4WQKA

Crystal structure of aminoglycoside nucleotidylyltransferase ant(2")-ia, apo form
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
175
structure length
175
Chain Sequence
TTQVTLIHKILAAADERNLPLWIGGGWAIDARLGRVTRKHDDIDLTFPGERRGELEAIVEMLGGRVMEELDYGFLAEIGDELLDCEPAWWADEAYEIAEAPQGSCPEAAEGVIAGRPVRCNSWEAIIWDYFYYADEVPPVDWPTKHIESYRLACTSLGAEKVEVLRAAFRSRYAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Molecular Basis for Resistance to Aminoglycoside Antibiotics by the Adenylyltransferase ANT(2)-Ia.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Transferase
molecule keywords 2''-aminoglycoside nucleotidyltransferase
total genus 60
structure length 175
sequence length 175
ec nomenclature ec 2.7.7.46: Gentamicin 2''-nucleotidyltransferase.
pdb deposition date 2014-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10706 Aminoglyc_resit Aminoglycoside-2''-adenylyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.460.40 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 4wqkA00
2FCLA 4XJEA 5CFTA 4FO1A 5CFUA 4WH5A 2EWRA 4WQLA 4WQKA 4HX0A 5CFSA
chains in the Genus database with same CATH superfamily
4K97A 4PHAA 1BPEA 4IQWA 1RPLA 5DBCA 1UETA 4EV6A 4AT8B 5J0UA 1ZQPA 1ZQFA 8ICBA 4RT2A 2FMQA 5IIJA 3NYBA 4X4NA 4S3NA 2FMPA 2ZH8A 5HRGA 5DB8A 1XSLA 3V72A 4TUQA 3H39A 4YMNA 4RWOA 4X5VA 4WC0A 5HRLA 1OU5A 8ICTA 4NLKA 1BPXA 1VFGA 5IIOA 1TV9A 2PXIA 4WBYA 4KLGA 3WFRE 3MDAA 3ER9B 4K98A 2ZH9A 4GXIA 5J2AA 3OVAA 3JPRA 2EWRA 3MBYA 3ERCC 4KLFA 4NM1A 3JPSA 2VANA 5HREA 4K9AA 1MQ3A 1GPJA 1NOMA 5HR9A 4I2BA 3RJIA 4NM2A 4LEZA 4N7RA 4M9LA 4PGXA 8ICAA 3LQCB 5BOLA 3AUOA 3C18A 5CP2A 4ATBA 4F5RA 2HHPA 3CK6A 4FHXA 3V7LA 4KLJA 8ICQA 1ZQGA 4NXXA 5HRKA 4M9JA 8ICWA 2DRBA 4ATBB 3JPOA 4K96A 5HRBA 5HRHA 4QZ9A 8ICMA 4EBJA 4UD4A 3JPTA 4XUSA 4UAWA 7ICHA 8ICFA 4M2YA 4M5DA 4X4UA 9ICBA 4Z6CA 5DKWA 4I2EA 4WC7A 4M9GA 2DR5A 4X0BA 2HN2A 5D49A 4WOYA 3TFSA 5IINA 1KNYA 3OUYB 1HUOA 4IQUA 5EOZA 9ICUA 2DVIA 4F5NA 3TFRA 4UAZA 1ZJNA 4KLDA 4F5OA 4P2HA 2DR8A 4PHDA 8ICUA 4MKPA 8ICPA 4AT7B 7ICLA 4EBKA 4E7XA 4QZEA 4P4OA 