1VJ7A

Crystal structure of the bifunctional catalytic fragment of relseq, the rela/spot homolog from streptococcus equisimilis.
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
367
structure length
326
Chain Sequence
INLTGEEVVALAAKYMNETDAAFVKKALDYATAAHFYQVRKSGEPYIVHPIQVAGILADLHLDAVTVACGFLHDVVEDTDITLDNIEFDFGKDVRDIVDGVTKLGHRKMLMAMSKDIRVILVKLADRLHNMRTLKQERISRETMEIYAPLAHRLGISRIKWELEDLAFRYLNETEFYKISHMMNEKRREREALVDDIVTKIKSYTTEQGLFGDVYGRPKHIYSIYRKMRDKKKRFDQIFDLIAIRCVMETQSDVYAMVGYIHELWRPMPGRFKDYIAAPKANGYQSIHTTVYGPKGPIEIQIRTKEMHQVAEYGVAANWIKELVEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase, transferase
molecule keywords Bifunctional RELA/SPOT
publication title Conformational antagonism between opposing active sites in a bifunctional RelA/SpoT homolog modulates (p)ppGpp metabolism during the stringent response.
pubmed doi rcsb
source organism Streptococcus dysgalactiae subsp. equisimilis
total genus 119
structure length 326
sequence length 367
chains with identical sequence B
ec nomenclature ec 2.7.6.5: GTP diphosphokinase.
pdb deposition date 2004-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01966 HD HD domain
A PF04607 RelA_SpoT Region found in RelA / SpoT proteins
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3210.10 Mainly Alpha Orthogonal Bundle Hypothetical protein af1432 Hypothetical protein af1432 1vj7A01
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 1vj7A02
4UB1A 5AO2A 4FH3A 4YCXA 2DRBA 2P66A 4I2HA 4QZ9A 4QZFA 1ZQYA 4LRLA 4BZCA 3TM8A 4R65A 4WC5A 5J2EA 3V72A 8ICTA 4PHAA 9ICVA 3AQMA 2PAQA 5BOLA 4QZBA 5DBAA 5TK6A 5J29A 4YN4A 4F5RA 4I2CA 4UD4A 3HW8A 5AO3A 1VQRA 4M9HA 2VANA 4IQTA 4M0AA 7ICVA 5J0XA 5BOMA 4PHDA 4L1JB 5J2CA 4E7XA 4Z6EA 3RH6A 3RF0A 7ICTA 4TO1A 4MZ7A 5TK7A 3TMBA 7ICHA 7ICLA 3L9DA 4PH5A 3JPQA 3RH5A 5J0QA 7ICNA 4QZAA 4XRHA 2PFNA 2HEKA 3JPSA 3JYYA 2ZH7A 1HUOA 5CJ7A 4RXQA 1BPDA 4L7EA 4P4OA 8ICJA 4LZDA 4I2DA 5HREA 5EOZA 1TFWA 3RJFA 5IIKA 5HC9A 3HWTA 3MEMA 5DKWA 4ME4A 4RT3A 4RT2A 4LVSA 3PMLA 2ZHBA 3H3AA 4RXOA 3AUOA 3OUYA 3HIYA 8ICYA 3UXPA 9ICXA 4IG8A 3RJHA 4L7WA 4R66A 1YNBA 1NO5A 3UXOA 3WFSC 4RXSA 8ICRA 9ICJA 4K4GA 5HRKA 4ZWGA 3V7KA 1ZQOA 1R8BA 1ZQKA 5HRGA 4X4TA 4TNYA 3RJJA 1ZQSA 4FHXA 5TK8A 3ISBA 4JWMA 3WFQE 5J2AA 4KLIA 4F5PA 2ZH9A 9ICGA 4PGYA 1UEVA 4I2EA 4DOAA 4EBKA 1ZQPA 2PXIA 9ICHA 4N71A 4NM2A 2NRKA 4I2IA 4TO6A 3UPQA 4NM1A 3RJKA 3B0YA 4XDSA 9ICUA 1BPZA 3H37A 3JZ0A 2ZH4A 3TFSA 8ICMA 2BCVA 3V7JA 5CR0A 4YMOA 1XSNA 7ICEA 1XX7A 2ISOA 2DRAA 1XSPA 4TO0A 4RQ2A 3JPPA 1ZQHA 4KLOA 5CA7A 4X4PA 2Q14A 5J2GA 3MBYA 3OUYB 4I2BA 2DQBA 5J2IA 7ICQA 4KLEA 3H39A 3V7LA 4KLHA 4P2HA 5J2FA 3JPRA 1ZQIA 4MFCA 4XA5A 3TMDA 2DVIA 4JWNA 4WC6A 4M47A 4N6WA 4TUQA 8ICSA 1JN3A 5DB7A 2BCUA 3OVBA 1ZQXA 4X0BA 1MIYA 1YOYA 1JAJA 4X0AA 1KNYA 1Q79A 4TO4A 2W9MA 4M9JA 4QFXA 2RFFA 3I7AA 1TFYA 4DO9A 4QG0A 3AQKA 4I28A 2ZH8A 4BZBA 4NKTA 5TKAA 2PBEA 8ICZA 4MDZA 4RPZA 3HJ4A 5DECA 4RPYA 9ICEA 1VJ7A 4RWQA 4FHWA 5IIIA 3WFOA 4R64A 3PMNA 8ICIA 1KDHA 2GWSA 5IIJA 2PFOA 4Z6DA 5J0UA 8ICPA 2PARA 9ICTA 1ZQDA 4QZGA 5IIMA 2O1PA 1V4AA 5DDYA 8ICWA 9ICRA 4RQ0A 4TUPA 4QZ8A 2FMQA 3HC1A 4TNPA 4UB5A 1TVAA 4AT8A 4NXZA 3HJ1A 1U6ZA 4MF8A 3MGHA 1JMSA 4TO5A 4Z6CA 5HHHA 2M2TA 2M2WA 2I9GA 8ICVA 4UBBA 3KH1A 4LT6A 4RQ7A 3PNCA 9ICOA 3C5FA 4YD1A 1ZQMA 1TV9A 5AO1A 3B0XA 4NLKA 4RXPA 3NR1A 4RQ8A 3C66A 1R89A 1ZQCA 4IQUA 4R8ZA 4X9EA 5HRBA 3TFRA 1ZQGA 2FMPA 4YD2A 5AO0A 2BCQA 1MIVA 4K4IA 4YMMA 1KEJA 4E80A 1ZJNA 4M9GA 3BG2A 4WC0A 4TNZA 1ZQVA 3AQNA 1FA0A 3MDCA 1HUZA 4X4OA 4KLQA 4KLTA 4PPXA 4RQ4A 5DEDA 8ICUA 8ICFA 8ICGA 1UETA 4RQ5A 5J0SA 3ISCA 4X4VA 9ICPA 5J2JA 2ZH6A 5IINA 4KLFA 5HHIA 4EBJA 4R63A 9ICLA 4MFAA 4PHEA 4AT8B 1NOMA 3RH4A 1ZQFA 4FH5A 8ICOA 4IQVA 4RQ1A 4M5DA 1VFGA 1ZQTA 1MIWA 4NKUA 2ZH5A 9ICQA 1OU5A 5J2HA 4PGXA 5J0PA 8ICXA 2FMSA 4QZDA 4WCWA 4GXJA 4FO6A 4FHPA 4QZHA 2HHPA 4TO2A 4KLMA 4KLSA 3JPOA 3OGUA 8ICEA 3OVAA 4MLMA 5AO4A 5D46A 3JPNA 4WC7A 5J0OA 4QFZA 2ZHAA 2PFQA 4MF2A 3HI0A 4QG1A 4QFYA 7ICRA 3CCGA 3NYBA 3HX0A 2DR8A 4UAYA 4NLNA 8ICKA 5HRDA 4M9NA 1R8CA 1ZQLA 1BPYA 2M2UA 9ICIA 5CP2A 1MQ2A 2ZH2A 4AT7A 4GXKA 3IRHA 5DDMA 4M9LA 3C18A 2BPGA 2OGIA 5F2VO 1ZQZA 4WC1A 4X4RA 7ICUA 2GZ4A 2IHMA 4F5QA 4XQ8A 1ZJMA 5DBCA 5J2DA 5J0RA 2CQZA 2PAUA 5DB8A 5J0TA 3MGIA 7ICGA 3TMCA 