4WQKA

Crystal structure of aminoglycoside nucleotidylyltransferase ant(2")-ia, apo form
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
175
structure length
175
Chain Sequence
TTQVTLIHKILAAADERNLPLWIGGGWAIDARLGRVTRKHDDIDLTFPGERRGELEAIVEMLGGRVMEELDYGFLAEIGDELLDCEPAWWADEAYEIAEAPQGSCPEAAEGVIAGRPVRCNSWEAIIWDYFYYADEVPPVDWPTKHIESYRLACTSLGAEKVEVLRAAFRSRYAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords 2''-aminoglycoside nucleotidyltransferase
publication title Structural and Molecular Basis for Resistance to Aminoglycoside Antibiotics by the Adenylyltransferase ANT(2)-Ia.
pubmed doi rcsb
source organism Klebsiella pneumoniae
total genus 60
structure length 175
sequence length 175
ec nomenclature ec 2.7.7.46: Gentamicin 2''-nucleotidyltransferase.
pdb deposition date 2014-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10706 Aminoglyc_resit Aminoglycoside-2''-adenylyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.460.40 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 4wqkA00
4WH5A 4HX0A 2FCLA 4FO1A 4XJEA 4WQKA 5CFSA 5CFUA 4WQLA 2EWRA 5CFTA
chains in the Genus database with same CATH superfamily
4NXXA 3V7LA 5TZVA 4JWMA 5HHIA 4I2GA 5F2VO 4NY8A 7ICVA 4ATBB 2ZH1A 1ZQGA 5J2JA 3H38A 4RPZA 8ICHA 4TURA 4NM2A 5J0WA 5HRBA 5BPCA 7ICMA 9ICLA 2FCLA 4WC4A 8ICMA 4FHWA 5B3QA 3OWGA 4F5OA 8ICBA 1Q79A 2O1PA 1OU5A 2ZH8A 4UB1A 1ZQWA 2BBJA 2GA9D 4UB5A 4K4HA 1MIVA 5J2HA 5J2IA 4P2HA 4O6AA 2BPFA 1ZQDA 4KM5A 8ICGA 4RQ2A 1ZQVA 5CHGA 7ICJA 1GPJA 5DBAA 7ICNA 2ZH7A 4P4OA 2I9GA 4UAZA 1R89A 4X4VA 4XQ7A 4EBKA 5DB9A 2PBEA 4UBCA 1YLQA 1TV9A 2PFQA 4I2HA 5J2FA 8ICAA 9ICHA 4K9AA 5D63A 5DEDA 4KLSA 2W9MA 5HRDA 4LEWA 4E80A 4K96A 4RQ3A 2ZH2A 2ZHAA 3C18A 1XSLA 4KLTA 5J0PA 3UXPA 4K97A 4WC6A 3TFSA 1JN3A 5BOLA 4XA5A 4I2CA 4IG8A 4KLHA 2B4VA 4AT7A 3JPQA 4KLFA 5IIKA 3NWIA 3MGHA 8ICNA 5D4BA 3HX0A 4K4GA 2NRKA 5D46A 3AQMA 4NKTA 8ICOA 2PFOA 8ICRA 2FMQA 4RQ4A 4XRHA 4MF8A 3RJIA 7ICIA 3LQCB 2BE3A 4EEDA 9ICQA 1BPDA 4DO9A 4M5DA 4RT2A 4NLNA 1VFGA 9ICVA 4GXKA 2ID1A 4RQ8A 5IIIA 3K75D 1BPZA 4X4TA 1RPLA 4F5QA 