3UXNA 4MF8A 7ICNA 3WFSC 3AQNA 4Z6FA 7ICJA 9ICQA 5D46A 4UB3A 4MFAA 1Q79A 5D63A 5HC9A 1ZQUA 4X4RA 4MFCA 4WQKA 7ICKA 3L9DA 4KB6A 1HUZA 8ICKA 4LT6A 5J2FA 4EGWA 2ZHBA 2FCLA 4EEBA 1R8AA 2BBHA 2M2WA 2HN1A 5CFSA 5J29A 1NO5A 1ZQMA 9ICIA 7ICUA 1MIVA 5CA7A 4WH5A 4WC3A 5CJ7A 4OAHA 4AT9A 3RJHA 3JCFA 4UBCA 4FHVA 4I2JA 3C5GA 1ZQRA 4RWNA 5D61A 3RJKA 4FHWA 4PGYA 4JLZA 4TUSA 4E80A 4QZIA 4UBBA 4R64A 3MCRA 5CFTA 5J0XA 3HW8A 5J0OA 9ICAA 2B56A 3HJ1A 4O5KA 3WFOA 4AT7A 4M47A 9ICOA 4LEWA 2GA9D 3OVBA 1R89A 4NXUA 5J0PA 4K4HA 9ICHA 1ZQVA 5J0SA 4QZGA 4KLIA 5DB7A 5J2HA 4M9HA 4JWMA 1ZQLA 2DR9A 7ICIA 4RQ5A 3MDCA 4X4TA 4M04A 4NKUA 2NRKA 2BCQA 4RQ7A 1ZQDA 4PHEA 4GXKA 5J2KA 2ZHAA 3RH5A 4YCXA 4RPXA 1ZQHA 2PBEA 5CB1A 4PGQA 3PNCA 1ZQTA 8ICEA 9ICNA 5BPCA 3HIYA 5J2IA 7ICPA 5B3QA 1YLQA 4KM5A 7ICQA 9ICRA 2FMSA 4UB1A 4X4SA 4NXTA 4I2CA 3HWTA 3OV7A 4WC2A 4LZGA 1BPZA 4LEVA 3AQKA 4RQ0A 5IIMA 2I9GA 4E8FA 5JTGA 4WQLA 4QZ8A 3RJGA 7ICVA 4K4IA 1ZJMA 4PPXA 2DRAA 8ICJA 4RQ2A 3WFQE 5DECA 4I29A 9ICVA 8ICXA 2M2VA 4LVSA 4K9BA 8ICLA 4Z6DA 4RPYA 4AT8A 5IIIA 1TVAA 3UQ0A 9ICJA 7ICMA 2BCSA 3OVSA 4M0AA 2BE3A 4NY8A 5J2EA 3PMLA 4I2AA 3OUYA 4KLSA 3RH4A 4TURA 2ZH1A 3C2MA 7ICEA 5HRFA 4TUPA 1ZQIA 5J2BA 4R66A 4QZAA 2BPGA 2P66A 4FHPA 1KEJA 8ICZA 1ZQNA 4YD2A 1BPYA 4X4OA 3UPSA 3LK9A 4K99A 4R65A 1R8CA 1MIWA 3GDXA 1TFYA 2BBJA 3UXPA 3NKUA 4OAIZ 5J0RA 4F5PA 3ISBA 5J2CA 2BPCA 2PFNA 2PFPA 4QZCA 4FHYA 4O5EA 3MGHA 7ICSA 5DEDA 2B4VA 1ZQAA 9ICTA 8ICVA 2O1PA 9ICXA 2W9MA 3RJFA 4RPZA 4YN4A 3H38A 4OAFA 2ZH7A 5HRDA 9ICFA 4KLEA 7ICFA 5TZVA 4QZBA 4I2HA 9ICKA 4JLXA 9ICSA 2IHOA 4DO9A 4NLZA 1JQRA 4XA5A 3NWIA 4RWQA 4XQ8A 5HHIA 1BPDA 3AU2A 1ZQOA 3C2KA 4KLUA 3JYYA 4NXZA 4RQ8A 4IG8A 1JMSA 4O68A 3UXOA 9ICLA 1ZQSA 5B3PA 2RFFA 3NVOA 4I0UA 4EP7A 4FO6A 3B0XA 5DBAA 4UD5A 4GXJA 1ZQCA 2ISOA 8ICGA 3C2LA 3AU6A 1MIYA 4UB5A 3OGUA 5F2VO 4YMMA 5DB9A 5D4BA 3HJ4A 2GWSA 2ISPA 1ZQXA 3C5FA 4NXVA 4WC6A 2PFQA 5DDYA 4I2IA 2ZH3A 4WCWA 2ID1A 5J0WA 5D62A 3ER8C 2GAFD 5HRIA 1F5AA 3C66A 4UB4A 4I2DA 5CWRA 3UPQA 3AQMA 1ZQWA 2DR7A 5CFUA 9ICGA 4P4MA 3OWGA 3MGIA 1XSNA 1UEVA 9ICPA 4OAGA 4UB2A 1MQ2A 4KLLA 