4WQKA

Crystal structure of aminoglycoside nucleotidylyltransferase ant(2")-ia, apo form
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
175
structure length
175
Chain Sequence
b'TTQVTLIHKILAAADERNLPLWIGGGWAIDARLGRVTRKHDDIDLTFPGERRGELEAIVEMLGGRVMEELDYGFLAEIGDELLDCEPAWWADEAYEIAEAPQGSCPEAAEGVIAGRPVRCNSWEAIIWDYFYYADEVPPVDWPTKHIESYRLACTSLGAEKVEVLRAAFRSRYAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2''-aminoglycoside nucleotidyltransferase
publication title Structural and Molecular Basis for Resistance to Aminoglycoside Antibiotics by the Adenylyltransferase ANT(2)-Ia.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Transferase
total genus 60
structure length 175
sequence length 175
ec nomenclature ec 2.7.7.46: Gentamicin 2''-nucleotidyltransferase.
pdb deposition date 2014-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10706 Aminoglyc_resit Aminoglycoside-2''-adenylyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.460.40 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 4wqkA00
5CFSA 4FO1A 4WH5A 4HX0A 5CFUA 4XJEA 2FCLA 4WQKA 4WQLA 5CFTA 2EWRA
chains in the Genus database with same CATH superfamily
4QZ8A 5J0UA 1XSLA 4RQ8A 4NKUA 1JAJA 2NRKA 4TUQA 9ICLA 3OUYB 4MF8A 4QZHA 9ICCA 7ICKA 2ZH2A 4NY8A 1OU5A 8ICGA 9ICSA 4M2YA 2ZH4A 4KLIA 4M9HA 2DR9A 5HRHA 4WCWA 1ZQAA 2ZH3A 1RPLA 4ATBA 7ICEA 3C66A 4M9LA 7ICJA 4DOBA 1F5AA 3MCRA 2O1PA 5B3PA 3C5FA 3NKUA 8ICWA 2ZH7A 2BE3A 3HJ4A 3AU6A 4MFAA 1BPXA 3K75D 4K98A 9ICHA 5HRBA 5IINA 3C2LA 4EV6A 4I2CA 4KLOA 5HRKA 5EOZA 8ICUA 9ICEA 5DB7A 4NXUA 5DB8A 5DDMA 5J0WA 4KLSA 2HN2A 4TUPA 4M9JA 3RJJA 4FO1A 8ICHA 4I2DA 4FHVA 8ICSA 9ICJA 5J2HA 1NOMA 4RQ6A 1WOTA 4NKTA 3MDCA 4IQWA 2I9GA 8ICAA 7ICSA 1ZQEA 4LZGA 3EF2A 5J2EA 3AU2A 3HW8A 5D4BA 3RH5A 8ICRA 5B3QA 9ICUA 1NO5A 4X4UA 4NXTA 3UQ0A 3AQNA 1MQ2A 3TFSA 4WOYA 2VANA 1Q79A 1ZQBA 1KNYA 8ICEA 1ZQSA 1ZQVA 5J2FA 7ICLA 4AT9A 4F5NA 4X4QA 4QZAA 2ZH9A 5J2BA 2ZH8A 5DDYA 4F5RA 1ZQJA 4I2IA 2W9MA 3RH4A 2DR8A 3ISBA 4YD2A 5CFUA 4AT7B 4RT3A 3HIYA 5BOLA 1BPYA 8ICKA 4XQ7A 4RPYA 3CK6A 1UEVA 4M9NA 3H3AA 