4WQKA

Crystal structure of aminoglycoside nucleotidylyltransferase ant(2")-ia, apo form
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
175
structure length
175
Chain Sequence
TTQVTLIHKILAAADERNLPLWIGGGWAIDARLGRVTRKHDDIDLTFPGERRGELEAIVEMLGGRVMEELDYGFLAEIGDELLDCEPAWWADEAYEIAEAPQGSCPEAAEGVIAGRPVRCNSWEAIIWDYFYYADEVPPVDWPTKHIESYRLACTSLGAEKVEVLRAAFRSRYAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2''-aminoglycoside nucleotidyltransferase
publication title Structural and Molecular Basis for Resistance to Aminoglycoside Antibiotics by the Adenylyltransferase ANT(2)-Ia.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Transferase
total genus 60
structure length 175
sequence length 175
ec nomenclature ec 2.7.7.46: Gentamicin 2''-nucleotidyltransferase.
pdb deposition date 2014-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10706 Aminoglyc_resit Aminoglycoside-2''-adenylyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.460.40 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 4wqkA00
5CFUA 4HX0A 4WQLA 4XJEA 5CFSA 5CFTA 2FCLA 4WQKA 4WH5A 2EWRA 4FO1A
chains in the Genus database with same CATH superfamily
5HHIA 7ICKA 4M0AA 8ICHA 5HRHA 4KLSA 4FO1A 3CK6A 1NO5A 4MKPA 4RQ2A 3AQKA 3WFSC 4KLOA 1RZTA 4PPXA 9ICEA 4PH5A 1HUZA 5J2DA 9ICOA 4P4PA 4WC3A 4RQ8A 5J2HA 4AT9B 3H38A 2FMQA 1UETA 4K8VA 5HREA 3MDAA 4KLFA 4XQ7A 1YLQA 4R66A 8ICEA 1MIYA 4OAHA 5D62A 4I2DA 2ISOA 4DOCA 4X4QA 1ZQCA 2ZH6A 3ERCC 3PMLA 4E8FA 4X0BA 4FHVA 3ER8C 4NXXA 2ISPA 3RH4A 2VANA 4QZBA 8ICOA 3L9DA 1R8AA 2DRBA 4FHPA 3UXOA 3C5FA 4DOAA 1F5AA 7ICFA 4X4VA 5IIKA 1ZQOA 4N7RA 2B56A 4KB6A 4M9JA 4YMNA 3K75D 2ZHAA 2FMSA 3V72A 4RQ3A 9ICBA 3MCRA 5J2GA 5J2JA 1R8CA 1VFGA 3B0YA 1KNYA 5J0UA 2HN2A 7ICNA 4UD5A 4I27A 4QZHA 2ZH4A 9ICPA 3H39A 3AQLA 3OVSA 4UAYA 2DRAA 4X4OA 4OAGA 3JPRA 9ICFA 4UD4A 4R63A 5DB6A 4LEZA 3JCFA 4KLDA 2DR5A 2O1PA 5DBCA 1ZJNA 2ZH5A 1ZQXA 2GWSA 1ZQTA 5HHHA 1ZQMA 4YD1A 4O5KA 5DEDA 4TUSA 2M2TA 5DKWA 4EGWA 4IG8A 4QZFA 7ICJA 9ICTA 3C2KA 4UAZA 4QZAA 3HW8A 3ISCA 5D4BA 2B4VA 3NYBA 1JMSA 4FH5A 5HRDA 4UAWA 