4I2GA 2ZH5A 8ICCA 4RWPA 2IUBA 5IILA 1KDHA 4O5CA 3EF2A 5J0TA 1ZQQA 3RJEA 1ZQZA 3JPPA 4WC4A 2BPFA 1RZTA 4NLNA 3RH6A 4X0AA 2BCRA 4DOCA 2PFOA 3K7DA 3V7JA 4I27A 3V7KA 3H37A 4P4PA 3B0YA 4LEYA 4YD1A 4QZFA 4QZHA 1FA0A 2IHMA 5DB6A 4F5QA 4I2FA 3ISDA 3K75D 5CR0A 4XJEA 3PHZA 7ICTA 4HX0A 2O5AA 5J2DA 4RT3A 1PX5A 4DOBA 5J2GA 3ISCA 5BOMA 1ZQYA 4KLQA 4O6AA 4UAYA 3JPNA 2ZH4A 9ICEA 5CHEA 3UQ2A 3WFPA 1JAJA 7ICRA 3JPQA 7ICOA 3RJJA 1UEUA 4RQ4A 4O67A 4QZDA 4FH3A 4WC1A 3PMNA 8ICNA 4FH5A 4YMOA 4DOAA 4PH5A 4X4QA 4M9NA 2BCVA 4FO1A 4LZDA 5CHGA 4X4PA 4Z6EA 1ZQEA 4I28A 5IIKA 8ICRA 4NXWA 4RQ3A 2BCUA 1TFWA 4PHPA 9ICWA 1VJ7A 4WC5A 4XQ7A 4O9MA 1BPBA 4MF2A 8ICSA 1ZQBA 2ZH2A 4K4GA 4KLTA 3AQLA 4X4VA 2B51A 2ZH6A 4WBZA 4R63A 5DDMA 5J2JA 4KLHA 5J0YA 1ZQKA 9ICMA 4RQ6A 5HHHA 4AT9B 4IQTA 4NKTA 1ZQJA 4JWNA 4XRHA 5DBBA 4KLMA 7ICGA 9ICCA 1V4AA 8ICYA 3H3AA 4O69A 1R8BA 4IQVA 8ICIA 1XSPA 1Q78A 5J0QA 2Q66A 2M2TA 8ICOA 1WOTA 3HX0A 2M2UA 8ICHA 4K8VA 1JN3A 4KLOA 4RQ1A 4MFFA 4EEDA 3JZ0A
chains in the Genus database with same CATH topology
3NKUA 2IHOA 2GA9D 4LEWA 4OAIZ 4O67A 4XJEA 4K97A 4NXUA 5B3QA 3PHZA 4KM5A 2B51A 4WH5A 3EF2A 4WOYA 4OAHA 4NXVA 3ER9B 4HX0A 4NXTA 4K98A 5D63A 4NXXA 5D62A 4FO1A 3ER8C 2EWRA 2GAFD 3ERCC 4WQKA 2B4VA 4NXWA 4O68A 5D61A 3K7DA 4LEVA 4JLZA 4O69A 4KB6A 4K96A 4K9AA 1GPJA 5B3PA 5CFUA 4WQLA 4LEYA 4O6AA 3OWGA 4LEZA 4N7RA 4OAGA 2FCLA 3MCRA 4MKPA 4OAFA 5CFTA 4K99A 5CHEA 4K8VA 4K9BA 2B56A 4JLXA 5CFSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FCL A;  4XJE A;  5CFT A;  4FO1 A;  5CFU A;  4WH5 A;  2EWR A;  4WQL A;  4WQK A;  4HX0 A;  5CFS A; 
#chains in the Genus database with same CATH topology
 4K97 A;  4PHA A;  1BPE A;  4IQW A;  1RPL A;  5DBC A;  1UET A;  4EV6 A;  4AT8 B;  5J0U A;  1ZQP A;  1ZQF A;  8ICB A;  4RT2 A;  2FMQ A;  5IIJ A;  3NYB A;  4X4N A;  4S3N A;  2FMP A;  2ZH8 A;  5HRG A;  5DB8 A;  1XSL A;  3V72 A;  4TUQ A;  3H39 A;  4YMN A;  4RWO A;  4X5V A;  4WC0 A;  5HRL A;  1OU5 A;  8ICT A;  4NLK A;  1BPX A;  1VFG A;  5IIO A;  1TV9 A;  2PXI A;  4WBY A;  4KLG A;  3WFR E;  3MDA A;  3ER9 B;  4K98 A;  