1VJ7A

Crystal structure of the bifunctional catalytic fragment of relseq, the rela/spot homolog from streptococcus equisimilis.
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
367
structure length
326
Chain Sequence
b'INLTGEEVVALAAKYMNETDAAFVKKALDYATAAHFYQVRKSGEPYIVHPIQVAGILADLHLDAVTVACGFLHDVVEDTDITLDNIEFDFGKDVRDIVDGVTKLGHRKMLMAMSKDIRVILVKLADRLHNMRTLKQERISRETMEIYAPLAHRLGISRIKWELEDLAFRYLNETEFYKISHMMNEKRREREALVDDIVTKIKSYTTEQGLFGDVYGRPKHIYSIYRKMRDKKKRFDQIFDLIAIRCVMETQSDVYAMVGYIHELWRPMPGRFKDYIAAPKANGYQSIHTTVYGPKGPIEIQIRTKEMHQVAEYGVAANWIKELVEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bifunctional RELA/SPOT
publication title Conformational antagonism between opposing active sites in a bifunctional RelA/SpoT homolog modulates (p)ppGpp metabolism during the stringent response.
pubmed doi rcsb
source organism Streptococcus dysgalactiae subsp. equisimilis
molecule tags Hydrolase, transferase
total genus 119
structure length 326
sequence length 367
chains with identical sequence B
ec nomenclature ec 2.7.6.5: GTP diphosphokinase.
pdb deposition date 2004-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01966 HD HD domain
A PF04607 RelA_SpoT Region found in RelA / SpoT proteins
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3210.10 Mainly Alpha Orthogonal Bundle Hypothetical protein af1432 Hypothetical protein af1432 1vj7A01
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 1vj7A02
5HRGA 4Z6DA 4KLOA 4YMNA 5IIJA 3HW8A 4NM2A 9ICHA 4RQ0A 1ZQHA 3C18A 4S3NA 8ICBA 4K4IA 4TNPA 1MQ3A 1ZQLA 2O6IA 3V72A 1XSPA 5CR0A 2DRAA 9ICJA 4EP7A 1ZJMA 7ICNA 3AQMA 3P3QA 4QZGA 5TKAA 3LK9A 1ZQPA 4AT9A 2DR7A 4QZDA 4FHWA 8ICHA 4PHAA 5AO0A 2IHMA 1KDHA 2ZH4A 4X5VA 