F2VO 4I2IA 1TFWA 3JPQA 1R8AA 5BOMA 1ZJNA 4K4HA 2ZH8A 4AT7A 4NKTA 4M5DA 8ICEA 4UB2A 1ZQXA 4Z6EA 4FHWA 3C66A 4FHXA 4IQWA 2BCUA 4QZFA 3WFPA 5DBBA 3RJIA 4O9MA 3K75D 4WC0A 4PHAA 9ICFA 8ICKA 4NM2A 1BPDA 4M04A 9ICQA 1BPEA 8ICYA 5J2FA 1ZQIA 1ZQZA 5IIJA 5HR9A 9ICJA 1ZQFA 4NY8A 1BPBA 4I2FA 4RPZA 2GWSA 4X4SA 5J29A 5EOZA 4NLKA 4K4GA 4RQ2A 8ICPA 4IQTA 4X4NA 1MQ2A 4I27A 4PGYA 4AT8B 4QZIA 3ISCA 2BCSA 3UXOA 4KLIA 5J2EA 1UETA 3V7JA 4M9LA 4XQ7A 4QZBA 7ICFA 7ICTA 4RWNA 4QZDA 1ZQEA 3LQCB 4GXKA 4P4OA 1MIVA 3C5GA 4FHYA 4MF8A 4NLZA 4QZEA 1ZJMA 3AUOA 4UAZA 4F5RA 4MFAA 1TFYA 3GDXA 2VANA 4TUPA 4TURA 3TFRA 2BPCA 4LZDA 3UQ0A 3RJHA 3WFQE 3PMNA 3C2KA 4R65A 3AQNA 9ICEA 2O5AA 5J0RA 2FMQA 4UB4A 4MFFA 5DB8A 4UD5A 5IIIA 4X0AA 3MDAA 4UAWA 2DR7A 4PGQA 7ICSA 4P4MA 5J0SA 2BPGA 3OV7A 2I9GA 7ICEA 4I28A 4R66A 4E7XA 3OUYB 5HHHA 2B51A 4RQ7A 1Q78A 2HHPA 1BPZA 4KLLA 7ICHA 7ICOA 4I2BA 4UB1A 4KLQA 5CB1A 1R89A 4YMOA 5J2GA 4I2DA 4X5VA 1TVAA 3RJFA 4M0AA 4YD2A 3C2MA 2BCQA 5DB6A 2BPFA 4RQ0A 2ISPA 5J2IA 9ICLA 4IG8A 2DR9A 1XSLA 5J0WA 2BCVA 4O5CA 9ICRA 3AU6A 2PFQA 4KLMA 2PFPA 4M47A 8ICVA 1JN3A 3OVBA 8ICXA 4NM1A 1MIWA 5IIMA 8ICWA 3JPRA 4X0BA 1ZQWA 4S3NA 3B0YA 9ICAA 4EBKA 4KLHA 4FHVA 1HUZA 2M2WA 1YLQA 2B4VA 2ID1A 4O5KA 4MF2A 4KLEA 5DB9A 1ZQTA 5IILA 4I2HA 9ICOA 5IINA 2M2VA 5DKWA 9ICTA 4F5QA 5J2HA 4NLNA 4RQ3A 7ICGA 4RQ4A 4K4IA 2ZH1A 1NO5A 5DB7A 2DVIA 1F5AA 5HRDA 1RZTA 8ICJA 1NOMA 4AT9B
chains in the Genus database with same CATH superfamily
1ZQHA 4QZGA 4QZHA 5HHIA 3ER8C 2FMPA 8ICFA 5DECA 5HC9A 5D62A 2GA9D 4QZCA 5J0YA 4RWQA 3MGIA 4KLOA 1UEVA 3UQ2A 4UBCA 5HRIA 4XRHA 1GPJA 7ICVA 1VFGA 4EEBA 2ZH6A 3RJJA 4OAIZ 3OVSA 4O67A 4UB5A 7ICRA 1PX5A 4K8VA 4XQ8A 4X4UA 2FCLA 4X4QA 4M9HA 5IIOA 3C5FA 3PNCA 5DDMA 2O1PA 2RFFA 4X4PA 4FHPA 2ZH5A 3C2LA 8ICSA 4OAGA 3L9DA 2ZHBA 3AQKA 3H39A 4KLFA 3HWTA 4AT7B 3WFOA 4WC6A 8ICAA 4YCXA 1ZQUA 8ICQA 4JWNA 5HREA 1ZQPA 4PH5A 3ISBA 5J2BA 4I2CA 1BPYA 7ICUA 4EBJA 4RPYA 4NXTA 2M2UA 2ZH3A 1RPLA 4I2EA 1ZQQA 9ICVA 4KLTA 5CA7A 4PGXA 4NXVA 4I2AA 3V7LA 7ICPA 8ICTA 3B0XA 2ZHAA 3JYYA 7ICMA 5B3QA 1R8BA 4KB6A 7ICNA 1JMSA 4LVSA 5J2DA 4ATBA 1ZQAA 4R64A 5D61A 5CJ7A 4K96A 5J0TA 1ZQCA 2PBEA 5DDYA 1KDHA 1R8CA 1ZQRA 4GXIA 1Q79A 2ZH4A 1ZQOA 5J2KA 4RQ5A 4KLJA 5IIKA 4TUSA 4DO9A 4Z6CA 1V4AA 4K98A 2DRBA 4Z6DA 5BOLA 4KLDA 8ICGA 8ICUA 5B3PA 2P66A 2PXIA 4KLGA 8ICRA 4O68A 4IQVA 3MGHA 2BBHA 4M9JA 4PHPA 4F5PA 1WOTA 5HRLA 4DOBA 5J0XA 5D4BA 1OU5A 3RJGA 3UPSA 9ICNA 1ZQMA 2Q66A 4MFCA 3HIYA 3OWGA 3H37A 4HX0A 4RQ1A 1ZQVA 3RJEA 1HUOA 3HJ4A 4UD4A 5DBCA 9ICXA 2HN2A 3HJ1A 2PFOA 5CP2A 4WC3A 4M9NA 3CK6A 2BE3A 9ICHA 1ZQJA 4EEDA 4WC7A 2IUBA 4AT8A 7ICJA 4RT2A 7ICLA 3JPOA 8ICIA 4LEYA 3UXNA 4LZGA 3OGUA 5J0OA 8ICBA 3JZ0A 5TZVA 3JPNA 4RPXA 3OVAA 8ICHA 9ICKA 1MIYA 4DOCA 2ISOA 4WBYA 9ICIA 4YMMA 5J0QA 4GXJA 5HRBA 8ICZA 1TV9A 4IQUA 2ZH7A 1ZQSA 2IHMA 4EGWA 3V7KA 4K99A 4QZ8A 1ZQDA 1XSNA 3MBYA 5BPCA 4XA5A 4RWOA 4TUQA 9ICBA 4X4TA 9ICMA 3ISDA 1VJ7A 2GAFD 4I2GA 1MQ3A 1ZQGA 3RH4A 5CWRA 7ICQA 3PHZA 4E8FA 4PPXA 8ICLA 3JPPA 2DR5A 4O5EA 4FO1A 4X4RA 5DBAA 4NXWA 3OUYA 4P4PA 3HX0A 4JWMA 4P2HA 4F5NA 2HN1A 4WCWA 3H3AA 2NRKA 4K9BA 4RT3A 4YD1A 4YMNA 4WC2A 9ICSA 9ICCA 9ICUA 5HRHA 5J2CA 3AU2A 3TFSA 1BPXA 5D46A 1KNYA 3C18A 5DEDA 1JQRA 3WFSC 2ZH2A 4JLXA 4O6AA 2EWRA 5JTGA 4WC4A 4NXZA 3HW8A 3RH6A 9ICGA 8ICCA 4FH5A 