4P4PA 3JPTA 2DR5A 2ZH1A 5IIOA 2O08A 4UB2A 9ICFA 3UPSA 8ICNA 3OVSA 1RPLA 4QG2A 4AT9A 4NLZA 1XSLA 7ICIA 3MDAA 4F5OA 3WFPA 3ISDA 4I27A 4X4QA 1WOTA 1ZQEA 5DBBA 3K75D 3H38A 4UAWA 4P4MA 5IILA 2M2VA 5HR9A 1RZTA 3LJXA 3M1TA 3RJEA 2BCRA 2BPFA 7ICOA 5HRFA 4RPXA 1ZQWA 3GDXA 3C5GA 4I2GA 4WC2A 1ZQUA 1BPBA 1BPXA 7ICFA 5DB6A 4AT7B 7ICPA 4I2AA 3AU6A 4TNQA 7ICJA 1Q78A 4QG4A 5DB9A 3NQWA 3AU2A 3MZOA 1R8AA 5J2KA 9ICAA 4DMBA 2BPCA 4MFFA 2FLOA 4O5EA 4KLDA 4ATBA 4QZCA 5TK9A 4RXRA 3P3QA 4I29A 9ICWA 4XUSA 1PX5A 4AT9B 4GXIA 4RWPA 4I2FA 4TO3A 8ICBA 4O9MA 3UQ2A 4LZGA 1ZQJA 4KLLA 4FHVA 3RJIA 2ZH3A 4MLNA 5HRLA 8ICQA 3OV7A 8ICHA 5HRHA 4NY8A 7ICMA 9ICBA 8ICLA 4EP7A 4X4SA 3WFRE 3C2LA 3C2MA 4WC4A 8ICAA 4E8FA 4PHPA 5CB1A 7ICKA 4UD5A 4QZEA 3RJGA 4KLJA 9ICNA 4RQ6A 4UAZA 2PQ7A 4QZIA 3LK9A 3U1NA 4F5NA 4WC3A 9ICMA 4KLUA 3AQLA 4UB4A 4I2JA 2DR9A 1BPEA 2BE3A 5J2BA 4ATBB 9ICCA 2O6IA 5D49A 1MQ3A 4TNRA 1ZQAA 4K4HA 3UXNA 2BCSA 4DOBA 4RWNA 2PGSA 5CWRA 4MCWA 4IQWA 4TURA 3UQ0A 5D4BA 7ICSA 4KLGA 5CHGA 4TUSA 4X4NA 9ICSA 4X5VA 1UEUA 4UB3A 3C2KA 4DOCA 5J0WA 4FHYA 2PFPA 8ICCA 4WBYA 2DR7A 4O5KA 4L1JA 4S3NA 4Z6FA 5BPCA 2Q66A 4WBZA 1JQRA 4PGQA 1ZQBA 4O5CA 1ZQQA 4X4UA 1F5AA 4UBCA 4RWOA 4ZWEA 1ZQNA 4M2YA 4XQ7A 1ZQRA 3LQCB 2ID1A 5TZVA 5HRIA 5J0YA 4M04A 9ICKA 4RQ3A 2ISPA 1YLQA 2O5AA 4Q7HA 4TNXA 4YMNA
chains in the Genus database with same CATH superfamily
4UB1A 5AO2A 4FH3A 4YCXA 2DRBA 2P66A 4I2HA 4QZ9A 4QZFA 1ZQYA 4LRLA 4BZCA 3TM8A 4LEVA 4R65A 4WC5A 5J2EA 3V72A 8ICTA 2IHOA 4PHAA 9ICVA 3AQMA 2PAQA 5BOLA 4QZBA 5DBAA 5TK6A 5J29A 4JLZA 4YN4A 4F5RA 4O68A 4QQYA 4I2CA 4UD4A 3HW8A 5AO3A 1VQRA 4WOYA 4M9HA 2VANA 4IQTA 4M0AA 7ICVA 5J0XA 5BOMA 4PHDA 4L1JB 5J2CA 4E7XA 4Z6EA 3RH6A 3RF0A 7ICTA 4TO1A 4MZ7A 5TK7A 3TMBA 7ICHA 7ICLA 4NXXA 3L9DA 2IUBA 4PH5A 3JPQA 5J0QA 3KQ5A 4Q2CA 3RH5A 7ICNA 4QZAA 4XRHA 5B3QA 2PFNA 2HEKA 3JPSA 3JYYA 2ZH7A 1HUOA 5CJ7A 4RXQA 1BPDA 3K7DA 4L7EA 4P4OA 4K99A 8ICJA 3OWGA 4LZDA 4I2DA 5HREA 5EOZA 1TFWA 3RJFA 5IIKA 5HC9A 3HWTA 3MEMA 5DKWA 4ME4A 4RT3A 4RT2A 4LVSA 4EGWA 3PMLA 2ZHBA 3H3AA 4RXOA 3AUOA 3OUYA 3HIYA 3NVOA 8ICYA 3EF2A 3UXPA 9ICXA 4IG8A 3RJHA 4L7WA 4R66A 1YNBA 1NO5A 3UXOA 3WFSC 4RXSA 8ICRA 9ICJA 4K4GA 5HRKA 2HN1A 4ZWGA 4I0UA 2B4VA 3V7KA 1ZQOA 1R8BA 1ZQKA 5HRGA 4X4TA 4TNYA 3RJJA 4WQKA 1ZQSA 4FHXA 5TK8A 2B56A 3ISBA 4JWMA 3WFQE 5J2AA 3NKUA 5CHEA 4WH5A 4KLIA 4F5PA 2ZH9A 9ICGA 4PGYA 1UEVA 4I2EA 4DOAA 5D61A 4EBKA 1ZQPA 2PXIA 9ICHA 4N71A 4NM2A 4NXUA 2NRKA 4I2IA 4TO6A 4LEYA 3UPQA 4NM1A 4K96A 3RJKA 3B0YA 4XDSA 9ICUA 1BPZA 3H37A 3JZ0A 3GW7A 2ZH4A 3TFSA 8ICMA 2BCVA 3V7JA 5CR0A 4YMOA 1XSNA 7ICEA 1XX7A 4KB6A 2ISOA 2DRAA 1XSPA 4TO0A 4RQ2A 3JPPA 1ZQHA 4KLOA 5CA7A 4X4PA 2Q14A 4OAGA 5J2GA 3MBYA 3OUYB 4I2BA 2DQBA 5J2IA 7ICQA 4KLEA 3H39A 3V7LA 4KLHA 4P2HA 5J2FA 4O69A 3JPRA 1ZQIA 4MFCA 4XA5A 3TMDA 2DVIA 4JWNA 4OAIZ 4WC6A 4M47A 4N6WA 4TUQA 8ICSA 1JN3A 5DB7A 2BCUA 3OVBA 1ZQXA 4X0BA 1MIYA 1YOYA 1JAJA 4X0AA 1KNYA 1Q79A 4TO4A 4OAFA 2W9MA 3ERCC 4M9JA 4QFXA 2RFFA 3I7AA 1TFYA 4DO9A 4QG0A 3AQKA 4I28A 2ZH8A 4BZBA 4NKTA 5TKAA 2PBEA 2EWRA 8ICZA 4MDZA 4RPZA 3HJ4A 5DECA 4OAHA 4RPYA 9ICEA 1VJ7A 4O6AA 4RWQA 4FHWA 5IIIA 3WFOA 4R64A 3PMNA 8ICIA 1KDHA 4KM5A 5IIJA 2GWSA 4Z6DA 5J0UA 2PFOA 8ICPA 2PARA 9ICTA 1ZQDA 4QZGA 5IIMA 2O1PA 1V4AA 5DDYA 3MCRA 8ICWA 9ICRA 4RQ0A 4TUPA 4QZ8A 2FMQA 3HC1A 4TNPA 4UB5A 1TVAA 4AT8A 4NXZA 3HJ1A 1U6ZA 4MF8A 3MGHA 1JMSA 4TO5A 4Z6CA 5HHHA 2M2TA 2M2WA 2I9GA 8ICVA 4UBBA 3KH1A 4LT6A 4RQ7A 3PNCA 2B51A 9ICOA 3C5FA 4YD1A 1ZQMA 2HN2A 1TV9A 5AO1A 3B0XA 4NLKA 4RXPA 3NR1A 4RQ8A 3C66A 4EEDA 1R89A 1ZQCA 4IQUA 4R8ZA 4X9EA 5HRBA 3TFRA 1ZQGA 2FMPA 4YD2A 5AO0A 2BCQA 3ER8C 1MIVA 4K4IA 4YMMA 1KEJA 4O67A 4E80A 1ZJNA 4M9GA 3BG2A 4WC0A 4TNZA 4NXWA 1ZQVA 3AQNA 1FA0A 3MDCA 1HUZA 4X4OA 4KLQA 4KLTA 4PPXA 4RQ4A 5DEDA 4QQXA 8ICUA 8ICFA 8ICGA 1UETA 4RQ5A 5J0SA 3ISCA 4NXVA 4X4VA 9ICPA 5J2JA 2ZH6A 5IINA 3SK9A 5HHIA 4KLFA 4EBJA 4R63A 9ICLA 4MFAA 4PHEA 4AT8B 4NXTA 1NOMA 3RH4A 1ZQFA 2FCLA 4FH5A 4N7RA 8ICOA 4IQVA 4RQ1A 4M5DA 1VFGA 1ZQTA 1MIWA 4NKUA 2ZH5A 9ICQA 1OU5A 5J2HA 4PGXA 5J0PA 8ICXA 2FMSA 4QZDA 4WCWA 4GXJA 4FO6A 4FHPA 4QZHA 2HHPA 4TO2A 4FO1A 4KLMA 4LEZA 4KLSA 3JPOA 3OGUA 8ICEA 3OVAA 4MLMA 5AO4A 5D46A 3JPNA 4WC7A 5J0OA 4QFZA 3CK6A 2ZHAA 2PFQA 4MF2A 3HI0A 4QG1A 4QFYA 7ICRA 3CCGA 3NYBA 3HX0A 2DR8A 4UAYA 4NLNA 8ICKA 