4S3NA 4RWPA 4Z6FA 4K97A 1VFGA 3B0XA 4WC5A 5IIMA 3RJIA 2DVIA 4X4SA 4IG8A 4EEDA 5IIKA 3UXPA 4K9BA 3LQCB 2M2UA 5BPCA 4RQ5A 4K8VA 1KEJA 5J0YA 4KLLA 3C2KA 3JPOA 3ERCC 4KM5A 3C2MA 2EWRA 4NXWA 3TFRA 4UB3A 3OVAA 3H38A 7ICMA 5F2VO 3JPPA 1ZQRA 4HX0A 9ICAA 4WC6A 7ICFA 4O67A 3NVOA 4F5PA 8ICVA 2B51A 5D63A 3NYBA 5CHGA 4M47A 2PBEA 4I2GA 4M9GA 4P2HA 2BCUA 5BOMA 8ICBA 4LT6A 5J0SA 4GXIA 4M0AA 3C18A 5J2DA 3HWTA 3B0YA 3JYYA 4RQ0A 4UD5A 5D62A 4KLGA 8ICFA 5CFTA 3HX0A 4WC4A 5J2GA 5J2KA 1ZQLA 4EP7A 4TURA 4WC0A 5J0QA 5J0XA 4KLUA 8ICPA 1PX5A 2DRAA 4LZDA 4YMOA 8ICMA 4XQ8A 1FA0A 4MF2A 2DR5A 4E80A 4PHEA 2FMSA 8ICTA 4OAHA 4X0AA 4X4TA 9ICRA 2ZH1A 5IILA 4NM1A 9ICFA 5CB1A 7ICGA 4XA5A 4DOCA 4KLJA 5CP2A 5HRDA 8ICNA 3PHZA 4RWNA 8ICQA 1Q78A 4PH5A 5JTGA 5DB6A 4KLFA 7ICNA 1R8AA 1MIVA 4PGXA 5J2AA 4KLEA 3OWGA 4XRHA 1JQRA 4PHDA 3AQMA 3JPTA 2P66A 9ICKA 3JPNA 4RQ4A 4QZBA 4RQ3A 4YMMA 4QZ9A 4K99A 8ICYA 7ICUA 8ICXA 3ISDA 3RH6A 3WFRE 2IHMA 4I27A 4AT9B 4MFCA 2BCQA 4PPXA 4IQVA 7ICOA 3OVBA 3UXOA 4AT8B 7ICTA 1XSPA 5J0PA 4E8FA 4R63A 5D46A 4FHPA 4O9MA 4PHAA 5IIIA 9ICPA 4YMNA 9ICQA 4M04A 2FCLA 4O69A 1R8CA 3RJKA 2HHPA 4X4VA 4TUSA 4WC3A 4QZDA 3NWIA 4R66A 4FHYA 4N7RA 4WC1A 2PFPA 1GPJA 4F5QA 2FMQA 2ZHAA 1ZQMA 3RJHA 8ICOA 1R89A 2IHOA 9ICTA 3H39A 3MGHA 4OAFA 4NXZA 4QZGA 3PMLA 1ZQGA 1ZQKA 5TZVA 4I2BA 2GWSA 5HHHA 1TFYA 5DBCA 4QZIA 4FO6A 4PGQA 4P4OA 1V4AA 4I0UA 5J0OA 4F5OA 4R65A 4FH3A 5J0RA 4WQLA 2ZH6A 5D49A 2BPFA 4KLMA 4KLQA 5CA7A 4RPZA 7ICVA 3V7JA 3OVSA 4K9AA 5J29A 1ZQDA 4NLKA 4LVSA 9ICWA 4RWQA 1BPDA 4O5EA 2BBHA 4UB2A 1ZQQA 4KLHA 3V7KA 3WFQE 4QZCA 4UB5A 4AT7A 4I2AA 4RQ1A 1ZJNA 5HC9A 1UEUA 4ATBB 1TV9A 2DRBA 1RZTA 2BCVA 4X4OA 3LK9A 4EEBA 2BCRA 4NXVA 7ICIA 3UXNA 4RPXA 1ZQHA 8ICJA 3PNCA 7ICRA 9ICMA 1ZQFA 3JZ0A 2B56A 8ICLA 4FHXA 1ZQYA 3HJ1A 4K96A 3UPSA 4UB1A 4NLNA 3ER8C 3K7DA 3OGUA 1R8BA 9ICBA 3H37A 4OAIZ 4X0BA 4P4MA 3JCFA 5DBBA 4UAZA 3AQKA 2DR7A 2GA9D 4X4RA 4O68A 4I28A 5IIOA 5HHIA 4UB4A 9ICIA 4I29A 4K4HA 1TFWA 1ZQCA 3V72A 2PFQA 8ICZA 1ZQWA 3MGIA 5J2JA 5J2CA 1KDHA 1ZQXA 4I2EA 3JPQA 4RQ7A 3RJFA 2FMPA 1VJ7A 3OUYA 1XSNA 4I2HA 5DEDA 2PFNA 2HN1A 