1ZQQA 4XA5A 3H39A 5AO1A 3UQ2A 1BPZA 4FHVA 4N71A 1NOMA 4FH3A 1ZQGA 4MFCA 1XSNA 4EBKA 5HRIA 5J2IA 1TVAA 1ZQEA 5AO2A 7ICMA 2HEKA 3RJFA 2PXIA 5DB9A 3H3AA 7ICKA 3K75D 4ATBA 3B0XA 4TUPA 4GXJA 8ICPA 4RT2A 4QZFA 4BZBA 4R64A 4RT3A 4I2GA 5IIMA 2ZHAA 4K4GA 1MIVA 3HC1A 3HJ1A 1R8BA 9ICVA 4PHDA 4IQVA 1MQ2A 3JZ0A 2ZH5A 3TFRA 5HHIA 4TUSA 3LJXA 2PGSA 1ZQOA 4ZWEA 5CA7A 1BPEA 4TO1A 5J2FA 5DB6A 2DRBA 2I9GA 4ZWGA 4MF8A 5IIIA 4UB5A 4NM1A 4M9NA 9ICIA 4RXPA 5HHHA 4FHPA 3CCGA 3UXNA 4TO4A 3AU2A 4UAWA 2BPGA 2DR9A 5J0RA 1WOTA 4UBBA 1ZQMA 8ICUA 2HHPA 3PNCA 9ICRA 4RPYA 5TK9A 3C5GA 4KLDA 2ZH9A 4UD4A 1UEVA 4RQ4A 4KLGA 4QG0A 1ZQWA 4UB2A 3NYBA 4M9JA 2FLOA 4X4QA 4I2HA 4RXSA 4R66A 4IG8A 9ICTA 4RPZA 3HJ4A 3PMLA 1V4AA 3PMNA 3RJIA 4DOCA 3AU6A 4PGXA 3RJEA 2ZH7A 4AT7B 4RPXA 1ZQAA 2PFQA 9ICFA 5J2GA 8ICZA 7ICQA 1ZQRA 5DBBA 4WC3A 2NRKA 2ZH2A 4PHEA 1PX5A 4X4VA 4UAZA 4DO9A 3H37A 3U1NA 5J0WA 3JPSA 5CB1A 4N6WA 5J29A 4X0AA 3C2MA 2FMSA 1VQRA 2CQZA 4QZEA 2O5AA 5F2VO 5HRKA 4E7XA 4YN4A 5D49A 3TM8A 3BG2A 5TZVA 7ICPA 1ZQVA 8ICEA 4I29A 8ICYA 4MFFA 4M2YA 5HRBA 1NO5A 3MGHA 3WFOA 3HI0A 3I7AA 4RWPA 2PFOA 1ZQXA 1RPLA 2PARA 4F5PA 9ICCA 3L9DA 7ICFA 4R8ZA 1F5AA 1BPDA 8ICKA 1XSLA 4YMMA 5DB7A 1JN3A 4LZGA 4WC6A 3JPNA 4MCWA 4QZBA 4RWQA 4X4OA 8ICNA 5DDMA 4L1JB 4MLMA 3MDCA 2M2TA 5D4BA 3AUOA 5J0OA 2W9MA 1OU5A 3C5FA 4LT6A 3UPQA 3RJKA 4M9GA 1RZTA 4WC2A 9ICNA 1JAJA 1ZQSA 4KLLA 2M2UA 4WC1A 4UB1A 5AO3A 4JWMA 7ICSA 4DOBA 2ISOA 4I2FA 8ICMA 5TK7A 5J0XA 2FMPA 4WC7A 9ICWA 3V7KA 9ICKA 2VANA 1ZQTA 4I2JA 1R8CA 3JPTA 1ZQUA 4AT9B 2BCRA 4FH5A 7ICRA 4ME4A 3ISBA 9ICLA 4NY8A 4I2IA 4WC0A 4M47A 5J2CA 4R63A 5J0PA 4TO2A 4FHXA 3JPOA 4RQ3A 8ICJA 4TUQA 2O08A 4YMOA 4UB4A 4LVSA 2BPCA 4X4PA 2PBEA 4WBYA 3B0YA 4EBJA 2ISPA 4F5OA 9ICPA 4Z6FA 3HX0A 7ICTA 3RJGA 