2BPCA 3OUYB 4FHYA 2PFPA 4M9GA 4MFFA 2BCUA 8ICTA 5DBBA 9ICJA 1ZQMA 5J2CA 4KLLA 4UAYA 3ERCC 5J0YA 4I28A 4I29A 1JMSA 3B0XA 4WBYA 4F5RA 9ICMA 4WQLA 2P66A 5CHEA 5HHHA 1ZQHA 4PGYA 3OVAA 4Z6FA 5IIJA 4XJEA 3H39A 3L9DA 4IQWA 4OAHA 3JPNA 3EF2A 4M47A 9ICPA 4PPXA 8ICQA 2RFFA 3LK9A 3AU6A 9ICXA 4QZBA 4NXZA 4FHVA 4EGWA 5HRHA 1BPEA 3H3AA 2O5AA 5IIOA 1XSPA 3C2LA 3H37A 4WH5A 1ZQPA 4X4RA 2BPGA 2HN2A 3RJFA 4KLGA 3PMNA 9ICKA 1KDHA 4KLJA 2B51A 4LZGA 5HREA 8ICZA 2DVIA 4AT9A 3OV7A 4WOYA 4FHXA 4KLIA 4TUSA 4GXJA 4IQVA 4WC0A 2DR8A 1BPYA 5CA7A 3AQLA 8ICUA 3HJ1A 1TFWA 4X4UA 3RH4A 4QZCA 3ER8C 3RJHA 4QZ8A 2IHOA 3ISCA 4LEVA 5J0QA 7ICHA 3K7DA 1ZQBA 8ICJA 4QZDA 3RH6A 2EWRA 5EOZA 1ZQAA 4UB2A 4M04A 4F5NA 9ICSA 7ICOA 8ICPA 5CR0A 3AU2A 1ZQCA 1V4AA 3WFSC 5CFSA 3WFRE 4QZEA 5J2GA 5D49A 4WCWA 3JPTA 2ZH6A 1TFYA 4P4PA 4RQ5A 4KLUA 3JPOA 7ICSA 5HRGA 1R8CA 3UXNA 5IIMA 3ISBA 2ZH4A 1ZQFA 4K9BA 4AT7B 1MQ3A 2BCSA 4FO1A 4JLXA 2BCQA 8ICCA 8ICSA 3V7KA 4WC2A 4UBBA 7ICTA 4EP7A 2Q66A 4WQKA 2ISOA 4M9HA 4PHPA 4AT8A 4FH3A 1ZQUA 4DOBA 5DBCA 1MIYA 4UD5A 4YD1A 4KB6A 4I27A 4PHEA 4O5KA 4NXVA 1XSNA 7ICKA 1ZQQA 1ZQZA 8ICFA 4NLKA 4M0AA 4R66A 2GWSA 1Q78A 5J2BA 4EV6A 3AUOA 2VANA 5B3PA 1R8AA 2FMSA 2B56A 5CB1A 4QZIA 4MFAA 3C5GA 4O9MA 4Z6CA 3JPRA 3ER9B 3NYBA 3HW8A 1ZQLA 4YD2A 3V72A 9ICFA 2HHPA 4XUSA 4K99A 5JTGA 9ICRA 5CFUA 1JQRA 3ISDA 4LEZA 2ZH9A 1HUZA 9ICOA 4WC3A 5HRIA 4KLEA 4IQUA 4JLZA 7ICFA 9ICCA 5DDYA 4X4PA 4RWOA 4LEYA 4X4QA 7ICRA 4QZHA 5J29A 8ICXA 4E8FA 3JCFA 3MDCA 8ICVA 4X4SA 4QZAA 3OUYA 9ICEA 4OAGA 3WFOA 4DOCA 3JYYA 4I2JA 4F5PA 3HJ4A 2DRAA 4O5CA 4NLZA 8ICYA 1TVAA 2M2TA 4AT9B 1ZQIA 9ICBA 4M9JA 5J0UA 1ZQRA 4PHAA 3C5FA 3RJKA 2IUBA 5IINA 3C2KA 4UD4A 3UXOA 9ICWA 2PFNA 4XQ8A 4PH5A 3MDAA 1ZJNA 3PHZA 4RWQA 4S3NA 4IQTA 4KLOA 5J2DA 4I2EA 4YMOA 1KNYA 4PHDA 5D61A 2M2VA 4X4OA 1RZTA 5HC9A 8ICEA 3MCRA 1ZQNA 4GXIA 4TUPA 2M2WA 2FMPA 3OVBA 9ICTA 3C2MA 4I0UA 3MBYA 3PMLA 3UPSA 4HX0A 5J2AA 4O68A 4TUQA 1ZQJA 4O67A 3RJEA 5D62A 4ATBA 3OVSA 1ZQOA 5CFTA 3OGUA 4RQ1A 3JPSA 3UQ2A 4LZDA 4I2FA 3B0YA 2ZH5A 5DECA 7ICQA 4I2IA 1R8BA 4EEBA 9ICNA 4MKPA 4RPYA 1JAJA 3WFQE 4NM1A 