4LEVA 4WH5A 4X5VA 4WQKA 4GXJA 1TVAA 4Z6DA 7ICQA 4PHPA 2ISOA 2PFOA 4K4IA 4NLZA 1JMSA 4RQ2A 5HRLA 4MKPA 4FHWA 3L9DA 3WFOA 4XJEA 4UBBA 3GDXA 5HRGA 4OAGA 5CR0A 4GXKA 4LEZA 3C5GA 4LEYA 5DKWA 5CHEA 4EGWA 1YLQA 4E7XA 2ZH5A 5J2IA 4KB6A 1UETA 7ICPA 4R64A 3WFPA 4PGYA 4QZEA 2IUBA 4WBZA 4RWOA 2M2TA 4UAWA 3UPQA 5HRIA 5CWRA 4X4PA 4YD1A 1BPZA 5HR9A 4JWMA 5CFSA 2Q66A 1ZQNA 3WFSC 1BPEA 1ZQPA 2M2VA 4KLTA 4YCXA 5D61A 1MIWA 1BPBA 4I2JA 1ZJMA 4WC7A 5DB9A 4I2FA 3JPSA 4K4GA 4WC2A 3ISCA 4IQUA 3AUOA 5IIJA 4DO9A 4QZFA 4UBCA 4P4PA 4UAYA 4IQTA 1ZQZA 2RFFA 4EBKA 3MDAA 1ZQTA 2O5AA 4MFFA 9ICNA 3RJGA 9ICXA 5HRFA 4AT8A 2ID1A 5DBAA 3V7LA 2M2WA 4Z6EA 1HUZA 4JWNA 5J0TA 9ICGA 4NM2A 1ZQIA 1ZQUA 4FH5A 4JLXA 4X4NA 9ICOA 4Z6CA 3PMNA 4EBJA 5CJ7A 4NXXA 2BCSA 2B4VA 4YN4A 3UQ2A 4O6AA 2PXIA 1ZQOA 1MIYA 7ICHA 1HUOA 2ZHBA 8ICCA 4DOAA 4O5CA 2BPCA 3RJEA 4XUSA 3MBYA 4JLZA 4KLDA 5DECA 2ISPA 2BBJA 4WBYA 2GAFD 2BPGA 8ICIA 4RT2A 1JN3A 4O5KA 4M5DA 5HREA 3JPRA 3ER9B 9ICVA 3AQLA 4LEWA 4UD4A 3OV7A 1MQ3A
chains in the Genus database with same CATH topology
4OAIZ 5CFSA 4K98A 4MKPA 3EF2A 4XJEA 2FCLA 4O69A 4K9BA 4K99A 2GA9D 5D61A 4OAGA 4O68A 4OAHA 5B3QA 4K8VA 4LEZA 4NXUA 4JLZA 4NXTA 4NXVA 5D62A 4LEYA 5CFTA 4WQLA 4N7RA 3ERCC 4KM5A 2EWRA 4NXWA 2GAFD 1GPJA 5CHEA 4KB6A 4FO1A 4HX0A 2B56A 5CFUA 3PHZA 4K9AA 4O67A 4JLXA 4WOYA 2B51A 5D63A 2IHOA 4K96A 3ER8C 3MCRA 5B3PA 3K7DA 4LEVA 4OAFA 4WH5A 3NKUA 4LEWA 3ER9B 4K97A 3OWGA 4NXXA 4WQKA 2B4VA 4O6AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CFS A;  4FO1 A;  4WH5 A;  4HX0 A;  5CFU A;  4XJE A;  2FCL A;  4WQK A;  4WQL A;  5CFT A;  2EWR A; 
#chains in the Genus database with same CATH topology
 4QZ8 A;  5J0U A;  1XSL A;  4RQ8 A;  4NKU A;  1JAJ A;  2NRK A;  4TUQ A;  9ICL A;  3OUY B;  4MF8 A;  4QZH A;  9ICC A;  7ICK A;  2ZH2 A;  4NY8 A;  1OU5 A;  8ICG A;  9ICS A;  4M2Y A;  2ZH4 A;  4KLI A;  4M9H A;  2DR9 A;  5HRH A;  4WCW A;  1ZQA A;  2ZH3 A;  1RPL A;  4ATB A;  7ICE A;  3C66 A;  4M9L A;  7ICJ A;  4DOB A;  1F5A A;  3MCR A;  2O1P A;  5B3P A;  3C5F A;  3NKU A;  8ICW A;  2ZH7 A;  2BE3 A;  3HJ4 A;  