3RH4A 4QFYA 5DDYA 1ZQBA 5IILA 5HRDA 8ICGA 4TNQA 5CWRA 5J2BA 4UBCA 3GDXA 1HUOA 4I2BA 5CJ7A 4X4NA 8ICLA 4Z6CA 4P4OA 5HRLA 1VJ7A 4KLTA 2M2WA 3TMCA 4FHYA 3NQWA 3RH5A 4X4UA 4RXRA 8ICSA 7ICLA 5J2HA 4I2CA 4IQUA 4L7EA 4QZ8A 3MDAA 3WFQE 7ICGA 4TO3A 5EOZA 4Q7HA 3C2KA 2RFFA 4RQ8A 5DKWA 4AT7A 3OUYB 3HIYA 4WBZA 5HR9A 3JPQA 4AT8B 4X4RA 1TV9A 1KNYA 3OVBA 3JPRA 4KLFA 2BCUA 4F5QA 4QFZA 8ICTA 3MEMA 4QG1A 4I28A 1MIYA 2FMQA 4I2AA 9ICMA 8ICCA 3C66A 9ICXA 5TK8A 3UQ0A 4UAYA 2Q66A 4TNRA 4O5CA 1ZQNA 1YNBA 2ZH6A 4LZDA 5HRHA 1YLQA 4RWOA 2BPFA 3JYYA 4WC4A 8ICVA 1JMSA 4E80A 3TMBA 4M9LA 3JPPA 4TURA 4O5EA 4NLKA 4KLUA 7ICHA 4KLIA 4KLHA 2ZH8A 2DR8A 3C2LA 4YD1A 4NXZA 5D46A 4QZHA 2Q14A 1TFYA 4KLMA 5BOLA 4L1JA 5J2DA 4BZCA 4K4HA 4QG2A 3LQCB 4IQTA 4IQWA 4R65A 3TFSA 4X9EA 5CP2A 4X4SA 5HC9A 3IRHA 4KLEA 4XQ7A 3UXPA 4F5RA 3OVSA 3RF0A 5IINA 4QFXA 7ICOA 3ISDA 9ICGA 4RXQA 4XUSA 4X0BA 1ZQZA 3V7JA 5J2KA 8ICOA 4TNZA 4WC5A 7ICJA 1FA0A 3HWTA 4O9MA 1UETA 5DB8A 3WFPA 5HRFA 4M04A 4L7WA 4NKTA 4NLZA 4MF2A 3MZOA 4I2DA 9ICAA 3AQNA 4I27A 3MGIA 1YOYA 2GWSA 4KLQA 5DBCA 4NLNA 1ZQFA 4MDZA 3RJHA 2ZH1A 4MZ7A 5DBAA 4M5DA 3H38A 3AQLA 1BPYA 4PPXA 4RWNA 9ICUA 9ICBA 2ZHBA 4QZ9A 2BE3A 4QZIA 1ZJNA 1ZQDA 1UEUA 4TO5A 2ID1A 2BCSA 8ICWA 1MIWA 3M1TA 3OVAA 8ICAA 4P4MA 1R8AA 9ICQA 4YCXA 4M9HA 3WFSC 2OGIA 3TMDA 4DOAA 4GXKA 1U6ZA 4PH5A 3ISCA 4QG4A 1BPXA 4XRHA 4WCWA 3UPSA 4Z6EA 4NKUA 2PAUA 1ZQIA 5J0UA 4ATBB 2DVIA 4DMBA 3OUYA 4AT8A 2PFPA 3V7LA 5J2EA 2ZH3A 8ICRA 4I2EA 1BPBA 4TO0A 2O1PA 4KLSA 1R89A 5J0TA 5J2JA 4M0AA 9ICSA 1ZQCA 8ICXA 2PAQA 5TK6A 3NR1A 4XDSA 4F5NA 2BCQA 8ICFA 7ICIA 4TNXA 4MLNA 4RQ2A 4X4TA 5AO4A 1HUZA 4XQ8A 4P2HA 1Q79A 4RXOA 4UD5A 4QZCA 7ICVA 5BPCA 1XX7A 2BCVA 4O5KA 4JWNA 7ICEA 3KH1A 5BOMA 4TO6A 4RQ6A 4GXIA 4MFAA 8ICQA 