4IQWA 5TZVA 5CHEA 4WOYA 3PHZA 4WC1A 5IIOA 2FMPA 5D63A 4WC0A 3HJ1A 2Q66A 4O6AA 5BOLA 5IILA 4O68A 2PFNA 4M47A 2BBJA 3HJ4A 5CP2A 1ZQSA 3WFPA 5IIJA 2GAFD 4K96A 5J2IA 3C2LA 4NLKA 4AT9A 3NVOA 1KEJA 2I9GA 3JZ0A 8ICGA 4I2BA 5CFUA 4GXKA 1RPLA 4WC7A 4DOBA 7ICEA 3HIYA 4M9NA 4PHAA 1ZQFA 3MBYA 9ICVA 4HX0A 3V7KA 2HHPA 4TURA 5J0TA 4NLNA 3AU6A 7ICQA 3ISDA 4UB4A 3PMNA 4NLZA 4X4SA 2BPFA 4YMMA 4TUQA 5J2BA 4NKTA 2M2UA 1Q79A 4RT3A 2PFOA 5IIIA 3EF2A 5J0PA 3H3AA 5J2EA 2BBHA 1R89A 4RQ7A 4NXVA 1WOTA 4PGXA 1NOMA 4K4GA 1ZQJA 7ICIA 4WCWA 8ICWA 3C5GA 1UEUA 4S3NA 4QZEA 4F5PA 4KLGA 4O69A 2O5AA 3WFQE 2PXIA 4YN4A 4Z6CA 4XUSA 9ICMA 5HC9A 3MDCA 3NWIA 8ICJA 1BPXA 3B0XA 4LT6A 4IQUA 1ZQGA 5IIMA 4M5DA 4X4PA 8ICYA 4I2JA 4XQ8A 3ISBA 7ICPA 3LK9A 4LEVA 1MQ3A 2BCUA 3UXPA 4YCXA 1FA0A 3V7LA 4UBBA 4KLJA 4XRHA 2IUBA 4K98A 4LEYA 5D46A 3WFRE 7ICVA 3UQ2A 1ZQVA 1ZQQA 4IQTA 7ICRA 3OGUA 1KDHA 5D61A 8ICPA 8ICMA 3H37A 4PGYA 3UXNA 5DBAA 9ICNA 5J0XA 4RQ6A 7ICLA 3OVAA 7ICTA 4LZDA 4I2FA 4F5NA 5HRIA 4K9AA 4PGQA 4O5EA 4MFAA 2ZH1A 4NXUA 1ZQZA 3JYYA 3K7DA 1ZQYA 1ZJMA 1JN3A 4K97A 4DO9A 3HWTA 8ICQA 1ZQWA 4OAFA 1Q78A 2PFPA 7ICGA 3C66A 3RJHA 4QZ9A 4JWNA 4RPXA 4UB1A 3ER9B 1GPJA 5BPCA 4I2AA 4GXIA 2BE3A 4PHPA 5CWRA 1ZQNA 4X4RA 4QZCA 4FHXA 5DB9A 5DDMA 5J2KA 4RPZA 4KLUA 9ICSA 3LQCB 4E7XA 4GXJA 2DVIA 1TFWA 1MIVA 2PFQA 5BOMA 3MGIA 9ICAA 4WC6A 1ZQAA 5HR9A 3AQMA 4Z6DA 5J0SA 4EV6A 8ICAA 4NKUA 4X5VA 4I2EA 4KLLA 5F2VO 4RT2A 3AUOA 2DR7A 4PHEA 4FH3A 4I2HA 4WC5A 4RWPA 4WQKA 4RQ1A 4K4IA 2NRKA 1BPBA 4I2CA 4RQ5A 4F5QA 4AT8B 2BCQA 4XJEA 4Z6FA 3RJKA 1MQ2A 3UQ0A 4QZGA 1TFYA 1TVAA 3TFRA 4F5OA 4NXZA 1JAJA 2BCRA 4X4UA 3AU2A 4NY8A 3RJEA 5IINA 9ICXA 4I29A 4KLQA 4FO6A 5J0QA 4YD2A 5HRBA 5J2CA 5CB1A 1ZQDA 3WFOA 7ICOA 4EEDA 1JQRA 9ICGA 4KM5A 5JTGA 4EEBA 4X4TA 4E80A 1ZQIA 5HRKA 3RH5A 4EP7A 8ICBA 2EWRA 3V7JA 4KLMA 7ICUA 3JPQA 4UB5A 1XSLA 8ICCA 5HRGA 4WBZA 4Z6EA 5B3PA 3TFSA 1ZQEA 4UB2A 4PHDA 1BPEA 7ICHA 4FHWA 4QZDA 5CFSA 4O67A 4LVSA 3JPOA 5J2FA 4NXTA 1ZQLA 2M2WA 4P4MA 2IHOA 2ZH3A 1VJ7A 1ZQRA 9ICIA 3JPSA 7ICSA 1R8BA 4RPYA 9ICUA 2IHMA 4X4NA 2GA9D 1BPZA 2B51A 2ZH7A 4YMOA 1MIWA 