4I2BA 2DRBA 4LVSA 5DB6A 3HIYA 4FH5A 3GDXA 1MIWA 4AT8B 1NOMA 9ICGA 4QZ9A 3NVOA 8ICKA 7ICUA 9ICIA 8ICLA 4WC5A 4YCXA 3RJGA 5CJ7A 2ISPA 4K98A 2BCRA 1FA0A 4EBJA 4X0BA 9ICAA 5J0TA 4UB4A 4NXUA 3RH5A 1UETA 7ICPA 4X4NA 4RWNA 1ZQKA 7ICLA 4WC7A 1ZQTA 2DR9A 3CK6A 1MQ2A 4NKUA 1ZQYA 4PGQA 4KLMA 4KLQA 4N7RA 1PX5A 1BPBA 1KEJA 5HRKA 3MGIA 4QZFA 2DR5A 4K8VA 4MFCA 1WOTA 4JWNA 3AQKA 4OAIZ 4WC1A 5CWRA 2ZHBA 5J0SA 2BCVA 3WFPA 3PNCA 4RQ6A 1UEUA 8ICWA 5DB8A 4R64A 2BBHA 2M2UA 3AQNA 4RQ7A 4KLDA 4MF2A 4YMMA 3HWTA 4RQ0A 4I2DA 4RPXA 5IILA 3RJJA 4FHPA 4WBZA 4O69A 2DR7A 1NO5A 5HRLA 4NXTA 1BPXA 4M9LA 8ICIA 9ICUA 3TFRA 4PGXA 4UAWA 4R65A 3V7JA 4LT6A 4OAFA 5J0RA 1VJ7A 5J0OA 3JPPA 3C66A 4UB3A 4O5EA 5CP2A 3JZ0A 5HRFA 4Z6DA 4DOAA 1ZQEA 4RT3A 3NKUA 5J2EA 2GAFD 4YN4A 4RWPA 5J0XA 1ZJMA 4I2AA 1UEVA 5J2KA 7ICEA 5DKWA 4FO6A 4K4IA 1ZQSA 3UQ0A 4X5VA 4R63A 4M2YA 5DDMA 2ZH3A 4YMNA 4M9NA 4NXWA 3UPQA 1F5AA 4P4MA 4Z6EA 2PXIA 5HR9A 4QZGA 7ICGA 4X0AA 5BOMA 5DB7A 4E7XA 1HUOA 2HN1A 2IHMA 1ZQXA
chains in the Genus database with same CATH topology
4NXXA 3ERCC 3NKUA 4O6AA 2GAFD 4KM5A 4MKPA 4NXVA 4K99A 5D61A 4K9BA 4K97A 5CFUA 3ER8C 4WQLA 5CHEA 2IHOA 3MCRA 1GPJA 4LEVA 4WH5A 4FO1A 4LEZA 3K7DA 4JLXA 4XJEA 4O69A 2B51A 4N7RA 2EWRA 2B4VA 4NXWA 4NXTA 4OAHA 3EF2A 4K8VA 2FCLA 4HX0A 4JLZA 4O68A 4O67A 5D62A 4OAIZ 5B3PA 5B3QA 3OWGA 4WOYA 4WQKA 5CFSA 4OAFA 4LEYA 5CFTA 2B56A 4K98A 4K9AA 5D63A 3ER9B 4NXUA 4LEWA 3PHZA 2GA9D 4K96A 4KB6A 4OAGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WH5 A;  4HX0 A;  2FCL A;  4FO1 A;  4XJE A;  4WQK A;  5CFS A;  5CFU A;  4WQL A;  2EWR A;  5CFT A; 
#chains in the Genus database with same CATH topology
 4NXX A;  3V7L A;  5TZV A;  4JWM A;  5HHI A;  4I2G A;  5F2V O;  4NY8 A;  7ICV A;  4ATB B;  2ZH1 A;  1ZQG A;  5J2J A;  3H38 A;  4RPZ A;  8ICH A;  4TUR A;  4NM2 A;  5J0W A;  5HRB A;  5BPC A;  7ICM A;  9ICL A;  2FCL A;  4WC4 A;  8ICM A;  4FHW A;  5B3Q A;  3OWG A;  4F5O A;  8ICB A;  1Q79 A;  2O1P A;  1OU5 A;  2ZH8 A;  4UB1 A;  1ZQW A;  2BBJ A;  2GA9 D;  4UB5 A;  4K4H A;  1MIV A;  5J2H A;  5J2I A;  4P2H A;  4O6A