5J2AA 5J0QA 4P4PA 4QZAA 3RJJA 5HREA 3RH6A 4PGQA 1ZQKA 4PHPA 4KLJA 2DQBA 1Q78A 5IIKA 4RQ1A 5IIOA 7ICUA 4FO6A 1KEJA 1ZQYA 2GZ4A 4LRLA 5DECA 5J0SA 2P66A 3OV7A 1VFGA 3WFRE 9ICOA 3UXOA 4PGYA 1TFWA 2PQ7A 8ICIA 5J0YA 3OGUA 4RQ5A 1JQRA 4TNYA 4E8FA 1ZQJA 9ICEA 4UB3A 2M2VA 2DR5A 5DEDA 4RQ7A 3AQKA 4YD2A 5CHGA 3MBYA 2PFNA
chains in the Genus database with same CATH superfamily
5CFSA 5HRGA 4Z6DA 4KLOA 4YMNA 5IIJA 3HW8A 4NM2A 9ICHA 4RQ0A 1ZQHA 3C18A 4S3NA 8ICBA 4K4IA 4TNPA 1MQ3A 1ZQLA 2O6IA 3V72A 1XSPA 5CR0A 2DRAA 9ICJA 4EP7A 1ZJMA 7ICNA 3AQMA 3P3QA 4QZGA 5TKAA 3LK9A 1ZQPA 4AT9A 2DR7A 4QZDA 3NKUA 2B56A 4FHWA 4N7RA 5D61A 8ICHA 4PHAA 5AO0A 3ERCC 2IHMA 1KDHA 2ZH4A 4X5VA 1ZQQA 4LEWA 4XA5A 3H39A 5AO1A 3UQ2A 1BPZA 4FHVA 4N71A 1NOMA 4KM5A 4FH3A 1ZQGA 4MFCA 1XSNA 4EBKA 5HRIA 5J2IA 1TVAA 1ZQEA 5AO2A 7ICMA 2HEKA 3RJFA 2PXIA 5DB9A 3H3AA 7ICKA 4WOYA 3K75D 4ATBA 3B0XA 4TUPA 4GXJA 8ICPA 4RT2A 4QZFA 4MKPA 4BZBA 4R64A 2HN1A 4RT3A 5IIMA 4I2GA 2ZHAA 4K4GA 1MIVA 3HC1A 3HJ1A 1R8BA 4OAGA 4QQWA 4HX0A 9ICVA 4PHDA 4IQVA 2B51A 1MQ2A 3JZ0A 3EF2A 2ZH5A 3TFRA 5HHIA 4TUSA 3LJXA 2PGSA 1ZQOA 4OAIZ 4EV6A 4ZWEA 5CA7A 1BPEA 4TO1A 5J2FA 5DB6A 2DRBA 2I9GA 4ZWGA 4O67A 4MF8A 2BBJA 4EEBA 5IIIA 4UB5A 4NM1A 4M9NA 9ICIA 4RXPA 5HHHA 4I0UA 4FHPA 3CCGA 3UXNA 4TO4A 3AU2A 4UAWA 2BPGA 2DR9A 5J0RA 1WOTA 4UBBA 1ZQMA 8ICUA 2HHPA 3PNCA 9ICRA 4KB6A 4RPYA 5TK9A 3C5GA 4KLDA 2ZH9A 4UD4A 1UEVA 4RQ4A 4KLGA 4QG0A 1ZQWA 4UB2A 3NYBA 4M9JA 2FLOA 4X4QA 4I2HA 4RXSA 4R66A 4IG8A 9ICTA 4RPZA 3HJ4A 3PMLA 4O69A 1V4AA 4OAHA 3PMNA 3RJIA 4DOCA 3AU6A 4PGXA 3RJEA 2ZH7A 2HN2A 4AT7B 4RPXA 1ZQAA 2GA9D 2PFQA 9ICFA 5J2GA 8ICZA 7ICQA 1ZQRA 5DBBA 4WC3A 2NRKA 4O68A 2ZH2A 4PHEA 1PX5A 3NWIA 4X4VA 3JCFA 4UAZA 4DO9A 3H37A 5CHEA 3U1NA 4FO1A 5J0WA 3JPSA 