4M2YA 4FH3A 3UXPA 3ERCC 4I29A 7ICKA 3LK9A 1KEJA 4LT6A 9ICWA 4Z6FA 3AQMA 4E80A 1JAJA 4KLSA 4WH5A 1ZQBA 2M2TA 4RQ6A 3AQLA 4UBBA 3RH5A 8ICNA 8ICOA 4KLUA 9ICPA 4PHDA 4X4VA 3UPQA 4EV6A 1ZQLA 4WC5A 4M9GA 4K9AA 4WBZA 4WC1A 4QZAA 5J2JA 3JPSA 4RWPA 1ZQYA 5CHGA 4LEWA 4UAYA 8ICMA 3RJKA 4UB3A 5J0PA 1ZQNA 4QZ9A 4X4OA 4AT9A 4F5OA 2ZH9A 3MDCA 1XSPA 4NKUA 4FO6A 4OAFA 3JPTA 3V72A 1UEUA 2FMSA 1FA0A 1ZQKA 3NYBA 2DR8A 4OAHA 4RQ8A 3PMLA 4DOAA 5HRGA 3WFRE 2DRAA 4EP7A 3H38A 5J0UA 2PFNA 5HRFA 5D49A 4NXXA 5J2AA 4R63A 5CR0A 2B56A 4ATBB 7ICIA 4PHEA 2BCRA 5HRKA 4XUSA 3NVOA 4I2JA 4YN4A 5F2VO 4AT9B 4I2IA 1TFWA 3JPQA 1R8AA 4N7RA 5BOMA 1ZJNA 4K4HA 2ZH8A 4AT7A 4NKTA 4M5DA 4WQKA 8ICEA 4UB2A 1ZQXA 4Z6EA 4FHWA 3C66A 4FHXA 4IQWA 4K97A 4QZFA 2BCUA 3WFPA 5DBBA 3RJIA 4O9MA 3K75D 4WC0A 4PHAA 9ICFA 8ICKA 4NM2A 1BPDA 4M04A 9ICQA 1BPEA 8ICYA 5J2FA 1ZQIA 1ZQZA 5IIJA 5HR9A 9ICJA 1ZQFA 4NY8A 1BPBA 4I2FA 4RPZA 2GWSA 3NKUA 4X4SA 5J29A 5EOZA 4NLKA 4K4GA 4RQ2A 4XJEA 3MCRA 3ER9B 8ICPA 4IQTA 4X4NA 1MQ2A 4I27A 4PGYA 4AT8B 2IHOA 4QZIA 4WOYA 3ISCA 2BCSA 3UXOA 4KLIA 5J2EA 1UETA 3V7JA 4M9LA 4XQ7A 4QZBA 7ICFA 7ICTA 4RWNA 4QZDA 1ZQEA 3K7DA 3LQCB 4GXKA 4P4OA 1MIVA 3C5GA 4FHYA 4MF8A 4NLZA 4QZEA 1ZJMA 3AUOA 4JLZA 4UAZA 4F5RA 4MFAA 1TFYA 3GDXA 2VANA 4TUPA 4TURA 3TFRA 2BPCA 4LZDA 3UQ0A 3RJHA 3WFQE 3PMNA 3C2KA 4R65A 3AQNA 9ICEA 2O5AA 5J0RA 2FMQA 4UB4A 4MFFA 5DB8A 4UD5A 5IIIA 4X0AA 3MDAA 4UAWA 2DR7A 4PGQA 5CFUA 4LEZA 4P4MA 7ICSA 5J0SA 4MKPA 2BPGA 3OV7A 2I9GA 7ICEA 4I28A 3NWIA 4R66A 4E7XA 3OUYB 4WQLA 5HHHA 2B51A 4RQ7A 1Q78A 2BBJA 2HHPA 1BPZA 4KLLA 4KM5A 7ICHA 7ICOA 4I2BA 4UB1A 4KLQA 5CB1A 3JCFA 1R89A 4YMOA 5CFTA 5J2GA 4I2DA 4X5VA 1TVAA 3RJFA 4M0AA 4YD2A 3C2MA 2BCQA 5DB6A 2BPFA 4RQ0A 2ISPA 5J2IA 9ICLA 4IG8A 2DR9A 1XSLA 5J0WA 2BCVA 4O5CA 9ICRA 3AU6A 2PFQA 4KLMA 2PFPA 4M47A 8ICVA 1JN3A 3OVBA 8ICXA 5CFSA 4NM1A 1MIWA 3EF2A 5IIMA 8ICWA 3JPRA 4X0BA 1ZQWA 4S3NA 3B0YA 9ICAA 4EBKA 4KLHA 5D63A 4FHVA 1HUZA 4I0UA 2M2WA 1YLQA 2B4VA 2ID1A 4O5KA 4MF2A 4KLEA 5DB9A 1ZQTA 5IILA 4NXUA 4I2HA 9ICOA 4LEVA 5IINA 2M2VA 5DKWA 9ICTA 4F5QA 5J2HA 5CHEA 4NLNA 4RQ3A 4O69A 7ICGA 4RQ4A 4K4IA 2ZH1A 1NO5A 5DB7A 2DVIA 1F5AA 5HRDA 1RZTA 8ICJA 1NOMA 2W9MA
chains in the Genus database with same CATH topology
1ZQHA 4QZGA 4QZHA 5HHIA 2FMPA 8ICFA 5DECA 5HC9A 4QZCA 5J0YA 4RWQA 3MGIA 4KLOA 1UEVA 3UQ2A 4UBCA 5HRIA 4XRHA 7ICVA 1VFGA 2ZH6A 3RJJA 4OAIZ 3OVSA 4O67A 4UB5A 7ICRA 1PX5A 4K8VA 4XQ8A 4X4UA 4X4QA 4M9HA 5IIOA 3C5FA 3PNCA 5DDMA 2O1PA 2RFFA 4X4PA 4FHPA 2ZH5A 3C2LA 8ICSA 4OAGA 3L9DA 2ZHBA 3AQKA 3H39A 4KLFA 3HWTA 4AT7B 3WFOA 4WC6A 8ICAA 4YCXA 1ZQUA 8ICQA 4JWNA 5HREA 1ZQPA 4PH5A 3ISBA 5J2BA 4I2CA 1BPYA 7ICUA 4EBJA 4RPYA 4NXTA 2M2UA 2ZH3A 1RPLA 4I2EA 1ZQQA 9ICVA 4KLTA 5CA7A 4PGXA 4NXVA 4I2AA 3V7LA 7ICPA 8ICTA 3B0XA 2ZHAA 3JYYA 7ICMA 1R8BA 4KB6A 7ICNA 1JMSA 4LVSA 5J2DA 4ATBA 1ZQAA 4R64A 5CJ7A 4K96A 5J0TA 1ZQCA 2PBEA 5DDYA 1KDHA 1R8CA 1ZQRA 4GXIA 1Q79A 2ZH4A 1ZQOA 5J2KA 4RQ5A 4KLJA 5IIKA 4TUSA 4DO9A 4Z6CA 1V4AA 4K98A 2DRBA 4Z6DA 5BOLA 4KLDA 8ICGA 8ICUA 2P66A 2PXIA 4KLGA 8ICRA 4O68A 4IQVA 3MGHA 4M9JA 4PHPA 4F5PA 1WOTA 5HRLA 4DOBA 5J0XA 5D4BA 1OU5A 3RJGA 3UPSA 9ICNA 1ZQMA 2Q66A 4MFCA 3HIYA 3H37A 4RQ1A 1ZQVA 3RJEA 1HUOA 3HJ4A 4UD4A 5DBCA 9ICXA 3HJ1A 2PFOA 5CP2A 4WC3A 4M9NA 2BE3A 9ICHA 1ZQJA 4WC7A 4AT8A 7ICJA 4RT2A 