2ZH9 A;  4GXI A;  5J2A A;  3OVA A;  3JPR A;  2EWR A;  3MBY A;  3ERC C;  4KLF A;  4NM1 A;  3JPS A;  2VAN A;  5HRE A;  4K9A A;  1MQ3 A;  1GPJ A;  1NOM A;  5HR9 A;  4I2B A;  3RJI A;  4NM2 A;  4LEZ A;  4N7R A;  4M9L A;  4PGX A;  8ICA A;  3LQC B;  5BOL A;  3AUO A;  3C18 A;  5CP2 A;  4ATB A;  4F5R A;  2HHP A;  3CK6 A;  4FHX A;  3V7L A;  4KLJ A;  8ICQ A;  1ZQG A;  4NXX A;  5HRK A;  4M9J A;  8ICW A;  2DRB A;  4ATB B;  3JPO A;  4K96 A;  5HRB A;  5HRH A;  4QZ9 A;  8ICM A;  4EBJ A;  4UD4 A;  3JPT A;  4XUS A;  4UAW A;  7ICH A;  8ICF A;  4M2Y A;  4M5D A;  4X4U A;  9ICB A;  4Z6C A;  5DKW A;  4I2E A;  4WC7 A;  4M9G A;  2DR5 A;  4X0B A;  2HN2 A;  5D49 A;  4WOY A;  3TFS A;  5IIN A;  1KNY A;  3OUY B;  1HUO A;  4IQU A;  5EOZ A;  9ICU A;  2DVI A;  4F5N A;  3TFR A;  4UAZ A;  1ZJN A;  4KLD A;  4F5O A;  4P2H A;  2DR8 A;  4PHD A;  8ICU A;  4MKP A;  8ICP A;  4AT7 B;  7ICL A;  4EBK A;  4E7X A;  4QZE A;  4P4O A;  3UXN A;  4MF8 A;  7ICN A;  3WFS C;  3AQN A;  4Z6F A;  7ICJ A;  9ICQ A;  5D46 A;  4UB3 A;  4MFA A;  1Q79 A;  5D63 A;  5HC9 A;  1ZQU A;  4X4R A;  4MFC A;  4WQK A;  7ICK A;  3L9D A;  4KB6 A;  1HUZ A;  8ICK A;  4LT6 A;  5J2F A;  4EGW A;  2ZHB A;  2FCL A;  4EEB A;  1R8A A;  2BBH A;  2M2W A;  2HN1 A;  5CFS A;  5J29 A;  1NO5 A;  1ZQM A;  9ICI A;  7ICU A;  1MIV A;  5CA7 A;  4WH5 A;  4WC3 A;  5CJ7 A;  4OAH A;  4AT9 A;  3RJH A;  3JCF A;  4UBC A;  4FHV A;  4I2J A;  3C5G A;  1ZQR A;  4RWN A;  5D61 A;  3RJK A;  4FHW A;  4PGY A;  4JLZ A;  4TUS A;  4E80 A;  4QZI A;  4UBB A;  4R64 A;  3MCR A;  5CFT A;  5J0X A;  3HW8 A;  5J0O A;  9ICA A;  2B56 A;  3HJ1 A;  4O5K A;  3WFO A;  4AT7 A;  4M47 A;  9ICO A;  4LEW A;  2GA9 D;  3OVB A;  1R89 A;  4NXU A;  5J0P A;  4K4H A;  9ICH A;  1ZQV A;  5J0S A;  4QZG A;  4KLI A;  5DB7 A;  5J2H A;  4M9H A;  4JWM A;  1ZQL A;  2DR9 A;  7ICI A;  4RQ5 A;  3MDC A;  4X4T A;  4M04 A;  4NKU A;  2NRK A;  2BCQ A;  4RQ7 A;  1ZQD A;  4PHE A;  4GXK A;  5J2K A;  2ZHA A;  3RH5 A;  4YCX A;  4RPX A;  1ZQH A;  2PBE A;  5CB1 A;  4PGQ A;  3PNC A;  1ZQT A;  8ICE A;  9ICN A;  5BPC A;  3HIY A;  5J2I A;  