3AU6 A;  4MFA A;  1BPX A;  3K75 D;  4K98 A;  9ICH A;  5HRB A;  5IIN A;  3C2L A;  4EV6 A;  4I2C A;  4KLO A;  5HRK A;  5EOZ A;  8ICU A;  9ICE A;  5DB7 A;  4NXU A;  5DB8 A;  5DDM A;  5J0W A;  4KLS A;  2HN2 A;  4TUP A;  4M9J A;  3RJJ A;  4FO1 A;  8ICH A;  4I2D A;  4FHV A;  8ICS A;  9ICJ A;  5J2H A;  1NOM A;  4RQ6 A;  1WOT A;  4NKT A;  3MDC A;  4IQW A;  2I9G A;  8ICA A;  7ICS A;  1ZQE A;  4LZG A;  3EF2 A;  5J2E A;  3AU2 A;  3HW8 A;  5D4B A;  3RH5 A;  8ICR A;  5B3Q A;  9ICU A;  1NO5 A;  4X4U A;  4NXT A;  3UQ0 A;  3AQN A;  1MQ2 A;  3TFS A;  4WOY A;  2VAN A;  1Q79 A;  1ZQB A;  1KNY A;  8ICE A;  1ZQS A;  1ZQV A;  5J2F A;  7ICL A;  4AT9 A;  4F5N A;  4X4Q A;  4QZA A;  2ZH9 A;  5J2B A;  2ZH8 A;  5DDY A;  4F5R A;  1ZQJ A;  4I2I A;  2W9M A;  3RH4 A;  2DR8 A;  3ISB A;  4YD2 A;  5CFU A;  4AT7 B;  4RT3 A;  3HIY A;  5BOL A;  1BPY A;  8ICK A;  4XQ7 A;  4RPY A;  3CK6 A;  1UEV A;  4M9N A;  3H3A A;  4S3N A;  4RWP A;  4Z6F A;  4K97 A;  1VFG A;  3B0X A;  4WC5 A;  5IIM A;  3RJI A;  2DVI A;  4X4S A;  4IG8 A;  4EED A;  5IIK A;  3UXP A;  4K9B A;  3LQC B;  2M2U A;  5BPC A;  4RQ5 A;  4K8V A;  1KEJ A;  5J0Y A;  4KLL A;  3C2K A;  3JPO A;  3ERC C;  4KM5 A;  3C2M A;  2EWR A;  4NXW A;  3TFR A;  4UB3 A;  3OVA A;  3H38 A;  7ICM A;  5F2V O;  3JPP A;  1ZQR A;  4HX0 A;  9ICA A;  4WC6 A;  7ICF A;  4O67 A;  3NVO A;  4F5P A;  8ICV A;  2B51 A;  5D63 A;  3NYB A;  5CHG A;  4M47 A;  2PBE A;  4I2G A;  4M9G A;  4P2H A;  2BCU A;  5BOM A;  8ICB A;  4LT6 A;  5J0S A;  4GXI A;  4M0A A;  3C18 A;  5J2D A;  3HWT A;  3B0Y A;  3JYY A;  4RQ0 A;  4UD5 A;  5D62 A;  4KLG A;  8ICF A;  5CFT A;  3HX0 A;  4WC4 A;  5J2G A;  5J2K A;  1ZQL A;  4EP7 A;  4TUR A;  4WC0 A;  5J0Q A;  5J0X A;  4KLU A;  8ICP A;  1PX5 A;  2DRA A;  4LZD A;  4YMO A;  8ICM A;  4XQ8 A;  1FA0 A;  4MF2 A;  2DR5 A;  4E80 A;  4PHE A;  2FMS A;  8ICT A;  4OAH A;  4X0A A;  4X4T A;  9ICR A;  2ZH1 A;  5IIL A;  4NM1 A;  9ICF A;  5CB1 A;  7ICG A;  4XA5 A;  4DOC A;  4KLJ A;  5CP2 A;  5HRD A;  8ICN A;  3PHZ A;  4RWN A;  8ICQ A;  1Q78 A;  4PH5 A;  5JTG A;  5DB6 A;  4KLF A;  7ICN A;  1R8A