7ICLA 3JPOA 8ICIA 4LEYA 3UXNA 4LZGA 3OGUA 5J0OA 8ICBA 3JZ0A 5TZVA 3JPNA 4RPXA 3OVAA 8ICHA 9ICKA 1MIYA 4DOCA 2ISOA 4WBYA 9ICIA 4YMMA 5J0QA 4GXJA 5HRBA 8ICZA 1TV9A 4IQUA 2ZH7A 1ZQSA 2IHMA 3V7KA 4K99A 4QZ8A 1ZQDA 1XSNA 3MBYA 5BPCA 4XA5A 4RWOA 4TUQA 9ICBA 4X4TA 9ICMA 3ISDA 1VJ7A 4I2GA 1MQ3A 1ZQGA 3RH4A 5CWRA 7ICQA 4E8FA 4PPXA 8ICLA 3JPPA 2DR5A 4O5EA 4X4RA 5DBAA 4NXWA 3OUYA 4P4PA 3HX0A 4JWMA 4P2HA 4F5NA 4WCWA 3H3AA 2NRKA 4K9BA 4RT3A 4YD1A 4YMNA 4WC2A 9ICSA 9ICCA 9ICUA 5HRHA 5J2CA 3AU2A 3TFSA 1BPXA 5D46A 1KNYA 3C18A 5DEDA 1JQRA 3WFSC 2ZH2A 4JLXA 4O6AA 4WC4A 4NXZA 3HW8A 3RH6A 9ICGA 8ICCA 4FH5A 4M2YA 4FH3A 3UXPA 4I29A 7ICKA 3LK9A 1KEJA 4LT6A 9ICWA 4Z6FA 3AQMA 4E80A 1JAJA 4KLSA 1ZQBA 2M2TA 4RQ6A 3AQLA 4UBBA 3RH5A 8ICNA 8ICOA 4KLUA 9ICPA 4PHDA 4X4VA 3UPQA 1ZQLA 4WC5A 4M9GA 4K9AA 4WBZA 4WC1A 4QZAA 5J2JA 3JPSA 1ZQYA 5CHGA 4RWPA 4LEWA 4UAYA 8ICMA 3RJKA 4UB3A 5J0PA 1ZQNA 4QZ9A 4X4OA 4AT9A 4F5OA 2ZH9A 3MDCA 1XSPA 4NKUA 4FO6A 4OAFA 3JPTA 3V72A 1UEUA 2FMSA 1FA0A 1ZQKA 3NYBA 2DR8A 4OAHA 4RQ8A 3PMLA 4DOAA 5HRGA 3WFRE 2DRAA 4EP7A 3H38A 5J0UA 2PFNA 5HRFA 5D49A 4NXXA 5J2AA 4R63A 5CR0A 2B56A 4ATBB 7ICIA 4PHEA 2BCRA 5HRKA 4XUSA 4I2JA 4YN4A 5F2VO 4AT9B 4I2IA 1TFWA 3JPQA 1R8AA 5BOMA 1ZJNA 4K4HA 2ZH8A 4AT7A 4NKTA 4M5DA 8ICEA 4UB2A 1ZQXA 4Z6EA 4FHWA 3C66A 4FHXA 4IQWA 4K97A 4QZFA 2BCUA 3WFPA 5DBBA 3RJIA 4O9MA 3K75D 4WC0A 4PHAA 9ICFA 8ICKA 4NM2A 1BPDA 4M04A 9ICQA 1BPEA 8ICYA 5J2FA 1ZQIA 1ZQZA 5IIJA 5HR9A 9ICJA 1ZQFA 4NY8A 1BPBA 4I2FA 4RPZA 2GWSA 4X4SA 5J29A 5EOZA 4NLKA 4K4GA 4RQ2A 8ICPA 4IQTA 4X4NA 1MQ2A 4I27A 4PGYA 4AT8B 4QZIA 4WOYA 3ISCA 2BCSA 3UXOA 4KLIA 5J2EA 1UETA 3V7JA 4M9LA 4XQ7A 4QZBA 7ICFA 7ICTA 4RWNA 4QZDA 1ZQEA 3LQCB 4GXKA 4P4OA 1MIVA 3C5GA 4FHYA 4MF8A 4NLZA 4QZEA 1ZJMA 3AUOA 4JLZA 4UAZA 4F5RA 4MFAA 1TFYA 3GDXA 2VANA 4TUPA 4TURA 3TFRA 2BPCA 4LZDA 3UQ0A 3RJHA 3WFQE 3PMNA 3C2KA 4R65A 3AQNA 9ICEA 2O5AA 5J0RA 2FMQA 4UB4A 4MFFA 5DB8A 4UD5A 5IIIA 4X0AA 3MDAA 4UAWA 2DR7A 4PGQA 4LEZA 4P4MA 7ICSA 5J0SA 4MKPA 2BPGA 3OV7A 2I9GA 7ICEA 4I28A 4R66A 4E7XA 3OUYB 5HHHA 2B51A 4RQ7A 1Q78A 2HHPA 1BPZA 4KLLA 4KM5A 7ICHA 7ICOA 4I2BA 4UB1A 4KLQA 5CB1A 1R89A 4YMOA 5J2GA 4I2DA 4X5VA 1TVAA 3RJFA 4M0AA 4YD2A 3C2MA 2BCQA 5DB6A 2BPFA 4RQ0A 2ISPA 5J2IA 9ICLA 4IG8A 2DR9A 1XSLA 5J0WA 2BCVA 4O5CA 9ICRA 3AU6A 2PFQA 4KLMA 2PFPA 4M47A 8ICVA 1JN3A 3OVBA 8ICXA 4NM1A 1MIWA 5IIMA 8ICWA 3JPRA 4X0BA 1ZQWA 4S3NA 3B0YA 9ICAA 4EBKA 4KLHA 4FHVA 1HUZA 2M2WA 1YLQA 2B4VA 2ID1A 4O5KA 4MF2A 4KLEA 5DB9A 1ZQTA 5IILA 4NXUA 4I2HA 9ICOA 4LEVA 5IINA 2M2VA 5DKWA 9ICTA 4F5QA 5J2HA 4NLNA 4RQ3A 4O69A 7ICGA 4RQ4A 4K4IA 2ZH1A 1NO5A 5DB7A 2DVIA 1F5AA 5HRDA 1RZTA 8ICJA 1NOMA 2W9MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZQH A;  4QZG A;  4QZH A;  5HHI A;  2FMP A;  8ICF A;  5DEC A;  5HC9 A;  4QZC A;  5J0Y A;  4RWQ A;  3MGI A;  4KLO A;  1UEV A;  3UQ2 A;  4UBC A;  5HRI A;  4XRH A;  7ICV A;  1VFG A;  2ZH6 A;  3RJJ A;  3OVS A;  4UB5 A;  7ICR A;  1PX5 A;  4XQ8 A;  4X4U A;  4X4Q A;  4M9H A;  5IIO A;  3C5F A;  3PNC A;  5DDM A;  2O1P A;  2RFF A;  4X4P A;  4FHP A;  2ZH5 A;  3C2L A;  8ICS A;  3L9D A;  4KLF A;  3AQK A;  2ZHB A;  3H39 A;  3HWT A;  4AT7 B;  3WFO A;  4WC6 A;  8ICA A;  4YCX A;  1ZQU A;  8ICQ A;  4JWN A;  5HRE A;  1ZQP A;  4PH5 A;  3ISB A;  5J2B A;  4I2C A;  1BPY