7ICP A;  5B3Q A;  1YLQ A;  4KM5 A;  7ICQ A;  9ICR A;  2FMS A;  4UB1 A;  4X4S A;  4NXT A;  4I2C A;  3HWT A;  3OV7 A;  4WC2 A;  4LZG A;  1BPZ A;  4LEV A;  3AQK A;  4RQ0 A;  5IIM A;  2I9G A;  4E8F A;  5JTG A;  4WQL A;  4QZ8 A;  3RJG A;  7ICV A;  4K4I A;  1ZJM A;  4PPX A;  2DRA A;  8ICJ A;  4RQ2 A;  3WFQ E;  5DEC A;  4I29 A;  9ICV A;  8ICX A;  2M2V A;  4LVS A;  4K9B A;  8ICL A;  4Z6D A;  4RPY A;  4AT8 A;  5III A;  1TVA A;  3UQ0 A;  9ICJ A;  7ICM A;  2BCS A;  3OVS A;  4M0A A;  2BE3 A;  4NY8 A;  5J2E A;  3PML A;  4I2A A;  3OUY A;  4KLS A;  3RH4 A;  4TUR A;  2ZH1 A;  3C2M A;  7ICE A;  5HRF A;  4TUP A;  1ZQI A;  5J2B A;  4R66 A;  4QZA A;  2BPG A;  2P66 A;  4FHP A;  1KEJ A;  8ICZ A;  1ZQN A;  4YD2 A;  1BPY A;  4X4O A;  3UPS A;  3LK9 A;  4K99 A;  4R65 A;  1R8C A;  1MIW A;  3GDX A;  1TFY A;  2BBJ A;  3UXP A;  3NKU A;  4OAI Z;  5J0R A;  4F5P A;  3ISB A;  5J2C A;  2BPC A;  2PFN A;  2PFP A;  4QZC A;  4FHY A;  4O5E A;  3MGH A;  7ICS A;  5DED A;  2B4V A;  1ZQA A;  9ICT A;  8ICV A;  2O1P A;  9ICX A;  2W9M A;  3RJF A;  4RPZ A;  4YN4 A;  3H38 A;  4OAF A;  2ZH7 A;  5HRD A;  9ICF A;  4KLE A;  7ICF A;  5TZV A;  4QZB A;  4I2H A;  9ICK A;  4JLX A;  9ICS A;  2IHO A;  4DO9 A;  4NLZ A;  1JQR A;  4XA5 A;  3NWI A;  4RWQ A;  4XQ8 A;  5HHI A;  1BPD A;  3AU2 A;  1ZQO A;  3C2K A;  4KLU A;  3JYY A;  4NXZ A;  4RQ8 A;  4IG8 A;  1JMS A;  4O68 A;  3UXO A;  9ICL A;  1ZQS A;  5B3P A;  2RFF A;  3NVO A;  4I0U A;  4EP7 A;  4FO6 A;  3B0X A;  5DBA A;  4UD5 A;  4GXJ A;  1ZQC A;  2ISO A;  8ICG A;  3C2L A;  3AU6 A;  1MIY A;  4UB5 A;  3OGU A;  5F2V O;  4YMM A;  5DB9 A;  5D4B A;  3HJ4 A;  2GWS A;  2ISP A;  1ZQX A;  3C5F A;  4NXV A;  4WC6 A;  2PFQ A;  5DDY A;  4I2I A;  2ZH3 A;  4WCW A;  2ID1 A;  5J0W A;  5D62 A;  3ER8 C;  2GAF D;  5HRI A;  1F5A A;  3C66 A;  4UB4 A;  4I2D A;  5CWR A;  3UPQ A;  3AQM A;  1ZQW A;  2DR7 A;  5CFU A;  9ICG A;  4P4M A;  3OWG A;  3MGI A;  1XSN A;  1UEV A;  9ICP A;  4OAG A;  4UB2 A;  1MQ2 A;  4KLL A;  4I2G A;  2ZH5 A;  8ICC A;  4RWP A;  2IUB A;  5IIL A;  1KDH A;  4O5C A;  3EF2 A;  5J0T A;  1ZQQ A;  