5HRDA 5CFUA 3S4LA 4M9NA 1R8CA 1ZQLA 1BPYA 2M2UA 9ICIA 5CP2A 1MQ2A 2ZH2A 4AT7A 4GXKA 3IRHA 5DDMA 4M9LA 3C18A 2BPGA 2OGIA 5F2VO 1ZQZA 4WC1A 4X4RA 7ICUA 2GZ4A 2IHMA 4F5QA 4XQ8A 1ZJMA 5DBCA 5J2DA 5J0RA 2CQZA 2PAUA 5DB8A 5J0TA 3MGIA 7ICGA 3TMCA 4P4PA 3JPTA 2DR5A 2ZH1A 4QQWA 5IIOA 2O08A 4UB2A 9ICFA 3UPSA 8ICNA 3OVSA 1RPLA 4QG2A 4AT9A 4NLZA 1XSLA 7ICIA 3MDAA 4F5OA 3WFPA 3ISDA 4I27A 4X4QA 1WOTA 4K9BA 1ZQEA 5DBBA 3K75D 3H38A 4UAWA 4P4MA 2GA9D 5IILA 2M2VA 5HR9A 1RZTA 3LJXA 3M1TA 3RJEA 2BCRA 2BPFA 7ICOA 5HRFA 4RPXA 1ZQWA 3PHZA 3GDXA 3C5GA 4I2GA 4WC2A 1ZQUA 1BPBA 1BPXA 7ICFA 5DB6A 3NWIA 4AT7B 7ICPA 4I2AA 5CFTA 3AU6A 4TNQA 7ICJA 1Q78A 4QG4A 5DB9A 3NQWA 3AU2A 3MZOA 4JLXA 1R8AA 5J2KA 4K98A 9ICAA 4DMBA 2BPCA 4MFFA 2FLOA 4O5EA 4KLDA 4ATBA 4QZCA 5TK9A 4K97A 4RXRA 3P3QA 4HX0A 4I29A 4Q2DA 3JCFA 9ICWA 4XUSA 1PX5A 4AT9B 4LEWA 4GXIA 5D62A 4EEBA 4RWPA 4I2FA 4TO3A 8ICBA 4O9MA 4K9AA 3UQ2A 4LZGA 1ZQJA 4KLLA 4FHVA 3RJIA 2BBHA 2ZH3A 4MLNA 5HRLA 8ICQA 3OV7A 8ICHA 5HRHA 4NY8A 7ICMA 9ICBA 8ICLA 4EP7A 4X4SA 4K8VA 3WFRE 3C2LA 3C2MA 4WC4A 8ICAA 4E8FA 4PHPA 2GAFD 5CB1A 3ER9B 7ICKA 4UD5A 4QZEA 5CFSA 3RJGA 4KLJA 9ICNA 4RQ6A 4UAZA 2PQ7A 4QZIA 3LK9A 3U1NA 4F5NA 4WC3A 9ICMA 4KLUA 5D63A 3AQLA 4WQLA 5JTGA 4UB4A 4I2JA 2DR9A 1BPEA 2BE3A 5J2BA 4ATBB 9ICCA 2O6IA 5D49A 1MQ3A 4TNRA 1ZQAA 4K4HA 3UXNA 2BCSA 4DOBA 4RWNA 2PGSA 5CWRA 4MCWA 4IQWA 4EV6A 4TURA 1GPJA 3UQ0A 5D4BA 7ICSA 4KLGA 5CHGA 4TUSA 4X4NA 9ICSA 4X5VA 1UEUA 4XJEA 4MKPA 4UB3A 3C2KA 4DOCA 5J0WA 4FHYA 2PFPA 8ICCA 4WBYA 2DR7A 4O5KA 4L1JA 3SKDA 4S3NA 4Z6FA 5BPCA 2Q66A 4WBZA 1JQRA 4PGQA 1ZQBA 4O5CA 1ZQQA 4X4UA 1F5AA 4UBCA 4RWOA 4ZWEA 1ZQNA 4M2YA 4XQ7A 1ZQRA 3LQCB 2ID1A 5TZVA 5HRIA 5J0YA 4M04A 9ICKA 4RQ3A 2ISPA 1YLQA 2O5AA 4Q7HA 4TNXA 4QQZA 5B3PA 2BBJA 4YMNA
chains in the Genus database with same CATH topology
4UB1A 5AO2A 4FH3A 4YCXA 2DRBA 2P66A 4I2HA 4QZ9A 4QZFA 1ZQYA 4LRLA 4BZCA 3TM8A 4R65A 4WC5A 5J2EA 3V72A 8ICTA 4PHAA 9ICVA 3AQMA 2PAQA 5BOLA 4QZBA 5DBAA 5TK6A 5J29A 4YN4A 4F5RA 4QQYA 4I2CA 4UD4A 3HW8A 5AO3A 1VQRA 4M9HA 2VANA 4IQTA 4M0AA 7ICVA 5J0XA 5BOMA 4PHDA 4L1JB 5J2CA 4E7XA 4Z6EA 3RH6A 3RF0A 7ICTA 4TO1A 4MZ7A 5TK7A 3TMBA 7ICHA 7ICLA 3L9DA 4PH5A 3JPQA 3RH5A 5J0QA 3KQ5A 4Q2CA 7ICNA 4QZAA 4XRHA 2PFNA 2HEKA 3JPSA 3JYYA 2ZH7A 1HUOA 5CJ7A 4RXQA 1BPDA 4L7EA 4P4OA 8ICJA 4LZDA 4I2DA 5HREA 5EOZA 1TFWA 3RJFA 5IIKA 5HC9A 3HWTA 3MEMA 5DKWA 4ME4A 4RT3A 4RT2A 4LVSA 3PMLA 2ZHBA 3H3AA 4RXOA 3AUOA 3OUYA 3HIYA 8ICYA 3UXPA 9ICXA 4IG8A 3RJHA 4L7WA 4R66A 1YNBA 1NO5A 3UXOA 3WFSC 4RXSA 8ICRA 9ICJA 4K4GA 5HRKA 4ZWGA 3V7KA 1ZQOA 1R8BA 1ZQKA 5HRGA 4X4TA 4TNYA 3RJJA 1ZQSA 4FHXA 5TK8A 3ISBA 4JWMA 3WFQE 5J2AA 4KLIA 4F5PA 2ZH9A 9ICGA 4PGYA 1UEVA 4I2EA 4DOAA 4EBKA 1ZQPA 2PXIA 9ICHA 4N71A 4NM2A 2NRKA 4I2IA 4TO6A 3UPQA 4NM1A 3RJKA 3B0YA 4XDSA 9ICUA 1BPZA 3H37A 3JZ0A 3GW7A 2ZH4A 3TFSA 8ICMA 2BCVA 3V7JA 5CR0A 4YMOA 1XSNA 7ICEA 1XX7A 2ISOA 2DRAA 1XSPA 4TO0A 4RQ2A 3JPPA 1ZQHA 4KLOA 5CA7A 4X4PA 2Q14A 5J2GA 3MBYA 3OUYB 4I2BA 2DQBA 5J2IA 7ICQA 4KLEA 3H39A 3V7LA 4KLHA 4P2HA 5J2FA 3JPRA 1ZQIA 4MFCA 4XA5A 3TMDA 2DVIA 4JWNA 4WC6A 4M47A 4N6WA 4TUQA 8ICSA 1JN3A 5DB7A 2BCUA 3OVBA 1ZQXA 4X0BA 1MIYA 1YOYA 1JAJA 4X0AA 1KNYA 1Q79A 4TO4A 2W9MA 4M9JA 4QFXA 2RFFA 3I7AA 1TFYA 4DO9A 4QG0A 3AQKA 4I28A 2ZH8A 4BZBA 4NKTA 5TKAA 2PBEA 8ICZA 4MDZA 4RPZA 3HJ4A 5DECA 4RPYA 9ICEA 1VJ7A 4RWQA 4FHWA 5IIIA 3WFOA 4R64A 3PMNA 8ICIA 1KDHA 2GWSA 5IIJA 2PFOA 4Z6DA 5J0UA 8ICPA 2PARA 9ICTA 1ZQDA 4QZGA 5IIMA 2O1PA 1V4AA 5DDYA 8ICWA 9ICRA 4RQ0A 4TUPA 4QZ8A 2FMQA 3HC1A 4TNPA 4UB5A 1TVAA 4AT8A 4NXZA 3HJ1A 1U6ZA 4MF8A 3MGHA 1JMSA 4TO5A 4Z6CA 5HHHA 2M2TA 2M2WA 2I9GA 8ICVA 4UBBA 3KH1A 4LT6A 4RQ7A 3PNCA 9ICOA 3C5FA 4YD1A 1ZQMA 1TV9A 5AO1A 3B0XA 4NLKA 4RXPA 3NR1A 4RQ8A 3C66A 1R89A 1ZQCA 4IQUA 4R8ZA 4X9EA 5HRBA 3TFRA 1ZQGA 2FMPA 4YD2A 5AO0A 2BCQA 1MIVA 4K4IA 4YMMA 1KEJA 4E80A 1ZJNA 4M9GA 3BG2A 4WC0A 4TNZA 1ZQVA 3AQNA 1FA0A 3MDCA 1HUZA 4X4OA 4KLQA 4KLTA 4PPXA 4RQ4A 5DEDA 4QQXA 8ICUA 8ICFA 8ICGA 1UETA 4RQ5A 5J0SA 3ISCA 4X4VA 9ICPA 5J2JA 2ZH6A 5IINA 3SK9A 5HHIA 4KLFA 4EBJA 4R63A 9ICLA 4MFAA 4PHEA 4AT8B 1NOMA 3RH4A 1ZQFA 4FH5A 8ICOA 4IQVA 4RQ1A 4M5DA 1VFGA 1ZQTA 1MIWA 4NKUA 2ZH5A 9ICQA 1OU5A 5J2HA 4PGXA 5J0PA 8ICXA 2FMSA 4QZDA 4WCWA 4GXJA 4FO6A 4FHPA 4QZHA 2HHPA 4TO2A 4KLMA 4KLSA 3JPOA 3OGUA 8ICEA 