A;  7ICU A;  4EBJ A;  4RPY A;  2M2U A;  2ZH3 A;  1RPL A;  4I2E A;  1ZQQ A;  9ICV A;  4KLT A;  5CA7 A;  4PGX A;  4I2A A;  3V7L A;  7ICP A;  8ICT A;  3B0X A;  2ZHA A;  3JYY A;  7ICM A;  1R8B A;  2W9M A;  7ICN A;  1JMS A;  4LVS A;  5J2D A;  4ATB A;  1ZQA A;  4R64 A;  5CJ7 A;  5J0T A;  1ZQC A;  2PBE A;  5DDY A;  1KDH A;  1R8C A;  1ZQR A;  4GXI A;  1Q79 A;  2ZH4 A;  1ZQO A;  5J2K A;  4RQ5 A;  4KLJ A;  5IIK A;  4TUS A;  4DO9 A;  4Z6C A;  1V4A A;  4Z6D A;  2DRB A;  5BOL A;  4KLD A;  8ICG A;  8ICU A;  2P66 A;  2PXI A;  4KLG A;  8ICR A;  4IQV A;  3MGH A;  4M9J A;  4PHP A;  4F5P A;  1WOT A;  5HRL A;  4DOB A;  5J0X A;  5D4B A;  1OU5 A;  3RJG A;  3UPS A;  9ICN A;  1ZQM A;  2Q66 A;  4MFC A;  3HIY A;  3H37 A;  4RQ1 A;  1ZQV A;  3RJE A;  1HUO A;  3HJ4 A;  4UD4 A;  5DBC A;  9ICX A;  3HJ1 A;  2PFO A;  5CP2 A;  4WC3 A;  4M9N A;  2BE3 A;  9ICH A;  1ZQJ A;  4WC7 A;  4AT8 A;  7ICJ A;  4RT2 A;  7ICL A;  3JPO A;  8ICI A;  3UXN A;  4LZG A;  3OGU A;  5J0O A;  8ICB A;  3JZ0 A;  5TZV A;  3JPN A;  4RPX A;  3OVA A;  8ICH A;  9ICK A;  1MIY A;  4DOC A;  2ISO A;  4WBY A;  9ICI A;  4YMM A;  5J0Q A;  4GXJ A;  5HRB A;  8ICZ A;  1TV9 A;  4IQU A;  2ZH7 A;  1ZQS A;  2IHM A;  3V7K A;  4QZ8 A;  1ZQD A;  1XSN A;  3MBY A;  5BPC A;  4XA5 A;  4RWO A;  4TUQ A;  9ICB A;  4X4T A;  9ICM A;  3ISD A;  1VJ7 A;  4I2G A;  1MQ3 A;  1ZQG A;  3RH4 A;  5CWR A;  7ICQ A;  4E8F A;  4PPX A;  8ICL A;  3JPP A;  2DR5 A;  4O5E A;  4X4R A;  5DBA A;  3OUY A;  3HX0 A;  4P4P A;  4JWM A;  4P2H A;  4F5N A;  4WCW A;  3H3A A;  2NRK A;  4RT3 A;  4YD1 A;  4YMN A;  4WC2 A;  9ICS A;  9ICC A;  9ICU A;  5HRH A;  5J2C A;  3AU2 A;  3TFS A;  1BPX A;  5D46 A;  1KNY A;  3C18 A;  5DED A;  1JQR A;  3WFS C;  2ZH2 A;  4WC4 A;  4NXZ A;  3HW8 A;  3RH6 A;  9ICG A;  8ICC A;  4FH5 A;  4M2Y A;  4FH3 A;  3UXP A;  4I29 A;  7ICK A;  3LK9 A;  1KEJ A;  4LT6 A;  9ICW A;  4Z6F A;  3AQM A;  4E80 A;  1JAJ A;  4KLS A;  1ZQB A;  2M2T A;  4RQ6 A;  3AQL A;  4UBB A;  3RH5 A;  8ICN A;  8ICO A;  4KLU A;  9ICP A;  4PHD A;  3UPQ A;  4X4V A;  1ZQL A;  4WC5 A;  4M9G A;  4WBZ A;  4WC1 A;  4QZA A;  5J2J A;  3JPS A;  1ZQY A;  5CHG A;  4RWP A;  4UAY A;  8ICM A;  3RJK A;  4UB3 A;  5J0P A;  1ZQN A;  4QZ9 A;  4X4O A;  4AT9 A;  4F5O A;  2ZH9 A;  3MDC A;  1XSP A;  4NKU A;  4FO6 A;  3JPT A;  3V72 A;  1UEU A;  2FMS A;  1FA0 A;  1ZQK A;  3NYB A;  4RQ8 A;  3PML A;  4DOA A;  2DR8 A;  5HRG A;  3WFR E;  2DRA A;  4EP7 A;  3H38 A;  5J0U A;  2PFN A;  5HRF A;  5D49 A;  5J2A A;  4R63 A;  5CR0 A;  2B56 A;  4ATB B;  7ICI A;  4PHE A;  2BCR A;  5HRK A;  4XUS A;  4I2J A;  4YN4 A;  5F2V O;  4I2I A;  1TFW A;  3JPQ A;  1R8A A;  5BOM A;  1ZJN A;  4K4H A;  2ZH8 A;  4AT7 A;  4NKT A;  4M5D A;  8ICE A;  4UB2 A;  1ZQX A;  4Z6E A;  4FHW A;  3C66 A;  4FHX A;  4IQW A;  2BCU A;  4QZF A;  3WFP A;  5DBB A;  3RJI A;  4O9M A;  3K75 D;  4WC0 A;  4PHA A;  9ICF A;  8ICK A;  4NM2 A;  1BPD A;  4M04 A;  9ICQ A;  1BPE A;  8ICY A;  5J2F A;  1ZQI A;  1ZQZ A;  5IIJ A;  5HR9 A;  9ICJ A;  1ZQF A;  4NY8 A;  1BPB A;  4I2F A;  4RPZ A;  2GWS A;  4X4S A;  5J29 A;  5EOZ A;  4NLK A;  4K4G A;  4RQ2 A;  8ICP A;  4IQT A;  4X4N A;  1MQ2 A;  4I27 A;  4PGY A;  4AT8 B;  4QZI A;  3ISC A;  2BCS A;  3UXO A;  4KLI A;  5J2E A;  1UET A;  3V7J A;  4M9L A;  4XQ7 A;  4QZB A;  7ICF A;  