4MFFA 4FHYA 2FCLA 9ICQA 4JLZA 4QZIA 4WC2A 3RJIA 4WC4A 1OU5A 4UBCA 5DBBA 4I2IA 4NM1A 2ID1A 3OWGA 4RWOA 9ICKA 1PX5A 2DR9A 4WQLA 4KLHA 3UPSA 4WBYA 2BPCA 4X0AA 3C18A 4M9HA 9ICRA 4R65A 4M9GA 4XA5A 4RWNA 4F5RA 4QZ8A 5HRLA 5HRFA 7ICMA 5DB7A 1XSNA 4TUPA 4EBJA 4O9MA 4AT8A 4P2HA 4AT7A 9ICCA 5DECA 4KLEA 2RFFA 5DB8A 2PBEA 4R64A 4ATBA 3HX0A 1UEVA 2HN1A 2P66A 1ZQKA 3UPQA 3RJJA 4M9LA 3NKUA 4LEWA 4UB3A 1XSPA 4MFCA 4IQVA 1ZQHA 5B3QA 4RWQA 4OAIZ 4EBKA 3JPNA 5CR0A 4M04A 4NXWA 4O5CA 4KLTA 3OV7A 2W9MA 8ICZA 5J0WA 5CJ7A 2DR8A 4MF2A 1ZQPA 1BPDA 4JLXA 4K4HA 8ICKA 1ZQUA 5CFTA 3OUYA 3GDXA 8ICLA 8ICRA 9ICWA 9ICJA 3PNCA 1HUOA 3MGHA 4WH5A 4RQ0A 5DDYA 9ICLA 8ICNA 8ICIA 5J29A 3AQNA 4K9BA 4AT7B 3JPTA 4LZGA 4I0UA 2ZHBA 5J0YA 8ICTA 3RH6A 5J0OA 8ICFA 4ATBB 4MF8A 5EOZA 1ZQBA 4KLIA 8ICXA 9ICHA 1TV9A 4NM2A 5CHGA 2BCSA 4I28A 2BCVA 5J2AA 2ZH8A 5D49A 8ICUA 4JWMA 8ICVA 3OVBA 2M2VA 3JPPA 5CA7A 3C2MA 5J0RA 2ZH2A 1BPYA 4K99A 4I2GA 2BPGA 8ICSA 3RJFA 3OUYB 2ZH9A 1V4AA 4P4OA 3RJGA 4RQ4A 4M2YA
chains in the Genus database with same CATH topology
4OAHA 5D62A 3ER9B 1GPJA 5CFUA 3ERCC 3NKUA 4LEWA 4NXVA 4WQKA 4WH5A 2GA9D 3ER8C 2EWRA 2B51A 4FO1A 4NXXA 5B3QA 4OAIZ 4K9AA 4NXWA 4MKPA 2B4VA 4HX0A 4XJEA 4NXUA 2FCLA 4LEVA 3K7DA 4OAGA 5B3PA 4JLZA 5CHEA 4WOYA 3PHZA 4K9BA 4K99A 5D63A 4LEZA 4O69A 4K97A 5CFSA 4O67A 4O6AA 4K98A 4LEYA 4O68A 4NXTA 4JLXA 4N7RA 2B56A 4KB6A 3OWGA 4K8VA 4OAFA 2IHOA 2GAFD 3EF2A 3MCRA 4WQLA 5CFTA 4K96A 4KM5A 5D61A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CFU A;  4HX0 A;  4WQL A;  4XJE A;  5CFS A;  5CFT A;  2FCL A;  4WQK A;  4WH5 A;  2EWR A;  4FO1 A; 
#chains in the Genus database with same CATH topology
 5HHI A;  7ICK A;  4M0A A;  8ICH A;  5HRH A;  4KLS A;  4FO1 A;  3CK6 A;  1NO5 A;  4MKP A;  4RQ2 A;  3AQK A;  3WFS C;  4KLO A;  1RZT A;  4PPX A;  9ICE A;  4PH5 A;  1HUZ A;  5J2D A;  9ICO A;  4P4P A;  4WC3 A;  4RQ8 A;  5J2H A;  4AT9 B;  3H38 A;  2FMQ A;  1UET A;  4K8V A;  5HRE A;  3MDA A;  4KLF A;  4XQ7 A;  1YLQ A;  4R66 A;  8ICE A;  1MIY A;  4OAH A;  5D62 A;  4I2D A;  2ISO A;  4DOC A;  4X4Q A;  1ZQC A;  