5CB1A 4N6WA 5J29A 4X0AA 3C2MA 2FMSA 2BBHA 3CK6A 1VQRA 2CQZA 4QZEA 2O5AA 5F2VO 5HRKA 4E7XA 4YN4A 5D49A 3TM8A 3BG2A 5TZVA 7ICPA 1ZQVA 4K98A 4I29A 8ICEA 8ICYA 4MFFA 4M2YA 5HRBA 2IHOA 1NO5A 3MGHA 3OWGA 3WFOA 3HI0A 3I7AA 3SKDA 4RWPA 2PFOA 1ZQXA 1RPLA 2PARA 4F5PA 9ICCA 3L9DA 7ICFA 4R8ZA 1F5AA 1BPDA 8ICKA 1XSLA 4YMMA 5DB7A 1JN3A 4LZGA 4WC6A 3K7DA 3JPNA 4MCWA 4QZBA 4RWQA 4X4OA 8ICNA 5DDMA 4L1JB 4MLMA 3MDCA 2M2TA 5D4BA 3AUOA 5J0OA 2W9MA 1OU5A 3C5FA 4LT6A 3UPQA 3RJKA 4M9GA 1RZTA 5B3PA 4WC2A 4XJEA 9ICNA 1JAJA 1ZQSA 4KLLA 2M2UA 4WC1A 4UB1A 5AO3A 4JWMA 7ICSA 4DOBA 2ISOA 4Q2CA 4I2FA 8ICMA 5TK7A 5J0XA 2FMPA 4WC7A 9ICWA 3V7KA 9ICKA 2VANA 5CFUA 1ZQTA 4I2JA 2B4VA 4LEYA 1R8CA 3JPTA 1ZQUA 4AT9B 2BCRA 4FH5A 7ICRA 4ME4A 3ISBA 9ICLA 4NY8A 4I2IA 4WC0A 4M47A 5J2CA 4R63A 5J0PA 4TO2A 4FHXA 4NXXA 4RQ3A 3JPOA 4TUQA 2O08A 4YMOA 4UB4A 4LVSA 8ICJA 2BPCA 4X4PA 2PBEA 4WBYA 3B0YA 4EBJA 2ISPA 4F5OA 9ICPA 4Z6FA 3HX0A 7ICTA 3RJGA 3RH4A 4QFYA 5DDYA 5CFTA 1ZQBA 5IILA 5HRDA 8ICGA 4TNQA 5CWRA 5J2BA 4UBCA 3GDXA 4QQXA 1HUOA 4I2BA 5CJ7A 4LEVA 4X4NA 8ICLA 4Z6CA 4P4OA 5HRLA 1VJ7A 4KLTA 2M2WA 3TMCA 4FHYA 3NQWA 3RH5A 4X4UA 4RXRA 8ICSA 4Q2DA 7ICLA 5J2HA 4I2CA 4IQUA 2EWRA 4L7EA 4QZ8A 4JLZA 3MDAA 3WFQE 7ICGA 4TO3A 5EOZA 4QQYA 4Q7HA 3KQ5A 3C2KA 2RFFA 4RQ8A 5DKWA 4K97A 4AT7A 3OUYB 3HIYA 4K9BA 4WBZA 5D62A 5HR9A 3JPQA 4AT8B 4X4RA 1TV9A 1KNYA 3OVBA 3JPRA 4KLFA 2BCUA 4F5QA 4QFZA 8ICTA 3MEMA 4QG1A 4I28A 1MIYA 2FMQA 4I2AA 9ICMA 8ICCA 3C66A 9ICXA 5TK8A 3UQ0A 4UAYA 2Q66A 4TNRA 4O5CA 1ZQNA 1YNBA 2ZH6A 4WQKA 4LZDA 5HRHA 1YLQA 4NXVA 4RWOA 2BPFA 3JYYA 4WC4A 8ICVA 1JMSA 4E80A 3TMBA 4LEZA 4M9LA 3JPPA 4TURA 4O5EA 4NXUA 4NLKA 4KLUA 7ICHA 4KLIA 4KLHA 2ZH8A 2DR8A 3C2LA 4YD1A 4NXZA 5D46A 4QZHA 2Q14A 1TFYA 4KLMA 5BOLA 4L1JA 5J2DA 