7ICT A;  4RWN A;  4QZD A;  1ZQE A;  3LQC B;  4GXK A;  4P4O A;  1MIV A;  3C5G A;  4FHY A;  4MF8 A;  4NLZ A;  4QZE A;  1ZJM A;  3AUO A;  4UAZ A;  4F5R A;  4MFA A;  1TFY A;  3GDX A;  2VAN A;  4TUP A;  4TUR A;  3TFR A;  2BPC A;  4LZD A;  3UQ0 A;  3RJH A;  3WFQ E;  3PMN A;  3C2K A;  4R65 A;  3AQN A;  9ICE A;  2O5A A;  5J0R A;  2FMQ A;  4UB4 A;  4MFF A;  5DB8 A;  4UD5 A;  5III A;  4X0A A;  3MDA A;  4UAW A;  2DR7 A;  4PGQ A;  7ICS A;  4P4M A;  5J0S A;  2BPG A;  3OV7 A;  2I9G A;  7ICE A;  4I28 A;  4R66 A;  4E7X A;  3OUY B;  5HHH A;  2B51 A;  4RQ7 A;  1Q78 A;  2HHP A;  1BPZ A;  4KLL A;  7ICH A;  7ICO A;  4I2B A;  4UB1 A;  4KLQ A;  5CB1 A;  1R89 A;  4YMO A;  5J2G A;  4I2D A;  4X5V A;  1TVA A;  3RJF A;  4M0A A;  4YD2 A;  3C2M A;  2BCQ A;  5DB6 A;  2BPF A;  4RQ0 A;  2ISP A;  5J2I A;  9ICL A;  4IG8 A;  2DR9 A;  1XSL A;  5J0W A;  2BCV A;  4O5C A;  9ICR A;  3AU6 A;  2PFQ A;  4KLM A;  2PFP A;  4M47 A;  8ICV A;  1JN3 A;  3OVB A;  8ICX A;  4NM1 A;  1MIW A;  5IIM A;  8ICW A;  3JPR A;  4X0B A;  1ZQW A;  4S3N A;  3B0Y A;  9ICA A;  4EBK A;  4KLH A;  4FHV A;  1HUZ A;  2M2W A;  1YLQ A;  2B4V A;  2ID1 A;  4O5K A;  4MF2 A;  4KLE A;  5DB9 A;  1ZQT A;  5IIL A;  4I2H A;  9ICO A;  5IIN A;  2M2V A;  5DKW A;  9ICT A;  4F5Q A;  5J2H A;  4NLN A;  4RQ3 A;  7ICG A;  4RQ4 A;  4K4I A;  2ZH1 A;  1NO5 A;  5DB7 A;  2DVI A;  1F5A A;  5HRD A;  1RZT A;  8ICJ A;  1NOM A;  4AT9 B; 
#chains in the Genus database with same CATH topology
 1ZQH A;  4QZG A;  4QZH A;  5HHI A;  3ER8 C;  2FMP A;  8ICF A;  5DEC A;  5HC9 A;  5D62 A;  2GA9 D;  4QZC A;  5J0Y A;  4RWQ A;  3MGI A;  4KLO A;  1UEV A;  3UQ2 A;  4UBC A;  5HRI A;  4XRH A;  1GPJ A;  7ICV A;  1VFG A;  4EEB A;  2ZH6 A;  3RJJ A;  4OAI Z;  3OVS A;  4O67 A;  4UB5 A;  7ICR A;  1PX5 A;  4K8V A;  4XQ8 A;  4X4U A;  2FCL A;  4X4Q A;  4M9H A;  5IIO A;  3C5F A;  3PNC A;  5DDM A;  2O1P A;  2RFF A;  4X4P A;  4FHP A;  2ZH5 A;  3C2L A;  8ICS A;  4OAG A;  3L9D A;  2ZHB A;  3AQK A;  3H39 A;  4KLF A;  3HWT A;  4AT7 B;  3WFO A;  4WC6 A;  8ICA A;  4YCX A;  1ZQU A;  8ICQ A;  4JWN A;  5HRE A;  1ZQP A;  4PH5 A;  3ISB A;  5J2B A;  4I2C A;  1BPY A;  7ICU A;  4EBJ A;  4RPY A;  4NXT A;  2M2U A;  2ZH3 A;  1RPL A;  4I2E A;  1ZQQ A;  9ICV A;  4KLT A;  5CA7 A;  4PGX A;  4NXV A;  4I2A A;  3V7L A;  7ICP A;  8ICT A;  3B0X A;  2ZHA A;  3JYY A;  7ICM A;  5B3Q A;  1R8B A;  4KB6 A;  7ICN A;  1JMS A;  4LVS A;  5J2D A;  4ATB A;  1ZQA A;  4R64 A;  5D61 A;  5CJ7 A;  4K96 A;  5J0T A;  1ZQC A;  2PBE A;  5DDY A;  1KDH A;  1R8C A;  1ZQR A;  4GXI A;  1Q79 A;  2ZH4 A;  1ZQO A;  5J2K A;  4RQ5 A;  4KLJ A;  5IIK A;  4TUS A;  4DO9 A;  4Z6C A;  1V4A A;  4K98 A;  2DRB A;  4Z6D A;  5BOL A;  4KLD A;  8ICG A;  8ICU A;  5B3P A;  2P66 A;  2PXI A;  4KLG A;  8ICR A;  4O68 A;  4IQV A;  3MGH A;  2BBH A;  4M9J A;  4PHP A;  4F5P A;  1WOT A;  5HRL A;  4DOB A;  5J0X A;  5D4B A;  1OU5 A;  3RJG A;  3UPS A;  9ICN A;  1ZQM A;  2Q66 A;  4MFC A;  3HIY A;  3OWG A;  3H37 A;  4HX0 A;  4RQ1 A;  1ZQV A;  3RJE A;  1HUO A;  3HJ4 A;  4UD4 A;  5DBC A;  9ICX A;  2HN2 A;  3HJ1 A;  2PFO A;  5CP2 A;  4WC3 A;  4M9N A;  3CK6 A;  2BE3 A;  9ICH A;  1ZQJ A;  4EED A;  4WC7 A;  2IUB A;  4AT8 A;  7ICJ A;  4RT2 A;  7ICL A;  3JPO A;  8ICI A;  4LEY A;  3UXN A;  4LZG A;  3OGU A;  5J0O A;  