2ZH6 A;  3ERC C;  3PML A;  4E8F A;  4X0B A;  4FHV A;  3ER8 C;  4NXX A;  2ISP A;  3RH4 A;  2VAN A;  4QZB A;  8ICO A;  3L9D A;  1R8A A;  2DRB A;  4FHP A;  3UXO A;  3C5F A;  4DOA A;  1F5A A;  7ICF A;  4X4V A;  5IIK A;  1ZQO A;  4N7R A;  2B56 A;  4KB6 A;  4M9J A;  4YMN A;  3K75 D;  2ZHA A;  2FMS A;  3V72 A;  4RQ3 A;  9ICB A;  3MCR A;  5J2G A;  5J2J A;  1R8C A;  1VFG A;  3B0Y A;  1KNY A;  5J0U A;  2HN2 A;  7ICN A;  4UD5 A;  4I27 A;  4QZH A;  2ZH4 A;  9ICP A;  3H39 A;  3AQL A;  3OVS A;  4UAY A;  2DRA A;  4X4O A;  4OAG A;  3JPR A;  9ICF A;  4UD4 A;  4R63 A;  5DB6 A;  4LEZ A;  3JCF A;  4KLD A;  2DR5 A;  2O1P A;  5DBC A;  1ZJN A;  2ZH5 A;  1ZQX A;  2GWS A;  1ZQT A;  5HHH A;  1ZQM A;  4YD1 A;  4O5K A;  5DED A;  4TUS A;  2M2T A;  5DKW A;  4EGW A;  4IG8 A;  4QZF A;  7ICJ A;  9ICT A;  3C2K A;  4UAZ A;  4QZA A;  3HW8 A;  3ISC A;  5D4B A;  2B4V A;  3NYB A;  1JMS A;  4FH5 A;  5HRD A;  4UAW A;  4IQW A;  5TZV A;  5CHE A;  4WOY A;  3PHZ A;  4WC1 A;  5IIO A;  2FMP A;  5D63 A;  4WC0 A;  3HJ1 A;  2Q66 A;  4O6A A;  5BOL A;  5IIL A;  4O68 A;  2PFN A;  4M47 A;  2BBJ A;  3HJ4 A;  5CP2 A;  1ZQS A;  3WFP A;  5IIJ A;  2GAF D;  4K96 A;  5J2I A;  3C2L A;  4NLK A;  4AT9 A;  3NVO A;  1KEJ A;  2I9G A;  3JZ0 A;  8ICG A;  4I2B A;  5CFU A;  4GXK A;  1RPL A;  4WC7 A;  4DOB A;  7ICE A;  3HIY A;  4M9N A;  4PHA A;  1ZQF A;  3MBY A;  9ICV A;  4HX0 A;  3V7K A;  2HHP A;  4TUR A;  5J0T A;  4NLN A;  3AU6 A;  7ICQ A;  3ISD A;  4UB4 A;  3PMN A;  4NLZ A;  4X4S A;  2BPF A;  4YMM A;  4TUQ A;  5J2B A;  4NKT A;  2M2U A;  1Q79 A;  4RT3 A;  2PFO A;  5III A;  3EF2 A;  5J0P A;  3H3A A;  5J2E A;  2BBH A;  1R89 A;  4RQ7 A;  4NXV A;  1WOT A;  4PGX A;  1NOM A;  4K4G A;  1ZQJ A;  7ICI A;  4WCW A;  8ICW A;  3C5G A;  1UEU A;  4S3N A;  4QZE A;  4F5P A;  4KLG A;  4O69 A;  2O5A A;  3WFQ E;  2PXI A;  4YN4 A;  4Z6C A;  4XUS A;  9ICM A;  5HC9 A;  3MDC A;  3NWI A;  8ICJ A;  1BPX A;  3B0X A;  4LT6 A;  4IQU A;  1ZQG A;  5IIM A;  4M5D A;  4X4P A;  8ICY A;  4I2J A;  4XQ8 A;  3ISB A;  7ICP A;  3LK9 A;  4LEV A;  1MQ3 A;  2BCU A;  3UXP A;  4YCX A;  1FA0 