A;  2BPF A;  1ZQD A;  4KM5 A;  8ICG A;  4RQ2 A;  1ZQV A;  5CHG A;  7ICJ A;  1GPJ A;  5DBA A;  7ICN A;  2ZH7 A;  4P4O A;  2I9G A;  4UAZ A;  1R89 A;  4X4V A;  4XQ7 A;  4EBK A;  5DB9 A;  2PBE A;  4UBC A;  1YLQ A;  1TV9 A;  2PFQ A;  4I2H A;  5J2F A;  8ICA A;  9ICH A;  4K9A A;  5D63 A;  5DED A;  4KLS A;  2W9M A;  5HRD A;  4LEW A;  4E80 A;  4K96 A;  4RQ3 A;  2ZH2 A;  2ZHA A;  3C18 A;  1XSL A;  4KLT A;  5J0P A;  3UXP A;  4K97 A;  4WC6 A;  3TFS A;  1JN3 A;  5BOL A;  4XA5 A;  4I2C A;  4IG8 A;  4KLH A;  2B4V A;  4AT7 A;  3JPQ A;  4KLF A;  5IIK A;  3NWI A;  3MGH A;  8ICN A;  5D4B A;  3HX0 A;  4K4G A;  2NRK A;  5D46 A;  3AQM A;  4NKT A;  8ICO A;  2PFO A;  8ICR A;  2FMQ A;  4RQ4 A;  4XRH A;  4MF8 A;  3RJI A;  7ICI A;  3LQC B;  2BE3 A;  4EED A;  9ICQ A;  1BPD A;  4DO9 A;  4M5D A;  4RT2 A;  4NLN A;  1VFG A;  9ICV A;  4GXK A;  2ID1 A;  4RQ8 A;  5III A;  3K75 D;  1BPZ A;  4X4T A;  1RPL A;  4F5Q A;  2BPC A;  3OUY B;  4FHY A;  2PFP A;  4M9G A;  4MFF A;  2BCU A;  8ICT A;  5DBB A;  9ICJ A;  1ZQM A;  5J2C A;  4KLL A;  4UAY A;  3ERC C;  5J0Y A;  4I28 A;  4I29 A;  1JMS A;  3B0X A;  4WBY A;  4F5R A;  9ICM A;  4WQL A;  2P66 A;  5CHE A;  5HHH A;  1ZQH A;  4PGY A;  3OVA A;  4Z6F A;  5IIJ A;  4XJE A;  3H39 A;  3L9D A;  4IQW A;  4OAH A;  3JPN A;  3EF2 A;  4M47 A;  9ICP A;  4PPX A;  8ICQ A;  2RFF A;  3LK9 A;  3AU6 A;  9ICX A;  4QZB A;  4NXZ A;  4FHV A;  4EGW A;  5HRH A;  1BPE A;  3H3A A;  2O5A A;  5IIO A;  1XSP A;  3C2L A;  3H37 A;  4WH5 A;  1ZQP A;  4X4R A;  2BPG A;  2HN2 A;  3RJF A;  4KLG A;  3PMN A;  9ICK A;  1KDH A;  4KLJ A;  2B51 A;  4LZG A;  5HRE A;  8ICZ A;  2DVI A;  4AT9 A;  3OV7 A;  4WOY A;  4FHX A;  4KLI A;  4TUS A;  4GXJ A;  4IQV A;  4WC0 A;  2DR8 A;  1BPY A;  5CA7 A;  3AQL A;  8ICU A;  3HJ1 A;  1TFW A;  4X4U A;  3RH4 A;  4QZC A;  3ER8 C;  3RJH A;  4QZ8 A;  2IHO A;  3ISC A;  4LEV A;  5J0Q A;  7ICH A;  3K7D A;  1ZQB A;  8ICJ A;  4QZD A;  3RH6 A;  2EWR A;  5EOZ A;  1ZQA A;  4UB2 A;  4M04 A;  4F5N A;  9ICS A;  7ICO A;  8ICP A;  5CR0 A;  3AU2 A;  1ZQC A;  1V4A A;  3WFS C;  5CFS A;  3WFR E;  4QZE