8ICB A;  3JZ0 A;  5TZV A;  3JPN A;  4RPX A;  3OVA A;  8ICH A;  9ICK A;  1MIY A;  4DOC A;  2ISO A;  4WBY A;  9ICI A;  4YMM A;  5J0Q A;  4GXJ A;  5HRB A;  8ICZ A;  1TV9 A;  4IQU A;  2ZH7 A;  1ZQS A;  2IHM A;  4EGW A;  3V7K A;  4K99 A;  4QZ8 A;  1ZQD A;  1XSN A;  3MBY A;  5BPC A;  4XA5 A;  4RWO A;  4TUQ A;  9ICB A;  4X4T A;  9ICM A;  3ISD A;  1VJ7 A;  2GAF D;  4I2G A;  1MQ3 A;  1ZQG A;  3RH4 A;  5CWR A;  7ICQ A;  3PHZ A;  4E8F A;  4PPX A;  8ICL A;  3JPP A;  2DR5 A;  4O5E A;  4FO1 A;  4X4R A;  5DBA A;  4NXW A;  3OUY A;  4P4P A;  3HX0 A;  4JWM A;  4P2H A;  4F5N A;  2HN1 A;  4WCW A;  3H3A A;  2NRK A;  4K9B A;  4RT3 A;  4YD1 A;  4YMN A;  4WC2 A;  9ICS A;  9ICC A;  9ICU A;  5HRH A;  5J2C A;  3AU2 A;  3TFS A;  1BPX A;  5D46 A;  1KNY A;  3C18 A;  5DED A;  1JQR A;  3WFS C;  2ZH2 A;  4JLX A;  4O6A A;  2EWR A;  5JTG A;  4WC4 A;  4NXZ A;  3HW8 A;  3RH6 A;  9ICG A;  8ICC A;  4FH5 A;  4M2Y A;  4FH3 A;  3UXP A;  3ERC C;  4I29 A;  7ICK A;  3LK9 A;  1KEJ A;  4LT6 A;  9ICW A;  4Z6F A;  3AQM A;  4E80 A;  1JAJ A;  4KLS A;  4WH5 A;  1ZQB A;  2M2T A;  4RQ6 A;  3AQL A;  4UBB A;  3RH5 A;  8ICN A;  8ICO A;  4KLU A;  9ICP A;  4PHD A;  4X4V A;  3UPQ A;  4EV6 A;  1ZQL A;  4WC5 A;  4M9G A;  4K9A A;  4WBZ A;  4WC1 A;  4QZA A;  5J2J A;  3JPS A;  4RWP A;  1ZQY A;  5CHG A;  4LEW A;  4UAY A;  8ICM A;  3RJK A;  4UB3 A;  5J0P A;  1ZQN A;  4QZ9 A;  4X4O A;  4AT9 A;  4F5O A;  2ZH9 A;  3MDC A;  1XSP A;  4NKU A;  4FO6 A;  4OAF A;  3JPT A;  3V72 A;  1UEU A;  2FMS A;  1FA0 A;  1ZQK A;  3NYB A;  2DR8 A;  4OAH A;  4RQ8 A;  3PML A;  4DOA A;  5HRG A;  3WFR E;  2DRA A;  4EP7 A;  3H38 A;  5J0U A;  2PFN A;  5HRF A;  5D49 A;  4NXX A;  5J2A A;  4R63 A;  5CR0 A;  2B56 A;  4ATB B;  7ICI A;  4PHE A;  2BCR A;  5HRK A;  4XUS A;  3NVO A;  4I2J A;  4YN4 A;  5F2V O;  4AT9 B;  4I2I A;  1TFW A;  3JPQ A;  1R8A A;  4N7R A;  5BOM A;  1ZJN A;  4K4H A;  2ZH8 A;  4AT7 A;  4NKT A;  4M5D A;  4WQK A;  8ICE A;  4UB2 A;  1ZQX A;  4Z6E A;  4FHW A;  3C66 A;  4FHX A;  4IQW A;  4K97 A;  4QZF A;  2BCU A;  3WFP A;  5DBB A;  3RJI A;  4O9M A;  3K75 D;  4WC0 A;  4PHA A;  9ICF A;  8ICK A;  4NM2 A;  1BPD A;  4M04 A;  9ICQ A;  1BPE A;  8ICY A;  5J2F A;  1ZQI A;  1ZQZ A;  5IIJ A;  5HR9 A;  9ICJ A;  1ZQF A;  4NY8 A;  1BPB A;  4I2F A;  4RPZ A;  2GWS A;  3NKU A;  4X4S A;  5J29 A;  5EOZ A;  4NLK A;  4K4G A;  4RQ2 A;  4XJE A;  3MCR A;  3ER9 B;  8ICP A;  4IQT A;  4X4N A;  1MQ2 A;  4I27 A;  4PGY A;  4AT8 B;  2IHO A;  4QZI A;  4WOY A;  3ISC A;  2BCS A;  3UXO A;  4KLI A;  5J2E A;  1UET A;  3V7J A;  4M9L A;  4XQ7 A;  4QZB A;  7ICF A;  7ICT A;  4RWN A;  4QZD A;  1ZQE A;  3K7D A;  3LQC B;  4GXK A;  4P4O A;  1MIV A;  3C5G A;  4FHY A;  4MF8 A;  4NLZ A;  4QZE A;  1ZJM A;  3AUO A;  4JLZ A;  4UAZ A;  4F5R A;  4MFA A;  1TFY A;  3GDX A;  2VAN A;  4TUP A;  4TUR A;  3TFR A;  2BPC A;  4LZD A;  3UQ0 A;  3RJH A;  3WFQ E;  3PMN A;  3C2K A;  4R65 A;  3AQN A;  9ICE A;  2O5A A;  5J0R A;  2FMQ A;  4UB4 A;  4MFF A;  5DB8 A;  4UD5 A;  5III A;  4X0A A;  3MDA A;  4UAW A;  2DR7 A;  4PGQ A;  5CFU A;  4LEZ A;  4P4M A;  7ICS A;  5J0S A;  4MKP A;  2BPG A;  3OV7 A;  2I9G A;  7ICE A;  4I28 A;  3NWI A;  4R66 A;  4E7X A;  3OUY B;  4WQL A;  5HHH A;  2B51 A;  4RQ7 A;  1Q78 A;  2BBJ A;  2HHP A;  1BPZ A;  4KLL A;  4KM5 A;  7ICH