A;  1MIV A;  4PGX A;  5J2A A;  4KLE A;  3OWG A;  4XRH A;  1JQR A;  4PHD A;  3AQM A;  3JPT A;  2P66 A;  9ICK A;  3JPN A;  4RQ4 A;  4QZB A;  4RQ3 A;  4YMM A;  4QZ9 A;  4K99 A;  8ICY A;  7ICU A;  8ICX A;  3ISD A;  3RH6 A;  3WFR E;  2IHM A;  4I27 A;  4AT9 B;  4MFC A;  2BCQ A;  4PPX A;  4IQV A;  7ICO A;  3OVB A;  3UXO A;  4AT8 B;  7ICT A;  1XSP A;  5J0P A;  4E8F A;  4R63 A;  5D46 A;  4FHP A;  4O9M A;  4PHA A;  5III A;  9ICP A;  4YMN A;  9ICQ A;  4M04 A;  2FCL A;  4O69 A;  1R8C A;  3RJK A;  2HHP A;  4X4V A;  4TUS A;  4WC3 A;  4QZD A;  3NWI A;  4R66 A;  4FHY A;  4N7R A;  4WC1 A;  2PFP A;  1GPJ A;  4F5Q A;  2FMQ A;  2ZHA A;  1ZQM A;  3RJH A;  8ICO A;  1R89 A;  2IHO A;  9ICT A;  3H39 A;  3MGH A;  4OAF A;  4NXZ A;  4QZG A;  3PML A;  1ZQG A;  1ZQK A;  5TZV A;  4I2B A;  2GWS A;  5HHH A;  1TFY A;  5DBC A;  4QZI A;  4FO6 A;  4PGQ A;  4P4O A;  1V4A A;  4I0U A;  5J0O A;  4F5O A;  4R65 A;  4FH3 A;  5J0R A;  4WQL A;  2ZH6 A;  5D49 A;  2BPF A;  4KLM A;  4KLQ A;  5CA7 A;  4RPZ A;  7ICV A;  3V7J A;  3OVS A;  4K9A A;  5J29 A;  1ZQD A;  4NLK A;  4LVS A;  9ICW A;  4RWQ A;  1BPD A;  4O5E A;  2BBH A;  4UB2 A;  1ZQQ A;  4KLH A;  3V7K A;  3WFQ E;  4QZC A;  4UB5 A;  4AT7 A;  4I2A A;  4RQ1 A;  1ZJN A;  5HC9 A;  1UEU A;  4ATB B;  1TV9 A;  2DRB A;  1RZT A;  2BCV A;  4X4O A;  3LK9 A;  4EEB A;  2BCR A;  4NXV A;  7ICI A;  3UXN A;  4RPX A;  1ZQH A;  8ICJ A;  3PNC A;  7ICR A;  9ICM A;  1ZQF A;  3JZ0 A;  2B56 A;  8ICL A;  4FHX A;  1ZQY A;  3HJ1 A;  4K96 A;  3UPS A;  4UB1 A;  4NLN A;  3ER8 C;  3K7D A;  3OGU A;  1R8B A;  9ICB A;  3H37 A;  4OAI Z;  4X0B A;  4P4M A;  3JCF A;  5DBB A;  4UAZ A;  3AQK A;  2DR7 A;  2GA9 D;  4X4R A;  4O68 A;  4I28 A;  5IIO A;  5HHI A;  4UB4 A;  9ICI A;  4I29 A;  4K4H A;  1TFW A;  1ZQC A;  3V72 A;  2PFQ A;  8ICZ A;  1ZQW A;  3MGI A;  5J2J A;  5J2C A;  1KDH A;  1ZQX A;  4I2E A;  3JPQ A;  4RQ7 A;  3RJF A;  2FMP A;  1VJ7 A;  3OUY A;  1XSN A;  4I2H A;  5DED A;  2PFN A;  2HN1 A;  4LEV A;  4WH5 A;  4X5V A;  4WQK A;  4GXJ A;  1TVA A;  4Z6D A;  7ICQ A;  4PHP A;  2ISO A;  2PFO A;  4K4I A;  4NLZ A;  1JMS A;  4RQ2 A;  5HRL A;  4MKP A;  4FHW A;  3L9D A;  3WFO A;  4XJE A;  4UBB A;  3GDX A;  5HRG A;  4OAG A;  5CR0 A;  4GXK A;  4LEZ A;  3C5G A;  4LEY A;  5DKW A;  5CHE A;  4EGW A;  1YLQ A;  4E7X A;  2ZH5 A;  5J2I A;  4KB6 A;  1UET A;  7ICP A;  4R64 A;  3WFP A;  4PGY A;  4QZE A;  2IUB A;  4WBZ A;  4RWO A;  2M2T A;  4UAW A;  3UPQ A;  5HRI A;  5CWR A;  4X4P A;  4YD1 A;  1BPZ A;  5HR9 A;  4JWM A;  5CFS A;  2Q66 A;  1ZQN A;  3WFS C;  1BPE A;  1ZQP A;  2M2V A;  4KLT A;  4YCX A;  5D61 A;  1MIW A;  1BPB A;  4I2J A;  1ZJM A;  4WC7 A;  5DB9 A;  4I2F A;  3JPS A;  4K4G A;  4WC2 A;  3ISC A;  4IQU A;  3AUO A;  5IIJ A;  4DO9 A;  4QZF A;  4UBC A;  4P4P A;  4UAY A;  4IQT A;  1ZQZ A;  2RFF A;  4EBK A;  3MDA A;  1ZQT A;  2O5A A;  4MFF A;  9ICN A;  3RJG A;  9ICX A;  5HRF A;  4AT8 A;  2ID1 A;  5DBA A;  3V7L A;  2M2W A;  4Z6E A;  1HUZ A;  4JWN A;  5J0T A;  9ICG A;  4NM2 A;  1ZQI A;  1ZQU A;  4FH5 A;  4JLX A;  4X4N A;  9ICO A;  4Z6C A;  3PMN A;  4EBJ A;  5CJ7 A;  4NXX A;  2BCS A;  2B4V A;  4YN4 A;  3UQ2 A;  4O6A A;  2PXI A;  1ZQO A;  1MIY A;  7ICH A;  1HUO A;  2ZHB A;  8ICC A;  4DOA A;  4O5C A;  2BPC A;  3RJE A;  4XUS A;  3MBY A;  4JLZ A;  4KLD A;  5DEC A;  2ISP A;  2BBJ A;  4WBY A;  2GAF D;  2BPG A;  8ICI A;  4RT2 A;  1JN3 A;  4O5K A;  4M5D A;  5HRE A;  3JPR A;  3ER9 B;  9ICV A;  3AQL A;  4LEW A;  4UD4 A;  3OV7 A;  1MQ3 A; 
#chains in the Genus database with same CATH homology
 4OAI Z;  5CFS A;  4K98 A;  4MKP A;  3EF2 A;  4XJE A;  2FCL A;  4O69 A;  4K9B A;  4K99 A;  2GA9 D;  5D61 A;  4OAG A;  4O68 A;  4OAH A;  5B3Q A;  4K8V A;  4LEZ A;  4NXU A;  4JLZ A;  4NXT A;  4NXV A;  5D62 A;  4LEY A;  5CFT A;  4WQL A;  4N7R A;  3ERC C;  4KM5 A;  2EWR A;  4NXW A;  2GAF D;  1GPJ A;  5CHE A;  4KB6 A;  4FO1 A;  4HX0 A;  2B56 A;  5CFU A;  3PHZ A;  4K9A A;  4O67 A;  4JLX A;  4WOY A;  2B51 A;  5D63 A;  2IHO A;  4K96 A;  3ER8 C;  3MCR A;  5B3P A;  3K7D A;  4LEV A;  4OAF A;  4WH5 A;  3NKU A;  4LEW A;  3ER9 B;  4K97 A;  3OWG A;  4NXX A;  4WQK A;  2B4V A;  4O6A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...