3OVAA 4MLMA 5AO4A 5D46A 3JPNA 4WC7A 5J0OA 4QFZA 2ZHAA 2PFQA 4MF2A 3HI0A 4QG1A 4QFYA 7ICRA 3CCGA 3NYBA 3HX0A 2DR8A 4UAYA 4NLNA 8ICKA 5HRDA 3S4LA 4M9NA 1R8CA 1ZQLA 1BPYA 2M2UA 9ICIA 5CP2A 1MQ2A 2ZH2A 4AT7A 4GXKA 3IRHA 5DDMA 4M9LA 3C18A 2BPGA 2OGIA 5F2VO 1ZQZA 4WC1A 4X4RA 7ICUA 2GZ4A 2IHMA 4F5QA 4XQ8A 1ZJMA 5DBCA 5J2DA 5J0RA 2CQZA 2PAUA 5DB8A 5J0TA 3MGIA 7ICGA 3TMCA 4P4PA 3JPTA 2DR5A 2ZH1A 4QQWA 5IIOA 2O08A 4UB2A 9ICFA 3UPSA 8ICNA 3OVSA 1RPLA 4QG2A 4AT9A 4NLZA 1XSLA 7ICIA 3MDAA 4F5OA 3WFPA 3ISDA 4I27A 4X4QA 1WOTA 1ZQEA 5DBBA 3K75D 3H38A 4UAWA 4P4MA 5IILA 2M2VA 5HR9A 1RZTA 3LJXA 3M1TA 3RJEA 2BCRA 2BPFA 7ICOA 5HRFA 4RPXA 1ZQWA 3GDXA 3C5GA 4I2GA 4WC2A 1ZQUA 1BPBA 1BPXA 7ICFA 5DB6A 4AT7B 7ICPA 4I2AA 3AU6A 4TNQA 7ICJA 1Q78A 4QG4A 5DB9A 3NQWA 3AU2A 3MZOA 1R8AA 5J2KA 9ICAA 4DMBA 2BPCA 4MFFA 2FLOA 4O5EA 4KLDA 4ATBA 4QZCA 5TK9A 4RXRA 3P3QA 4I29A 4Q2DA 9ICWA 4XUSA 1PX5A 4AT9B 4GXIA 4RWPA 4I2FA 4TO3A 8ICBA 4O9MA 3UQ2A 4LZGA 1ZQJA 4KLLA 4FHVA 3RJIA 2ZH3A 4MLNA 5HRLA 8ICQA 3OV7A 8ICHA 5HRHA 4NY8A 7ICMA 9ICBA 8ICLA 4EP7A 4X4SA 3WFRE 3C2LA 3C2MA 4WC4A 8ICAA 4E8FA 4PHPA 5CB1A 7ICKA 4UD5A 4QZEA 3RJGA 4KLJA 9ICNA 4RQ6A 4UAZA 2PQ7A 4QZIA 3LK9A 3U1NA 4F5NA 4WC3A 9ICMA 4KLUA 3AQLA 4UB4A 4I2JA 2DR9A 1BPEA 2BE3A 5J2BA 4ATBB 9ICCA 2O6IA 5D49A 1MQ3A 4TNRA 1ZQAA 4K4HA 3UXNA 2BCSA 4DOBA 4RWNA 2PGSA 5CWRA 4MCWA 4IQWA 4TURA 3UQ0A 5D4BA 7ICSA 4KLGA 5CHGA 4TUSA 4X4NA 9ICSA 4X5VA 1UEUA 4UB3A 3C2KA 4DOCA 5J0WA 4FHYA 2PFPA 8ICCA 4WBYA 2DR7A 4O5KA 4L1JA 3SKDA 4S3NA 4Z6FA 5BPCA 2Q66A 4WBZA 1JQRA 4PGQA 1ZQBA 4O5CA 1ZQQA 4X4UA 1F5AA 4UBCA 4RWOA 4ZWEA 1ZQNA 4M2YA 4XQ7A 1ZQRA 3LQCB 2ID1A 5TZVA 5HRIA 5J0YA 4M04A 9ICKA 4RQ3A 2ISPA 1YLQA 2O5AA 4Q7HA 4TNXA 4QQZA 4YMNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UB1 A;  5AO2 A;  4FH3 A;  4YCX A;  2DRB A;  2P66 A;  4I2H A;  4QZ9 A;  4QZF A;  1ZQY A;  4LRL A;  4BZC A;  3TM8 A;  4R65 A;  4WC5 A;  5J2E A;  3V72 A;  8ICT A;  4PHA A;  9ICV A;  3AQM A;  2PAQ A;  5BOL A;  4QZB A;  5DBA A;  5TK6 A;  5J29 A;  4YN4 A;  4F5R A;  4I2C A;  4UD4 A;  3HW8 A;  5AO3 A;  1VQR A;  4M9H A;  2VAN A;  4IQT A;  4M0A A;  7ICV A;  5J0X A;  5BOM A;  4PHD A;  4L1J B;  5J2C A;  4E7X A;  4Z6E A;  3RH6 A;  3RF0 A;  7ICT A;  4TO1 A;  4MZ7 A;  5TK7 A;  3TMB A;  7ICH A;  7ICL A;  3L9D A;  4PH5 A;  3JPQ A;  3RH5 A;  5J0Q A;  7ICN A;  4QZA A;  4XRH A;  2PFN A;  2HEK A;  3JPS A;  3JYY A;  2ZH7 A;  1HUO A;  5CJ7 A;  4RXQ A;  1BPD A;  4L7E A;  4P4O A;  8ICJ A;  4LZD A;  4I2D A;  5HRE A;  5EOZ A;  1TFW A;  3RJF A;  5IIK A;  5HC9 A;  3HWT A;  3MEM A;  5DKW A;  4ME4 A;  4RT3 A;  4RT2 A;  4LVS A;  3PML A;  2ZHB A;  3H3A A;  4RXO A;  3AUO A;  3OUY A;  3HIY A;  8ICY A;  3UXP A;  9ICX A;  4IG8 A;  3RJH A;  4L7W A;  4R66 A;  1YNB A;  1NO5 A;  3UXO A;  3WFS C;  4RXS A;  8ICR A;  9ICJ A;  4K4G A;  5HRK A;  4ZWG A;  3V7K A;  1ZQO A;  1R8B A;  1ZQK A;  5HRG A;  4X4T A;  4TNY A;  3RJJ A;  1ZQS A;  4FHX A;  5TK8 A;  3ISB A;  4JWM A;  3WFQ E;  5J2A A;  4KLI A;  4F5P A;  2ZH9 A;  9ICG A;  4PGY A;  1UEV A;  4I2E A;  4DOA A;  4EBK A;  1ZQP A;  2PXI A;  9ICH A;  4N71 A;  4NM2 A;  2NRK A;  4I2I A;  4TO6 A;  3UPQ A;  4NM1 A;  3RJK A;  3B0Y A;  4XDS A;  9ICU A;  1BPZ A;  3H37 A;  3JZ0 A;  2ZH4 A;  3TFS A;  8ICM A;  2BCV A;  3V7J A;  5CR0 A;  4YMO A;  1XSN A;  7ICE A;  1XX7 A;  2ISO A;  2DRA A;  1XSP A;  4TO0 A;  4RQ2 A;  3JPP A;  1ZQH A;  4KLO A;  5CA7 A;  4X4P A;  2Q14 A;  5J2G A;  3MBY A;  3OUY B;  4I2B A;  2DQB A;  5J2I A;  7ICQ A;  4KLE A;  3H39 A;  3V7L A;  4KLH A;  4P2H A;  5J2F A;  3JPR A;  1ZQI A;  4MFC A;  4XA5 A;  3TMD A;  2DVI A;  4JWN A;  4WC6 A;  4M47 A;  4N6W A;  4TUQ A;  8ICS A;  1JN3 A;  5DB7 A;  2BCU A;  3OVB A;  1ZQX A;  4X0B A;  1MIY A;  1YOY A;  1JAJ A;  4X0A A;  1KNY A;  1Q79 A;  4TO4 A;  2W9M A;  4M9J A;  4QFX A;  2RFF A;  3I7A A;  1TFY A;  4DO9 A;  4QG0 A;  3AQK A;  4I28 A;  2ZH8 A;  4BZB A;  4NKT A;  5TKA A;  2PBE A;  8ICZ A;  4MDZ A;  4RPZ A;  3HJ4 A;  5DEC A;  4RPY A;  9ICE A;  1VJ7 A;  4RWQ A;  4FHW A;  5III A;  3WFO A;  4R64 A;  3PMN A;  8ICI A;  1KDH A;  2GWS A;  5IIJ A;  2PFO A;  4Z6D A;  5J0U A;  8ICP A;  2PAR A;  9ICT A;  1ZQD A;  4QZG A;  5IIM A;  2O1P A;  1V4A A;  5DDY A;  8ICW A;  9ICR A;  4RQ0 A;  4TUP A;  4QZ8 A;  2FMQ A;  3HC1 A;  