A;  7ICO A;  4I2B A;  4UB1 A;  4KLQ A;  5CB1 A;  3JCF A;  1R89 A;  4YMO A;  5CFT A;  5J2G A;  4I2D A;  4X5V A;  1TVA A;  3RJF A;  4M0A A;  4YD2 A;  3C2M A;  2BCQ A;  5DB6 A;  2BPF A;  4RQ0 A;  2ISP A;  5J2I A;  9ICL A;  4IG8 A;  2DR9 A;  1XSL A;  5J0W A;  2BCV A;  4O5C A;  9ICR A;  3AU6 A;  2PFQ A;  4KLM A;  2PFP A;  4M47 A;  8ICV A;  1JN3 A;  3OVB A;  8ICX A;  5CFS A;  4NM1 A;  1MIW A;  3EF2 A;  5IIM A;  8ICW A;  3JPR A;  4X0B A;  1ZQW A;  4S3N A;  3B0Y A;  9ICA A;  4EBK A;  4KLH A;  5D63 A;  4FHV A;  1HUZ A;  4I0U A;  2M2W A;  1YLQ A;  2B4V A;  2ID1 A;  4O5K A;  4MF2 A;  4KLE A;  5DB9 A;  1ZQT A;  5IIL A;  4NXU A;  4I2H A;  9ICO A;  4LEV A;  5IIN A;  2M2V A;  5DKW A;  9ICT A;  4F5Q A;  5J2H A;  5CHE A;  4NLN A;  4RQ3 A;  4O69 A;  7ICG A;  4RQ4 A;  4K4I A;  2ZH1 A;  1NO5 A;  5DB7 A;  2DVI A;  1F5A A;  5HRD A;  1RZT A;  8ICJ A;  1NOM A;  2W9M A; 
#chains in the Genus database with same CATH homology
 1ZQH A;  4QZG A;  4QZH A;  5HHI A;  2FMP A;  8ICF A;  5DEC A;  5HC9 A;  4QZC A;  5J0Y A;  4RWQ A;  3MGI A;  4KLO A;  1UEV A;  3UQ2 A;  4UBC A;  5HRI A;  4XRH A;  7ICV A;  1VFG A;  2ZH6 A;  3RJJ A;  4OAI Z;  3OVS A;  4O67 A;  4UB5 A;  7ICR A;  1PX5 A;  4K8V A;  4XQ8 A;  4X4U A;  4X4Q A;  4M9H A;  5IIO A;  3C5F A;  3PNC A;  5DDM A;  2O1P A;  2RFF A;  4X4P A;  4FHP A;  2ZH5 A;  3C2L A;  8ICS A;  4OAG A;  3L9D A;  2ZHB A;  3AQK A;  3H39 A;  4KLF A;  3HWT A;  4AT7 B;  3WFO A;  4WC6 A;  8ICA A;  4YCX A;  1ZQU A;  8ICQ A;  4JWN A;  5HRE A;  1ZQP A;  4PH5 A;  3ISB A;  5J2B A;  4I2C A;  1BPY A;  7ICU A;  4EBJ A;  4RPY A;  4NXT A;  2M2U A;  2ZH3 A;  1RPL A;  4I2E A;  1ZQQ A;  9ICV A;  4KLT A;  5CA7 A;  4PGX A;  4NXV A;  4I2A A;  3V7L A;  7ICP A;  8ICT A;  3B0X A;  2ZHA A;  3JYY A;  7ICM A;  1R8B A;  4KB6 A;  7ICN A;  1JMS A;  4LVS A;  5J2D A;  4ATB A;  1ZQA A;  4R64 A;  5CJ7 A;  4K96 A;  5J0T A;  1ZQC A;  2PBE A;  5DDY A;  1KDH A;  1R8C A;  1ZQR A;  4GXI A;  1Q79 A;  2ZH4 A;  1ZQO A;  5J2K A;  4RQ5 A;  4KLJ A;  5IIK A;  4TUS A;  4DO9 A;  4Z6C A;  1V4A A;  4K98 A;  2DRB A;  4Z6D A;  5BOL A;  4KLD A;  8ICG A;  8ICU A;  2P66 A;  2PXI A;  4KLG A;  8ICR A;  4O68 A;  4IQV A;  3MGH A;  4M9J A;  4PHP A;  4F5P A;  1WOT A;  5HRL A;  4DOB A;  5J0X A;  5D4B A;  1OU5 A;  3RJG A;  3UPS A;  9ICN A;  1ZQM A;  2Q66 A;  4MFC A;  3HIY A;  3H37 A;  4RQ1 A;  1ZQV A;  3RJE A;  1HUO A;  3HJ4 A;  4UD4 A;  5DBC A;  9ICX A;  3HJ1 A;  2PFO A;  5CP2 A;  4WC3 A;  4M9N A;  2BE3 A;  9ICH A;  1ZQJ A;  4WC7 A;  4AT8 A;  7ICJ A;  4RT2 A;  7ICL A;  3JPO A;  8ICI A;  4LEY A;  3UXN A;  4LZG A;  3OGU A;  5J0O A;  8ICB A;  3JZ0 A;  5TZV A;  3JPN A;  4RPX A;  3OVA A;  8ICH A;  9ICK A;  1MIY A;  4DOC A;  2ISO A;  4WBY A;  9ICI A;  4YMM A;  5J0Q A;  4GXJ A;  5HRB A;  8ICZ A;  1TV9 A;  4IQU A;  2ZH7 A;  1ZQS A;  2IHM A;  3V7K A;  4K99 A;  4QZ8 A;  1ZQD A;  1XSN A;  3MBY A;  5BPC A;  4XA5 A;  4RWO A;  4TUQ A;  9ICB A;  4X4T A;  9ICM A;  3ISD A;  1VJ7 A;  4I2G A;  1MQ3 A;  1ZQG A;  3RH4 A;  5CWR A;  7ICQ A;  4E8F A;  4PPX A;  8ICL A;  3JPP A;  2DR5 A;  4O5E A;  4X4R A;  5DBA A;  4NXW A;  3OUY A;  4P4P A;  3HX0 A;  4JWM A;  4P2H A;  4F5N A;  4WCW A;  3H3A A;  2NRK A;  4K9B A;  4RT3 A;  4YD1 A;  4YMN A;  4WC2 A;  9ICS A;  9ICC A;  9ICU A;  5HRH A;  5J2C