A;  5J2G A;  5D49 A;  4WCW A;  3JPT A;  2ZH6 A;  1TFY A;  4P4P A;  4RQ5 A;  4KLU A;  3JPO A;  7ICS A;  5HRG A;  1R8C A;  3UXN A;  5IIM A;  3ISB A;  2ZH4 A;  1ZQF A;  4K9B A;  4AT7 B;  1MQ3 A;  2BCS A;  4FO1 A;  4JLX A;  2BCQ A;  8ICC A;  8ICS A;  3V7K A;  4WC2 A;  4UBB A;  7ICT A;  4EP7 A;  2Q66 A;  4WQK A;  2ISO A;  4M9H A;  4PHP A;  4AT8 A;  4FH3 A;  1ZQU A;  4DOB A;  5DBC A;  1MIY A;  4UD5 A;  4YD1 A;  4KB6 A;  4I27 A;  4PHE A;  4O5K A;  4NXV A;  1XSN A;  7ICK A;  1ZQQ A;  1ZQZ A;  8ICF A;  4NLK A;  4M0A A;  4R66 A;  2GWS A;  1Q78 A;  5J2B A;  4EV6 A;  3AUO A;  2VAN A;  5B3P A;  1R8A A;  2FMS A;  2B56 A;  5CB1 A;  4QZI A;  4MFA A;  3C5G A;  4O9M A;  4Z6C A;  3JPR A;  3ER9 B;  3NYB A;  3HW8 A;  1ZQL A;  4YD2 A;  3V72 A;  9ICF A;  2HHP A;  4XUS A;  4K99 A;  5JTG A;  9ICR A;  5CFU A;  1JQR A;  3ISD A;  4LEZ A;  2ZH9 A;  1HUZ A;  9ICO A;  4WC3 A;  5HRI A;  4KLE A;  4IQU A;  4JLZ A;  7ICF A;  9ICC A;  5DDY A;  4X4P A;  4RWO A;  4LEY A;  4X4Q A;  7ICR A;  4QZH A;  5J29 A;  8ICX A;  4E8F A;  3JCF A;  3MDC A;  8ICV A;  4X4S A;  4QZA A;  3OUY A;  9ICE A;  4OAG A;  3WFO A;  4DOC A;  3JYY A;  4I2J A;  4F5P A;  3HJ4 A;  2DRA A;  4O5C A;  4NLZ A;  8ICY A;  1TVA A;  2M2T A;  4AT9 B;  1ZQI A;  9ICB A;  4M9J A;  5J0U A;  1ZQR A;  4PHA A;  3C5F A;  3RJK A;  2IUB A;  5IIN A;  3C2K A;  4UD4 A;  3UXO A;  9ICW A;  2PFN A;  4XQ8 A;  4PH5 A;  3MDA A;  1ZJN A;  3PHZ A;  4RWQ A;  4S3N A;  4IQT A;  4KLO A;  5J2D A;  4I2E A;  4YMO A;  1KNY A;  4PHD A;  5D61 A;  2M2V A;  4X4O A;  1RZT A;  5HC9 A;  8ICE A;  3MCR A;  1ZQN A;  4GXI A;  4TUP A;  2M2W A;  2FMP A;  3OVB A;  9ICT A;  3C2M A;  4I0U A;  3MBY A;  3PML A;  3UPS A;  4HX0 A;  5J2A A;  4O68 A;  4TUQ A;  1ZQJ A;  4O67 A;  3RJE A;  5D62 A;  4ATB A;  3OVS A;  1ZQO A;  5CFT A;  3OGU A;  4RQ1 A;  3JPS A;  3UQ2 A;  4LZD A;  4I2F A;  3B0Y A;  2ZH5 A;  5DEC A;  7ICQ A;  4I2I A;  1R8B A;  4EEB A;  9ICN A;  4MKP A;  4RPY A;  1JAJ A;  3WFQ E;  4NM1 A;  4I2B A;  2DRB A;  4LVS A;  5DB6 A;  3HIY A;  4FH5 A;  3GDX A;  1MIW A;  4AT8 B;  1NOM A;  9ICG A;  4QZ9 