4TNP A;  4UB5 A;  1TVA A;  4AT8 A;  4NXZ A;  3HJ1 A;  1U6Z A;  4MF8 A;  3MGH A;  1JMS A;  4TO5 A;  4Z6C A;  5HHH A;  2M2T A;  2M2W A;  2I9G A;  8ICV A;  4UBB A;  3KH1 A;  4LT6 A;  4RQ7 A;  3PNC A;  9ICO A;  3C5F A;  4YD1 A;  1ZQM A;  1TV9 A;  5AO1 A;  3B0X A;  4NLK A;  4RXP A;  3NR1 A;  4RQ8 A;  3C66 A;  1R89 A;  1ZQC A;  4IQU A;  4R8Z A;  4X9E A;  5HRB A;  3TFR A;  1ZQG A;  2FMP A;  4YD2 A;  5AO0 A;  2BCQ A;  1MIV A;  4K4I A;  4YMM A;  1KEJ A;  4E80 A;  1ZJN A;  4M9G A;  3BG2 A;  4WC0 A;  4TNZ A;  1ZQV A;  3AQN A;  1FA0 A;  3MDC A;  1HUZ A;  4X4O A;  4KLQ A;  4KLT A;  4PPX A;  4RQ4 A;  5DED A;  8ICU A;  8ICF A;  8ICG A;  1UET A;  4RQ5 A;  5J0S A;  3ISC A;  4X4V A;  9ICP A;  5J2J A;  2ZH6 A;  5IIN A;  4KLF A;  5HHI A;  4EBJ A;  4R63 A;  9ICL A;  4MFA A;  4PHE A;  4AT8 B;  1NOM A;  3RH4 A;  1ZQF A;  4FH5 A;  8ICO A;  4IQV A;  4RQ1 A;  4M5D A;  1VFG A;  1ZQT A;  1MIW A;  4NKU A;  2ZH5 A;  9ICQ A;  1OU5 A;  5J2H A;  4PGX A;  5J0P A;  8ICX A;  2FMS A;  4QZD A;  4WCW A;  4GXJ A;  4FO6 A;  4FHP A;  4QZH A;  2HHP A;  4TO2 A;  4KLM A;  4KLS A;  3JPO A;  3OGU A;  8ICE A;  3OVA A;  4MLM A;  5AO4 A;  5D46 A;  3JPN A;  4WC7 A;  5J0O A;  4QFZ A;  2ZHA A;  2PFQ A;  4MF2 A;  3HI0 A;  4QG1 A;  4QFY A;  7ICR A;  3CCG A;  3NYB A;  3HX0 A;  2DR8 A;  4UAY A;  4NLN A;  8ICK A;  5HRD A;  4M9N A;  1R8C A;  1ZQL A;  1BPY A;  2M2U A;  9ICI A;  5CP2 A;  1MQ2 A;  2ZH2 A;  4AT7 A;  4GXK A;  3IRH A;  5DDM A;  4M9L A;  3C18 A;  2BPG A;  2OGI A;  5F2V O;  1ZQZ A;  4WC1 A;  4X4R A;  7ICU A;  2GZ4 A;  2IHM A;  4F5Q A;  4XQ8 A;  1ZJM A;  5DBC A;  5J2D A;  5J0R A;  2CQZ A;  2PAU A;  5DB8 A;  5J0T A;  3MGI A;  7ICG A;  3TMC A;  4P4P A;  3JPT A;  2DR5 A;  2ZH1 A;  5IIO A;  2O08 A;  4UB2 A;  9ICF A;  3UPS A;  8ICN A;  3OVS A;  1RPL A;  4QG2 A;  4AT9 A;  4NLZ A;  1XSL A;  7ICI A;  3MDA A;  4F5O A;  3WFP A;  3ISD A;  4I27 A;  4X4Q A;  1WOT A;  1ZQE A;  5DBB A;  3K75 D;  3H38 A;  4UAW A;  4P4M A;  5IIL A;  2M2V A;  5HR9 A;  1RZT A;  3LJX A;  3M1T A;  3RJE A;  2BCR A;  2BPF A;  7ICO A;  5HRF A;  4RPX A;  1ZQW A;  3GDX A;  3C5G A;  4I2G A;  4WC2 A;  1ZQU A;  1BPB A;  1BPX A;  7ICF A;  5DB6 A;  4AT7 B;  7ICP A;  4I2A A;  3AU6 A;  4TNQ A;  7ICJ A;  1Q78 A;  4QG4 A;  5DB9 A;  3NQW A;  3AU2 A;  3MZO A;  1R8A A;  5J2K A;  9ICA A;  4DMB A;  2BPC A;  4MFF A;  2FLO A;  4O5E A;  4KLD A;  4ATB A;  4QZC A;  5TK9 A;  4RXR A;  3P3Q A;  4I29 A;  9ICW A;  4XUS A;  1PX5 A;  4AT9 B;  4GXI A;  4RWP A;  4I2F A;  4TO3 A;  8ICB A;  4O9M A;  3UQ2 A;  4LZG A;  1ZQJ A;  4KLL A;  4FHV A;  3RJI A;  2ZH3 A;  4MLN A;  5HRL A;  8ICQ A;  3OV7 A;  8ICH A;  5HRH A;  4NY8 A;  7ICM A;  9ICB A;  8ICL A;  4EP7 A;  4X4S A;  3WFR E;  3C2L A;  3C2M A;  4WC4 A;  8ICA A;  4E8F A;  4PHP A;  5CB1 A;  7ICK A;  4UD5 A;  4QZE A;  3RJG A;  4KLJ A;  9ICN A;  4RQ6 A;  4UAZ A;  2PQ7 A;  4QZI A;  3LK9 A;  3U1N A;  4F5N A;  4WC3 A;  9ICM A;  4KLU A;  3AQL A;  4UB4 A;  4I2J A;  2DR9 A;  1BPE A;  2BE3 A;  5J2B A;  4ATB B;  9ICC A;  2O6I A;  5D49 A;  1MQ3 A;  4TNR A;  1ZQA A;  4K4H A;  3UXN A;  2BCS A;  4DOB A;  4RWN A;  2PGS A;  5CWR A;  4MCW A;  4IQW A;  4TUR A;  3UQ0 A;  5D4B A;  7ICS A;  4KLG A;  5CHG A;  4TUS A;  4X4N A;  9ICS A;  4X5V A;  1UEU A;  4UB3 A;  3C2K A;  4DOC A;  5J0W A;  4FHY A;  2PFP A;  8ICC A;  4WBY A;  2DR7 A;  4O5K A;  4L1J A;  4S3N A;  4Z6F A;  5BPC A;  2Q66 A;  4WBZ A;  1JQR A;  4PGQ A;  1ZQB A;  4O5C A;  1ZQQ A;  4X4U A;  1F5A A;  4UBC A;  4RWO A;  4ZWE A;  1ZQN A;  4M2Y A;  4XQ7 A;  1ZQR A;  3LQC B;  2ID1 A;  5TZV A;  5HRI A;  5J0Y A;  4M04 A;  9ICK A;  4RQ3 A;  2ISP A;  1YLQ A;  2O5A A;  4Q7H A;  4TNX A;  4YMN A; 
#chains in the Genus database with same CATH topology
 4UB1 A;  5AO2 A;  4FH3 A;  4YCX A;  2DRB A;  2P66 A;  4I2H A;  4QZ9 A;  4QZF A;  1ZQY A;  4LRL A;  4BZC A;  3TM8 A;  4LEV A;  4R65 A;  4WC5 A;  5J2E A;  3V72 A;  8ICT A;  2IHO A;  4PHA A;  9ICV A;  3AQM A;  2PAQ A;  5BOL A;  4QZB A;  5DBA A;  5TK6 A;  5J29 A;  4JLZ A;  4YN4 A;  4F5R A;  4O68 A;  4QQY A;  4I2C A;  4UD4 A;  3HW8 A;  5AO3 A;  1VQR A;  4WOY A;  4M9H A;  2VAN A;  4IQT A;  4M0A A;  7ICV A;  5J0X A;  5BOM A;  4PHD A;  4L1J B;  5J2C A;  4E7X A;  4Z6E A;  3RH6 A;  3RF0 A;  7ICT A;  4TO1 A;  4MZ7 A;  5TK7 A;  3TMB A;  7ICH A;  7ICL A;  4NXX A;  3L9D A;  2IUB A;  4PH5 A;  3JPQ A;  5J0Q A;  3KQ5 A;  4Q2C A;  3RH5 A;  7ICN A;  4QZA A;  4XRH A;  5B3Q A;  2PFN A;  2HEK A;  3JPS A;  3JYY A;  2ZH7 A;  1HUO A;  5CJ7 A;  4RXQ A;  1BPD A;  3K7D A;  4L7E A;  4P4O A;  4K99 A;  8ICJ A;  3OWG A;  4LZD A;  4I2D A;  5HRE A;  5EOZ A;  1TFW A;  3RJF A;  5IIK A;  5HC9 A;  3HWT A;  3MEM A;  5DKW A;  4ME4 A;  4RT3 A;  4RT2 A;  4LVS A;  4EGW A;  3PML A;  2ZHB A;  3H3A A;  4RXO A;  3AUO A;  3OUY A;  3HIY A;  3NVO A;  8ICY A;  3EF2 A;  3UXP A;  9ICX A;  4IG8 A;  3RJH A;  4L7W A;  4R66 A;  1YNB A;  1NO5 A;  3UXO A;  3WFS C;  4RXS A;  8ICR A;  9ICJ A;  4K4G A;  5HRK A;  2HN1 A;  4ZWG A;  4I0U A;  2B4V A;  3V7K A;  1ZQO A;  1R8B A;  1ZQK A;  5HRG A;  4X4T A;  4TNY A;  3RJJ A;  4WQK A;  1ZQS A;  4FHX A;  5TK8 A;  2B56 A;  3ISB A;  4JWM A;  3WFQ E;  5J2A A;  3NKU A;  5CHE A;  4WH5 A;  4KLI A;  4F5P A;  2ZH9 A;  9ICG A;  4PGY A;  1UEV A;  4I2E A;  4DOA A;  5D61 A;  4EBK A;  1ZQP A;  2PXI A;  9ICH A;  4N71 A;  4NM2 A;  4NXU A;  2NRK A;  4I2I A;  4TO6 A;  4LEY A;  3UPQ A;  4NM1 A;  4K96 A;  3RJK A;  3B0Y A;  4XDS A;  9ICU A;  1BPZ A;  3H37 A;  3JZ0 A;  3GW7 A;  2ZH4 A;  3TFS A;  8ICM A;  2BCV A;  3V7J A;  5CR0 A;  4YMO A;  1XSN A;  7ICE A;  1XX7 A;  4KB6 A;  2ISO A;  2DRA A;  1XSP A;  4TO0 A;  4RQ2 A;  3JPP A;  1ZQH A;  4KLO A;  5CA7 A;  4X4P A;  2Q14 A;  4OAG A;  5J2G A;  3MBY A;  3OUY B;  4I2B A;  2DQB A;  5J2I A;  7ICQ A;  4KLE A;  3H39 A;  3V7L A;  4KLH A;  4P2H A;  5J2F A;  4O69 A;  3JPR A;  1ZQI A;  4MFC A;  4XA5 A;  3TMD A;  2DVI A;  4JWN A;  4OAI Z;  4WC6 A;  4M47 A;  4N6W A;  4TUQ A;  8ICS A;  1JN3 A;  5DB7 A;  2BCU A;  3OVB A;  1ZQX A;  4X0B A;  1MIY A;  1YOY A;  1JAJ A;  4X0A A;  1KNY A;  1Q79 A;  4TO4 A;  4OAF A;  2W9M A;  3ERC C;  4M9J A;  4QFX A;  2RFF A;  3I7A A;  1TFY A;  4DO9 A;  4QG0 A;  3AQK A;  4I28 A;  2ZH8 A;  4BZB A;  4NKT A;  5TKA A;  2PBE A;  2EWR A;  8ICZ A;  4MDZ A;  4RPZ A;  3HJ4 A;  5DEC A;  4OAH A;  4RPY A;  9ICE A;  1VJ7 A;  4O6A A;  4RWQ A;  4FHW A;  5III A;  3WFO A;  4R64 A;  3PMN A;  8ICI A;  1KDH A;  4KM5 A;  5IIJ A;  2GWS A;  4Z6D A;  5J0U A;  2PFO A;  8ICP A;  2PAR A;  9ICT A;  1ZQD A;  4QZG A;  5IIM A;  2O1P A;  1V4A A;  5DDY A;  3MCR A;  8ICW A;  9ICR A;  4RQ0 A;  4TUP A;  4QZ8 A;  2FMQ A;  3HC1 A;  4TNP A;  4UB5 A;  1TVA A;  4AT8 A;  4NXZ A;  3HJ1 A;  1U6Z A;  4MF8 A;  3MGH A;  1JMS A;  4TO5 A;  4Z6C A;  5HHH A;  2M2T A;  2M2W A;  2I9G A;  8ICV A;  4UBB A;  3KH1 A;  4LT6 A;  4RQ7 A;  3PNC A;  2B51 A;  9ICO A;  3C5F A;  4YD1 A;  1ZQM A;  2HN2 A;  1TV9 A;  5AO1 A;  3B0X A;  4NLK A;  4RXP A;  3NR1 A;  4RQ8 A;  3C66 A;  4EED A;  1R89 A;  1ZQC A;  4IQU A;  4R8Z A;  4X9E A;  5HRB A;  3TFR A;  1ZQG A;  2FMP A;  4YD2 A;  5AO0 A;  2BCQ A;  3ER8 C;  1MIV A;  4K4I A;  4YMM A;  1KEJ A;  4O67 A;  4E80 A;  1ZJN A;  4M9G A;  3BG2 A;  4WC0 A;  4TNZ A;  4NXW A;  1ZQV A;  3AQN A;  1FA0 A;  3MDC A;  1HUZ A;  4X4O A;  4KLQ A;  4KLT A;  4PPX A;  4RQ4 A;  5DED A;  4QQX A;  8ICU A;  8ICF A;  8ICG A;  1UET A;  4RQ5 A;  5J0S A;  3ISC A;  4NXV A;  4X4V A;  9ICP A;  5J2J A;  2ZH6 A;  5IIN A;  3SK9 A;  5HHI A;  4KLF A;  4EBJ A;  4R63 A;  9ICL A;  4MFA A;  4PHE A;  4AT8 B;  4NXT A;  1NOM A;  3RH4 A;  1ZQF A;  2FCL A;  4FH5 A;  4N7R A;  8ICO A;  4IQV A;  4RQ1 A;  4M5D A;  1VFG A;  1ZQT A;  1MIW A;  4NKU A;  2ZH5 A;  9ICQ A;  1OU5 A;  5J2H A;  4PGX A;  5J0P A;  8ICX A;  2FMS A;  4QZD A;  4WCW A;  4GXJ A;  4FO6 A;  4FHP A;  4QZH A;  2HHP A;  4TO2 A;  4FO1 A;  4KLM A;  4LEZ A;  4KLS A;  3JPO A;  3OGU A;  8ICE A;  3OVA A;  4MLM A;  5AO4 A;  5D46 A;  3JPN A;  4WC7 A;  5J0O A;  4QFZ A;  3CK6 A;  2ZHA A;  2PFQ A;  4MF2 A;  3HI0 A;  4QG1 A;  4QFY A;  7ICR A;  3CCG A;  3NYB A;  3HX0 A;  2DR8 A;  4UAY A;  4NLN A;  8ICK A;  5HRD A;  5CFU A;  3S4L A;  4M9N A;  1R8C A;  1ZQL A;  1BPY A;  2M2U A;  9ICI A;  5CP2 A;  1MQ2 A;  2ZH2 A;  4AT7 A;  4GXK A;  3IRH A;  5DDM A;  4M9L A;  3C18 A;  2BPG A;  2OGI A;  5F2V O;  1ZQZ A;  4WC1 A;  4X4R A;  7ICU A;  2GZ4 A;  2IHM A;  4F5Q A;  4XQ8 A;  1ZJM A;  5DBC A;  5J2D A;  5J0R A;  2CQZ A;  2PAU A;  5DB8 A;  5J0T A;  3MGI A;  7ICG A;  3TMC A;  4P4P A;  3JPT A;  2DR5 A;  2ZH1 A;  4QQW A;  5IIO A;  2O08 A;  4UB2 A;  9ICF A;  3UPS A;  8ICN