3RJE A;  1ZQZ A;  3JPP A;  4WC4 A;  2BPF A;  1RZT A;  4NLN A;  3RH6 A;  4X0A A;  2BCR A;  4DOC A;  2PFO A;  3K7D A;  3V7J A;  4I27 A;  3V7K A;  3H37 A;  4P4P A;  3B0Y A;  4LEY A;  4YD1 A;  4QZF A;  4QZH A;  1FA0 A;  2IHM A;  5DB6 A;  4F5Q A;  4I2F A;  3ISD A;  3K75 D;  5CR0 A;  4XJE A;  3PHZ A;  7ICT A;  4HX0 A;  2O5A A;  5J2D A;  4RT3 A;  1PX5 A;  4DOB A;  5J2G A;  3ISC A;  5BOM A;  1ZQY A;  4KLQ A;  4O6A A;  4UAY A;  3JPN A;  2ZH4 A;  9ICE A;  5CHE A;  3UQ2 A;  3WFP A;  1JAJ A;  7ICR A;  3JPQ A;  7ICO A;  3RJJ A;  1UEU A;  4RQ4 A;  4O67 A;  4QZD A;  4FH3 A;  4WC1 A;  3PMN A;  8ICN A;  4FH5 A;  4YMO A;  4DOA A;  4PH5 A;  4X4Q A;  4M9N A;  2BCV A;  4FO1 A;  4LZD A;  5CHG A;  4X4P A;  4Z6E A;  1ZQE A;  4I28 A;  5IIK A;  8ICR A;  4NXW A;  4RQ3 A;  2BCU A;  1TFW A;  4PHP A;  9ICW A;  1VJ7 A;  4WC5 A;  4XQ7 A;  4O9M A;  1BPB A;  4MF2 A;  8ICS A;  1ZQB A;  2ZH2 A;  4K4G A;  4KLT A;  3AQL A;  4X4V A;  2B51 A;  2ZH6 A;  4WBZ A;  4R63 A;  5DDM A;  5J2J A;  4KLH A;  5J0Y A;  1ZQK A;  9ICM A;  4RQ6 A;  5HHH A;  4AT9 B;  4IQT A;  4NKT A;  1ZQJ A;  4JWN A;  4XRH A;  5DBB A;  4KLM A;  7ICG A;  9ICC A;  1V4A A;  8ICY A;  3H3A A;  4O69 A;  1R8B A;  4IQV A;  8ICI A;  1XSP A;  1Q78 A;  5J0Q A;  2Q66 A;  2M2T A;  8ICO A;  1WOT A;  3HX0 A;  2M2U A;  8ICH A;  4K8V A;  1JN3 A;  4KLO A;  4RQ1 A;  4MFF A;  4EED A;  3JZ0 A; 
#chains in the Genus database with same CATH homology
 3NKU A;  2IHO A;  2GA9 D;  4LEW A;  4OAI Z;  4O67 A;  4XJE A;  4K97 A;  4NXU A;  5B3Q A;  3PHZ A;  4KM5 A;  2B51 A;  4WH5 A;  3EF2 A;  4WOY A;  4OAH A;  4NXV A;  3ER9 B;  4HX0 A;  4NXT A;  4K98 A;  5D63 A;  4NXX A;  5D62 A;  4FO1 A;  3ER8 C;  2EWR A;  2GAF D;  3ERC C;  4WQK A;  2B4V A;  4NXW A;  4O68 A;  5D61 A;  3K7D A;  4LEV A;  4JLZ A;  4O69 A;  4KB6 A;  4K96 A;  4K9A A;  1GPJ A;  5B3P A;  5CFU A;  4WQL A;  4LEY A;  4O6A A;  3OWG A;  4LEZ A;  4N7R A;  4OAG A;  2FCL A;  3MCR A;  4MKP A;  4OAF A;  5CFT A;  4K99 A;  5CHE A;  4K8V A;  4K9B A;  2B56 A;  4JLX A;  5CFS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...