A;  3NVO A;  8ICK A;  7ICU A;  9ICI A;  8ICL A;  4WC5 A;  4YCX A;  3RJG A;  5CJ7 A;  2ISP A;  4K98 A;  2BCR A;  1FA0 A;  4EBJ A;  4X0B A;  9ICA A;  5J0T A;  4UB4 A;  4NXU A;  3RH5 A;  1UET A;  7ICP A;  4X4N A;  4RWN A;  1ZQK A;  7ICL A;  4WC7 A;  1ZQT A;  2DR9 A;  3CK6 A;  1MQ2 A;  4NKU A;  1ZQY A;  4PGQ A;  4KLM A;  4KLQ A;  4N7R A;  1PX5 A;  1BPB A;  1KEJ A;  5HRK A;  3MGI A;  4QZF A;  2DR5 A;  4K8V A;  4MFC A;  1WOT A;  4JWN A;  3AQK A;  4OAI Z;  4WC1 A;  5CWR A;  2ZHB A;  5J0S A;  2BCV A;  3WFP A;  3PNC A;  4RQ6 A;  1UEU A;  8ICW A;  5DB8 A;  4R64 A;  2BBH A;  2M2U A;  3AQN A;  4RQ7 A;  4KLD A;  4MF2 A;  4YMM A;  3HWT A;  4RQ0 A;  4I2D A;  4RPX A;  5IIL A;  3RJJ A;  4FHP A;  4WBZ A;  4O69 A;  2DR7 A;  1NO5 A;  5HRL A;  4NXT A;  1BPX A;  4M9L A;  8ICI A;  9ICU A;  3TFR A;  4PGX A;  4UAW A;  4R65 A;  3V7J A;  4LT6 A;  4OAF A;  5J0R A;  1VJ7 A;  5J0O A;  3JPP A;  3C66 A;  4UB3 A;  4O5E A;  5CP2 A;  3JZ0 A;  5HRF A;  4Z6D A;  4DOA A;  1ZQE A;  4RT3 A;  3NKU A;  5J2E A;  2GAF D;  4YN4 A;  4RWP A;  5J0X A;  1ZJM A;  4I2A A;  1UEV A;  5J2K A;  7ICE A;  5DKW A;  4FO6 A;  4K4I A;  1ZQS A;  3UQ0 A;  4X5V A;  4R63 A;  4M2Y A;  5DDM A;  2ZH3 A;  4YMN A;  4M9N A;  4NXW A;  3UPQ A;  1F5A A;  4P4M A;  4Z6E A;  2PXI A;  5HR9 A;  4QZG A;  7ICG A;  4X0A A;  5BOM A;  5DB7 A;  4E7X A;  1HUO A;  2HN1 A;  2IHM A;  1ZQX A; 
#chains in the Genus database with same CATH homology
 4NXX A;  3ERC C;  3NKU A;  4O6A A;  2GAF D;  4KM5 A;  4MKP A;  4NXV A;  4K99 A;  5D61 A;  4K9B A;  4K97 A;  5CFU A;  3ER8 C;  4WQL A;  5CHE A;  2IHO A;  3MCR A;  1GPJ A;  4LEV A;  4WH5 A;  4FO1 A;  4LEZ A;  3K7D A;  4JLX A;  4XJE A;  4O69 A;  2B51 A;  4N7R A;  2EWR A;  2B4V A;  4NXW A;  4NXT A;  4OAH A;  3EF2 A;  4K8V A;  2FCL A;  4HX0 A;  4JLZ A;  4O68 A;  4O67 A;  5D62 A;  4OAI Z;  5B3P A;  5B3Q A;  3OWG A;  4WOY A;  4WQK A;  5CFS A;  4OAF A;  4LEY A;  5CFT A;  2B56 A;  4K98 A;  4K9A A;  5D63 A;  3ER9 B;  4NXU A;  4LEW A;  3PHZ A;  2GA9 D;  4K96 A;  4KB6 A;  4OAG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...