A;  3OVS A;  1RPL A;  4QG2 A;  4AT9 A;  4NLZ A;  1XSL A;  7ICI A;  3MDA A;  4F5O A;  3WFP A;  3ISD A;  4I27 A;  4X4Q A;  1WOT A;  4K9B A;  1ZQE A;  5DBB A;  3K75 D;  3H38 A;  4UAW A;  4P4M A;  2GA9 D;  5IIL A;  2M2V A;  5HR9 A;  1RZT A;  3LJX A;  3M1T A;  3RJE A;  2BCR A;  2BPF A;  7ICO A;  5HRF A;  4RPX A;  1ZQW A;  3PHZ A;  3GDX A;  3C5G A;  4I2G A;  4WC2 A;  1ZQU A;  1BPB A;  1BPX A;  7ICF A;  5DB6 A;  3NWI A;  4AT7 B;  7ICP A;  4I2A A;  5CFT A;  3AU6 A;  4TNQ A;  7ICJ A;  1Q78 A;  4QG4 A;  5DB9 A;  3NQW A;  3AU2 A;  3MZO A;  4JLX A;  1R8A A;  5J2K A;  4K98 A;  9ICA A;  4DMB A;  2BPC A;  4MFF A;  2FLO A;  4O5E A;  4KLD A;  4ATB A;  4QZC A;  5TK9 A;  4K97 A;  4RXR A;  3P3Q A;  4HX0 A;  4I29 A;  4Q2D A;  3JCF A;  9ICW A;  4XUS A;  1PX5 A;  4AT9 B;  4LEW A;  4GXI A;  5D62 A;  4EEB A;  4RWP A;  4I2F A;  4TO3 A;  8ICB A;  4O9M A;  4K9A A;  3UQ2 A;  4LZG A;  1ZQJ A;  4KLL A;  4FHV A;  3RJI A;  2BBH A;  2ZH3 A;  4MLN A;  5HRL A;  8ICQ A;  3OV7 A;  8ICH A;  5HRH A;  4NY8 A;  7ICM A;  9ICB A;  8ICL A;  4EP7 A;  4X4S A;  4K8V A;  3WFR E;  3C2L A;  3C2M A;  4WC4 A;  8ICA A;  4E8F A;  4PHP A;  2GAF D;  5CB1 A;  3ER9 B;  7ICK A;  4UD5 A;  4QZE A;  5CFS A;  3RJG A;  4KLJ A;  9ICN A;  4RQ6 A;  4UAZ A;  2PQ7 A;  4QZI A;  3LK9 A;  3U1N A;  4F5N A;  4WC3 A;  9ICM A;  4KLU A;  5D63 A;  3AQL A;  4WQL A;  5JTG A;  4UB4 A;  4I2J A;  2DR9 A;  1BPE A;  2BE3 A;  5J2B A;  4ATB B;  9ICC A;  2O6I A;  5D49 A;  1MQ3 A;  4TNR A;  1ZQA A;  4K4H A;  3UXN A;  2BCS A;  4DOB A;  4RWN A;  2PGS A;  5CWR A;  4MCW A;  4IQW A;  4EV6 A;  4TUR A;  1GPJ A;  3UQ0 A;  5D4B A;  7ICS A;  4KLG A;  5CHG A;  4TUS A;  4X4N A;  9ICS A;  4X5V A;  1UEU A;  4XJE A;  4MKP A;  4UB3 A;  3C2K A;  4DOC A;  5J0W A;  4FHY A;  2PFP A;  8ICC A;  4WBY A;  2DR7 A;  4O5K A;  4L1J A;  3SKD A;  4S3N A;  4Z6F A;  5BPC A;  2Q66 A;  4WBZ A;  1JQR A;  4PGQ A;  1ZQB A;  4O5C A;  1ZQQ A;  4X4U A;  1F5A A;  4UBC A;  4RWO A;  4ZWE A;  1ZQN A;  4M2Y A;  4XQ7 A;  1ZQR A;  3LQC B;  2ID1 A;  5TZV A;  5HRI A;  5J0Y A;  4M04 A;  9ICK A;  4RQ3 A;  2ISP A;  1YLQ A;  2O5A A;  4Q7H A;  4TNX A;  4QQZ A;  5B3P A;  2BBJ A;  4YMN A; 
#chains in the Genus database with same CATH homology
 4UB1 A;  5AO2 A;  4FH3 A;  4YCX A;  2DRB A;  2P66 A;  4I2H A;  4QZ9 A;  4QZF A;  1ZQY A;  4LRL A;  4BZC A;  3TM8 A;  4R65 A;  4WC5 A;  5J2E A;  3V72 A;  8ICT A;  4PHA A;  9ICV A;  3AQM A;  2PAQ A;  5BOL A;  4QZB A;  5DBA A;  5TK6 A;  5J29 A;  4YN4 A;  4F5R A;  4QQY A;  4I2C A;  4UD4 A;  3HW8 A;  5AO3 A;  1VQR A;  4M9H A;  2VAN A;  4IQT A;  4M0A A;  7ICV A;  5J0X A;  5BOM A;  4PHD A;  4L1J B;  5J2C A;  4E7X A;  4Z6E A;  3RH6 A;  3RF0 A;  7ICT A;  4TO1 A;  4MZ7 A;  5TK7 A;  3TMB A;  7ICH A;  7ICL A;  3L9D A;  4PH5 A;  3JPQ A;  3RH5 A;  5J0Q A;  3KQ5 A;  4Q2C A;  7ICN A;  4QZA A;  4XRH A;  2PFN A;  2HEK A;  3JPS A;  3JYY A;  2ZH7 A;  1HUO A;  5CJ7 A;  4RXQ A;  1BPD A;  4L7E A;  4P4O A;  8ICJ A;  4LZD A;  4I2D A;  5HRE A;  5EOZ A;  1TFW A;  3RJF A;  5IIK A;  5HC9 A;  3HWT A;  3MEM A;  5DKW A;  4ME4 A;  4RT3 A;  4RT2 A;  4LVS A;  3PML A;  2ZHB A;  3H3A A;  4RXO A;  3AUO A;  3OUY A;  3HIY A;  8ICY A;  3UXP A;  9ICX A;  4IG8 A;  3RJH A;  4L7W A;  4R66 A;  1YNB A;  1NO5 A;  3UXO A;  3WFS C;  4RXS A;  8ICR A;  9ICJ A;  4K4G A;  5HRK A;  4ZWG A;  3V7K A;  1ZQO A;  1R8B A;  1ZQK A;  5HRG A;  4X4T A;  4TNY A;  3RJJ A;  1ZQS A;  4FHX A;  5TK8 A;  3ISB A;  4JWM A;  3WFQ E;  5J2A A;  4KLI A;  4F5P A;  2ZH9 A;  9ICG A;  4PGY A;  1UEV A;  4I2E A;  4DOA A;  4EBK A;  1ZQP A;  2PXI A;  9ICH A;  4N71 A;  4NM2 A;  2NRK A;  4I2I A;  4TO6 A;  3UPQ A;  4NM1 A;  3RJK A;  3B0Y A;  4XDS A;  9ICU A;  1BPZ A;  3H37 A;  3JZ0 A;  3GW7 A;  2ZH4 A;  3TFS A;  8ICM A;  2BCV A;  3V7J A;  5CR0 A;  4YMO A;  1XSN A;  7ICE A;  1XX7 A;  2ISO A;  2DRA A;  1XSP A;  4TO0 A;  4RQ2 A;  3JPP A;  1ZQH A;  4KLO A;  5CA7 A;  4X4P A;  2Q14 A;  5J2G A;  3MBY A;  3OUY B;  4I2B A;  2DQB A;  5J2I A;  7ICQ A;  4KLE A;  3H39 A;  3V7L A;  4KLH A;  4P2H A;  5J2F A;  3JPR A;  1ZQI A;  4MFC A;  4XA5 A;  3TMD A;  2DVI A;  4JWN A;  4WC6 A;  4M47 A;  4N6W A;  4TUQ A;  8ICS A;  1JN3 A;  5DB7 A;  2BCU A;  3OVB A;  1ZQX A;  4X0B A;  1MIY A;  1YOY A;  1JAJ A;  4X0A A;  1KNY A;  1Q79 A;  4TO4 