A;  3AU2 A;  3TFS A;  1BPX A;  5D46 A;  1KNY A;  3C18 A;  5DED A;  1JQR A;  3WFS C;  2ZH2 A;  4JLX A;  4O6A A;  4WC4 A;  4NXZ A;  3HW8 A;  3RH6 A;  9ICG A;  8ICC A;  4FH5 A;  4M2Y A;  4FH3 A;  3UXP A;  4I29 A;  7ICK A;  3LK9 A;  1KEJ A;  4LT6 A;  9ICW A;  4Z6F A;  3AQM A;  4E80 A;  1JAJ A;  4KLS A;  1ZQB A;  2M2T A;  4RQ6 A;  3AQL A;  4UBB A;  3RH5 A;  8ICN A;  8ICO A;  4KLU A;  9ICP A;  4PHD A;  4X4V A;  3UPQ A;  1ZQL A;  4WC5 A;  4M9G A;  4K9A A;  4WBZ A;  4WC1 A;  4QZA A;  5J2J A;  3JPS A;  1ZQY A;  5CHG A;  4RWP A;  4LEW A;  4UAY A;  8ICM A;  3RJK A;  4UB3 A;  5J0P A;  1ZQN A;  4QZ9 A;  4X4O A;  4AT9 A;  4F5O A;  2ZH9 A;  3MDC A;  1XSP A;  4NKU A;  4FO6 A;  4OAF A;  3JPT A;  3V72 A;  1UEU A;  2FMS A;  1FA0 A;  1ZQK A;  3NYB A;  2DR8 A;  4OAH A;  4RQ8 A;  3PML A;  4DOA A;  5HRG A;  3WFR E;  2DRA A;  4EP7 A;  3H38 A;  5J0U A;  2PFN A;  5HRF A;  5D49 A;  4NXX A;  5J2A A;  4R63 A;  5CR0 A;  2B56 A;  4ATB B;  7ICI A;  4PHE A;  2BCR A;  5HRK A;  4XUS A;  4I2J A;  4YN4 A;  5F2V O;  4AT9 B;  4I2I A;  1TFW A;  3JPQ A;  1R8A A;  5BOM A;  1ZJN A;  4K4H A;  2ZH8 A;  4AT7 A;  4NKT A;  4M5D A;  8ICE A;  4UB2 A;  1ZQX A;  4Z6E A;  4FHW A;  3C66 A;  4FHX A;  4IQW A;  4K97 A;  4QZF A;  2BCU A;  3WFP A;  5DBB A;  3RJI A;  4O9M A;  3K75 D;  4WC0 A;  4PHA A;  9ICF A;  8ICK A;  4NM2 A;  1BPD A;  4M04 A;  9ICQ A;  1BPE A;  8ICY A;  5J2F A;  1ZQI A;  1ZQZ A;  5IIJ A;  5HR9 A;  9ICJ A;  1ZQF A;  4NY8 A;  1BPB A;  4I2F A;  4RPZ A;  2GWS A;  4X4S A;  5J29 A;  5EOZ A;  4NLK A;  4K4G A;  4RQ2 A;  8ICP A;  4IQT A;  4X4N A;  1MQ2 A;  4I27 A;  4PGY A;  4AT8 B;  4QZI A;  4WOY A;  3ISC A;  2BCS A;  3UXO A;  4KLI A;  5J2E A;  1UET A;  3V7J A;  4M9L A;  4XQ7 A;  4QZB A;  7ICF A;  7ICT A;  4RWN A;  4QZD A;  1ZQE A;  3LQC B;  4GXK A;  4P4O A;  1MIV A;  3C5G A;  4FHY A;  4MF8 A;  4NLZ A;  4QZE A;  1ZJM A;  3AUO A;  4JLZ A;  4UAZ A;  4F5R A;  4MFA A;  1TFY A;  3GDX A;  2VAN A;  4TUP A;  4TUR A;  3TFR A;  2BPC A;  4LZD A;  3UQ0 A;  3RJH A;  3WFQ E;  3PMN A;  3C2K A;  4R65 A;  3AQN A;  9ICE A;  2O5A A;  5J0R A;  2FMQ A;  4UB4 A;  4MFF A;  5DB8 A;  4UD5 A;  5III A;  4X0A A;  3MDA A;  4UAW A;  2DR7 A;  4PGQ A;  4LEZ A;  4P4M A;  7ICS A;  5J0S A;  4MKP A;  2BPG A;  3OV7 A;  2I9G A;  7ICE A;  4I28 A;  4R66 A;  4E7X A;  3OUY B;  5HHH A;  2B51 A;  4RQ7 A;  1Q78 A;  2HHP A;  1BPZ A;  4KLL A;  4KM5 A;  7ICH A;  7ICO A;  4I2B A;  4UB1 A;  4KLQ A;  5CB1 A;  1R89 A;  4YMO A;  5J2G A;  4I2D A;  4X5V A;  1TVA A;  3RJF A;  4M0A A;  4YD2 A;  3C2M A;  2BCQ A;  5DB6 A;  2BPF A;  4RQ0 A;  2ISP A;  5J2I A;  9ICL A;  4IG8 A;  2DR9 A;  1XSL A;  5J0W A;  2BCV A;  4O5C A;  9ICR A;  3AU6 A;  2PFQ A;  4KLM A;  2PFP A;  4M47 A;  8ICV A;  1JN3 A;  3OVB A;  8ICX A;  4NM1 A;  1MIW A;  5IIM A;  8ICW A;  3JPR A;  4X0B A;  1ZQW A;  4S3N A;  3B0Y A;  9ICA A;  4EBK A;  4KLH A;  4FHV A;  1HUZ A;  2M2W A;  1YLQ A;  2B4V A;  2ID1 A;  4O5K A;  4MF2 A;  4KLE A;  5DB9 A;  1ZQT A;  5IIL A;  4NXU A;  4I2H A;  9ICO A;  4LEV A;  5IIN A;  2M2V A;  5DKW A;  9ICT A;  4F5Q A;  5J2H A;  4NLN A;  4RQ3 A;  4O69 A;  7ICG A;  4RQ4 A;  4K4I A;  2ZH1 A;  1NO5 A;  5DB7 A;  2DVI A;  1F5A A;  5HRD A;  1RZT A;  8ICJ A;  1NOM A;  2W9M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...