A;  3V7L A;  4UBB A;  4KLJ A;  4XRH A;  2IUB A;  4K98 A;  4LEY A;  5D46 A;  3WFR E;  7ICV A;  3UQ2 A;  1ZQV A;  1ZQQ A;  4IQT A;  7ICR A;  3OGU A;  1KDH A;  5D61 A;  8ICP A;  8ICM A;  3H37 A;  4PGY A;  3UXN A;  5DBA A;  9ICN A;  5J0X A;  4RQ6 A;  7ICL A;  3OVA A;  7ICT A;  4LZD A;  4I2F A;  4F5N A;  5HRI A;  4K9A A;  4PGQ A;  4O5E A;  4MFA A;  2ZH1 A;  4NXU A;  1ZQZ A;  3JYY A;  3K7D A;  1ZQY A;  1ZJM A;  1JN3 A;  4K97 A;  4DO9 A;  3HWT A;  8ICQ A;  1ZQW A;  4OAF A;  1Q78 A;  2PFP A;  7ICG A;  3C66 A;  3RJH A;  4QZ9 A;  4JWN A;  4RPX A;  4UB1 A;  3ER9 B;  1GPJ A;  5BPC A;  4I2A A;  4GXI A;  2BE3 A;  4PHP A;  5CWR A;  1ZQN A;  4X4R A;  4QZC A;  4FHX A;  5DB9 A;  5DDM A;  5J2K A;  4RPZ A;  4KLU A;  9ICS A;  3LQC B;  4E7X A;  4GXJ A;  2DVI A;  1TFW A;  1MIV A;  2PFQ A;  5BOM A;  3MGI A;  9ICA A;  4WC6 A;  1ZQA A;  5HR9 A;  3AQM A;  4Z6D A;  5J0S A;  4EV6 A;  8ICA A;  4NKU A;  4X5V A;  4I2E A;  4KLL A;  5F2V O;  4RT2 A;  3AUO A;  2DR7 A;  4PHE A;  4FH3 A;  4I2H A;  4WC5 A;  4RWP A;  4WQK A;  4RQ1 A;  4K4I A;  2NRK A;  1BPB A;  4I2C A;  4RQ5 A;  4F5Q A;  4AT8 B;  2BCQ A;  4XJE A;  4Z6F A;  3RJK A;  1MQ2 A;  3UQ0 A;  4QZG A;  1TFY A;  1TVA A;  3TFR A;  4F5O A;  4NXZ A;  1JAJ A;  2BCR A;  4X4U A;  3AU2 A;  4NY8 A;  3RJE A;  5IIN A;  9ICX A;  4I29 A;  4KLQ A;  4FO6 A;  5J0Q A;  4YD2 A;  5HRB A;  5J2C A;  5CB1 A;  1ZQD A;  3WFO A;  7ICO A;  4EED A;  1JQR A;  9ICG A;  4KM5 A;  5JTG A;  4EEB A;  4X4T A;  4E80 A;  1ZQI A;  5HRK A;  3RH5 A;  4EP7 A;  8ICB A;  2EWR A;  3V7J A;  4KLM A;  7ICU A;  3JPQ A;  4UB5 A;  1XSL A;  8ICC A;  5HRG A;  4WBZ A;  4Z6E A;  5B3P A;  3TFS A;  1ZQE A;  4UB2 A;  4PHD A;  1BPE A;  7ICH A;  4FHW A;  4QZD A;  5CFS A;  4O67 A;  4LVS A;  3JPO A;  5J2F A;  4NXT A;  1ZQL A;  2M2W A;  4P4M A;  2IHO A;  2ZH3 A;  1VJ7 A;  1ZQR A;  9ICI A;  3JPS A;  7ICS A;  1R8B A;  4RPY A;  9ICU A;  2IHM A;  4X4N A;  2GA9 D;  1BPZ A;  2B51 A;  2ZH7 A;  4YMO A;  1MIW A;  4MFF A;  4FHY A;  2FCL A;  9ICQ A;  4JLZ A;  4QZI A;  4WC2 A;  3RJI A;  4WC4 A;  1OU5 A;  4UBC A;  5DBB A;  4I2I