A;  2W9M A;  4M9J A;  4QFX A;  2RFF A;  3I7A A;  1TFY A;  4DO9 A;  4QG0 A;  3AQK A;  4I28 A;  2ZH8 A;  4BZB A;  4NKT A;  5TKA A;  2PBE A;  8ICZ A;  4MDZ A;  4RPZ A;  3HJ4 A;  5DEC A;  4RPY A;  9ICE A;  1VJ7 A;  4RWQ A;  4FHW A;  5III A;  3WFO A;  4R64 A;  3PMN A;  8ICI A;  1KDH A;  2GWS A;  5IIJ A;  2PFO A;  4Z6D A;  5J0U A;  8ICP A;  2PAR A;  9ICT A;  1ZQD A;  4QZG A;  5IIM A;  2O1P A;  1V4A A;  5DDY A;  8ICW A;  9ICR A;  4RQ0 A;  4TUP A;  4QZ8 A;  2FMQ A;  3HC1 A;  4TNP A;  4UB5 A;  1TVA A;  4AT8 A;  4NXZ A;  3HJ1 A;  1U6Z A;  4MF8 A;  3MGH A;  1JMS A;  4TO5 A;  4Z6C A;  5HHH A;  2M2T A;  2M2W A;  2I9G A;  8ICV A;  4UBB A;  3KH1 A;  4LT6 A;  4RQ7 A;  3PNC A;  9ICO A;  3C5F A;  4YD1 A;  1ZQM A;  1TV9 A;  5AO1 A;  3B0X A;  4NLK A;  4RXP A;  3NR1 A;  4RQ8 A;  3C66 A;  1R89 A;  1ZQC A;  4IQU A;  4R8Z A;  4X9E A;  5HRB A;  3TFR A;  1ZQG A;  2FMP A;  4YD2 A;  5AO0 A;  2BCQ A;  1MIV A;  4K4I A;  4YMM A;  1KEJ A;  4E80 A;  1ZJN A;  4M9G A;  3BG2 A;  4WC0 A;  4TNZ A;  1ZQV A;  3AQN A;  1FA0 A;  3MDC A;  1HUZ A;  4X4O A;  4KLQ A;  4KLT A;  4PPX A;  4RQ4 A;  5DED A;  4QQX A;  8ICU A;  8ICF A;  8ICG A;  1UET A;  4RQ5 A;  5J0S A;  3ISC A;  4X4V A;  9ICP A;  5J2J A;  2ZH6 A;  5IIN A;  3SK9 A;  5HHI A;  4KLF A;  4EBJ A;  4R63 A;  9ICL A;  4MFA A;  4PHE A;  4AT8 B;  1NOM A;  3RH4 A;  1ZQF A;  4FH5 A;  8ICO A;  4IQV A;  4RQ1 A;  4M5D A;  1VFG A;  1ZQT A;  1MIW A;  4NKU A;  2ZH5 A;  9ICQ A;  1OU5 A;  5J2H A;  4PGX A;  5J0P A;  8ICX A;  2FMS A;  4QZD A;  4WCW A;  4GXJ A;  4FO6 A;  4FHP A;  4QZH A;  2HHP A;  4TO2 A;  4KLM A;  4KLS A;  3JPO A;  3OGU A;  8ICE A;  3OVA A;  4MLM A;  5AO4 A;  5D46 A;  3JPN A;  4WC7 A;  5J0O A;  4QFZ A;  2ZHA A;  2PFQ A;  4MF2 A;  3HI0 A;  4QG1 A;  4QFY A;  7ICR A;  3CCG A;  3NYB A;  3HX0 A;  2DR8 A;  4UAY A;  4NLN A;  8ICK A;  5HRD A;  3S4L A;  4M9N A;  1R8C A;  1ZQL A;  1BPY A;  2M2U A;  9ICI A;  5CP2 A;  1MQ2 A;  2ZH2 A;  4AT7 A;  4GXK A;  3IRH A;  5DDM A;  4M9L A;  3C18 A;  2BPG A;  2OGI A;  5F2V O;  1ZQZ A;  4WC1 A;  4X4R A;  7ICU A;  2GZ4 A;  2IHM A;  4F5Q A;  4XQ8 A;  1ZJM A;  5DBC A;  5J2D A;  5J0R A;  2CQZ A;  2PAU A;  5DB8 A;  5J0T A;  3MGI A;  7ICG A;  3TMC A;  4P4P A;  3JPT A;  2DR5 A;  2ZH1 A;  4QQW A;  5IIO A;  2O08 A;  4UB2 A;  9ICF A;  3UPS A;  8ICN A;  3OVS A;  1RPL A;  4QG2 A;  4AT9 A;  4NLZ A;  1XSL A;  7ICI A;  3MDA A;  4F5O A;  3WFP A;  3ISD A;  4I27 A;  4X4Q A;  1WOT A;  1ZQE A;  5DBB A;  3K75 D;  3H38 A;  4UAW A;  4P4M A;  5IIL A;  2M2V A;  5HR9 A;  1RZT A;  3LJX A;  3M1T A;  3RJE A;  2BCR A;  2BPF A;  7ICO A;  5HRF A;  4RPX A;  1ZQW A;  3GDX A;  3C5G A;  4I2G A;  4WC2 A;  1ZQU A;  1BPB A;  1BPX A;  7ICF A;  5DB6 A;  4AT7 B;  7ICP A;  4I2A A;  3AU6 A;  4TNQ A;  7ICJ A;  1Q78 A;  4QG4 A;  5DB9 A;  3NQW A;  3AU2 A;  3MZO A;  1R8A A;  5J2K A;  9ICA A;  4DMB A;  2BPC A;  4MFF A;  2FLO A;  4O5E A;  4KLD A;  4ATB A;  4QZC A;  5TK9 A;  4RXR A;  3P3Q A;  4I29 A;  4Q2D A;  9ICW A;  4XUS A;  1PX5 A;  4AT9 B;  4GXI A;  4RWP A;  4I2F A;  4TO3 A;  8ICB A;  4O9M A;  3UQ2 A;  4LZG A;  1ZQJ A;  4KLL A;  4FHV A;  3RJI A;  2ZH3 A;  4MLN A;  5HRL A;  8ICQ A;  3OV7 A;  8ICH A;  5HRH A;  4NY8 A;  7ICM A;  9ICB A;  8ICL A;  4EP7 A;  4X4S A;  3WFR E;  3C2L A;  3C2M A;  4WC4 A;  8ICA A;  4E8F A;  4PHP A;  5CB1 A;  7ICK A;  4UD5 A;  4QZE A;  3RJG A;  4KLJ A;  9ICN A;  4RQ6 A;  4UAZ A;  2PQ7 A;  4QZI A;  3LK9 A;  3U1N A;  4F5N A;  4WC3 A;  9ICM A;  4KLU A;  3AQL A;  4UB4 A;  4I2J A;  2DR9 A;  1BPE A;  2BE3 A;  5J2B A;  4ATB B;  9ICC A;  2O6I A;  5D49 A;  1MQ3 A;  4TNR A;  1ZQA A;  4K4H A;  3UXN A;  2BCS A;  4DOB A;  4RWN A;  2PGS A;  5CWR A;  4MCW A;  4IQW A;  4TUR A;  3UQ0 A;  5D4B A;  7ICS A;  4KLG A;  5CHG A;  4TUS A;  4X4N A;  9ICS A;  4X5V A;  1UEU A;  4UB3 A;  3C2K A;  4DOC A;  5J0W A;  4FHY A;  2PFP A;  8ICC A;  4WBY A;  2DR7 A;  4O5K A;  4L1J A;  3SKD A;  4S3N A;  4Z6F A;  5BPC A;  2Q66 A;  4WBZ A;  1JQR A;  4PGQ A;  1ZQB A;  4O5C A;  1ZQQ A;  4X4U A;  1F5A A;  4UBC A;  4RWO A;  4ZWE A;  1ZQN A;  4M2Y A;  4XQ7 A;  1ZQR A;  3LQC B;  2ID1 A;  5TZV A;  5HRI A;  5J0Y A;  4M04 A;  9ICK A;  4RQ3 A;  2ISP A;  1YLQ A;  2O5A A;  4Q7H A;  4TNX A;  4QQZ A;  4YMN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...