A;  4NM1 A;  2ID1 A;  3OWG A;  4RWO A;  9ICK A;  1PX5 A;  2DR9 A;  4WQL A;  4KLH A;  3UPS A;  4WBY A;  2BPC A;  4X0A A;  3C18 A;  4M9H A;  9ICR A;  4R65 A;  4M9G A;  4XA5 A;  4RWN A;  4F5R A;  4QZ8 A;  5HRL A;  5HRF A;  7ICM A;  5DB7 A;  1XSN A;  4TUP A;  4EBJ A;  4O9M A;  4AT8 A;  4P2H A;  4AT7 A;  9ICC A;  5DEC A;  4KLE A;  2RFF A;  5DB8 A;  2PBE A;  4R64 A;  4ATB A;  3HX0 A;  1UEV A;  2HN1 A;  2P66 A;  1ZQK A;  3UPQ A;  3RJJ A;  4M9L A;  3NKU A;  4LEW A;  4UB3 A;  1XSP A;  4MFC A;  4IQV A;  1ZQH A;  5B3Q A;  4RWQ A;  4OAI Z;  4EBK A;  3JPN A;  5CR0 A;  4M04 A;  4NXW A;  4O5C A;  4KLT A;  3OV7 A;  2W9M A;  8ICZ A;  5J0W A;  5CJ7 A;  2DR8 A;  4MF2 A;  1ZQP A;  1BPD A;  4JLX A;  4K4H A;  8ICK A;  1ZQU A;  5CFT A;  3OUY A;  3GDX A;  8ICL A;  8ICR A;  9ICW A;  9ICJ A;  3PNC A;  1HUO A;  3MGH A;  4WH5 A;  4RQ0 A;  5DDY A;  9ICL A;  8ICN A;  8ICI A;  5J29 A;  3AQN A;  4K9B A;  4AT7 B;  3JPT A;  4LZG A;  4I0U A;  2ZHB A;  5J0Y A;  8ICT A;  3RH6 A;  5J0O A;  8ICF A;  4ATB B;  4MF8 A;  5EOZ A;  1ZQB A;  4KLI A;  8ICX A;  9ICH A;  1TV9 A;  4NM2 A;  5CHG A;  2BCS A;  4I28 A;  2BCV A;  5J2A A;  2ZH8 A;  5D49 A;  8ICU A;  4JWM A;  8ICV A;  3OVB A;  2M2V A;  3JPP A;  5CA7 A;  3C2M A;  5J0R A;  2ZH2 A;  1BPY A;  4K99 A;  4I2G A;  2BPG A;  8ICS A;  3RJF A;  3OUY B;  2ZH9 A;  1V4A A;  4P4O A;  3RJG A;  4RQ4 A;  4M2Y A; 
#chains in the Genus database with same CATH homology
 4OAH A;  5D62 A;  3ER9 B;  1GPJ A;  5CFU A;  3ERC C;  3NKU A;  4LEW A;  4NXV A;  4WQK A;  4WH5 A;  2GA9 D;  3ER8 C;  2EWR A;  2B51 A;  4FO1 A;  4NXX A;  5B3Q A;  4OAI Z;  4K9A A;  4NXW A;  4MKP A;  2B4V A;  4HX0 A;  4XJE A;  4NXU A;  2FCL A;  4LEV A;  3K7D A;  4OAG A;  5B3P A;  4JLZ A;  5CHE A;  4WOY A;  3PHZ A;  4K9B A;  4K99 A;  5D63 A;  4LEZ A;  4O69 A;  4K97 A;  5CFS A;  4O67 A;  4O6A A;  4K98 A;  4LEY A;  4O68 A;  4NXT A;  4JLX A;  4N7R A;  2B56 A;  4KB6 A;  3OWG A;  4K8V A;  4OAF A;  2IHO A;  2GAF D;  3EF2 A;  3MCR A;  4WQL A;  5CFT A;  4K96 A;  4KM5 A;  5D61 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...