4BZCA 4K4HA 4QG2A 3LQCB 4IQTA 4IQWA 4R65A 3TFSA 4X9EA 5CP2A 5JTGA 4X4SA 3IRHA 5HC9A 4KLEA 4XQ7A 3UXPA 4F5RA 3OVSA 3RF0A 5IINA 4QFXA 3ER8C 4JLXA 7ICOA 3ISDA 1GPJA 9ICGA 4K99A 4RXQA 4XUSA 4X0BA 1ZQZA 3V7JA 5J2KA 4WH5A 8ICOA 4TNZA 4WC5A 7ICJA 1FA0A 3HWTA 4O9MA 1UETA 5DB8A 3WFPA 5HRFA 4M04A 4L7WA 4NKTA 4NLZA 4MF2A 3MZOA 4I2DA 9ICAA 3AQNA 4I27A 3MGIA 1YOYA 2GWSA 4KLQA 5DBCA 4NLNA 1ZQFA 4MDZA 3RJHA 2ZH1A 4MZ7A 4O6AA 5DBAA 4M5DA 3H38A 3AQLA 1BPYA 4PPXA 2FCLA 4RWNA 4WQLA 9ICUA 9ICBA 2ZHBA 4QZ9A 2BE3A 4QZIA 1ZJNA 1ZQDA 1UEUA 4TO5A 4NXWA 2ID1A 2BCSA 8ICWA 1MIWA 3M1TA 3OVAA 8ICAA 4P4MA 1R8AA 4QQZA 9ICQA 4YCXA 4M9HA 3WFSC 2OGIA 3TMDA 4DOAA 4GXKA 1U6ZA 4PH5A 3ISCA 4OAFA 4QG4A 1BPXA 4XRHA 4WCWA 3UPSA 4Z6EA 4NKUA 2PAUA 1ZQIA 5J0UA 4ATBB 2DVIA 4DMBA 2GAFD 3OUYA 4AT8A 4K9AA 2PFPA 3V7LA 5J2EA 2ZH3A 8ICRA 4I2EA 1BPBA 4TO0A 2O1PA 4KLSA 1R89A 3GW7A 5J0TA 5J2JA 4M0AA 9ICSA 1ZQCA 8ICXA 2PAQA 5TK6A 3SK9A 3PHZA 4K8VA 3NR1A 4XDSA 4K96A 4F5NA 2BCQA 8ICFA 7ICIA 4TNXA 4MLNA 4RQ2A 4X4TA 5D63A 5AO4A 1HUZA 4NXTA 4XQ8A 4P2HA 1Q79A 4RXOA 4UD5A 4QZCA 7ICVA 5BPCA 1XX7A 2BCVA 4O5KA 4JWNA 7ICEA 3KH1A 5BOMA 5B3QA 4TO6A 4RQ6A 4GXIA 4MFAA 8ICQA 5J2AA 5J0QA 4P4PA 4QZAA 3RJJA 5HREA 3RH6A 4PGQA 1ZQKA 4PHPA 4KLJA 2DQBA 2IUBA 1Q78A 5IIKA 4RQ1A 5IIOA 7ICUA 4FO6A 1KEJA 1ZQYA 2GZ4A 4LRLA 5DECA 5J0SA 2P66A 3OV7A 1VFGA 3WFRE 9ICOA 3UXOA 4PGYA 1TFWA 2PQ7A 8ICIA 5J0YA 3S4LA 4EGWA 3OGUA 3MCRA 4RQ5A 1JQRA 3NVOA 4TNYA 3ER9B 4E8FA 4EEDA 1ZQJA 4UB3A 9ICEA 2M2VA 2DR5A 5DEDA 4RQ7A 3AQKA 4YD2A 5CHGA 3MBYA 2PFNA
chains in the Genus database with same CATH topology
5HRGA 4Z6DA 4KLOA 4YMNA 5IIJA 3HW8A 4NM2A 9ICHA 4RQ0A 1ZQHA 3C18A 4S3NA 8ICBA 4K4IA 4TNPA 1MQ3A 1ZQLA 2O6IA 3V72A 1XSPA 5CR0A 2DRAA 9ICJA 4EP7A 1ZJMA 7ICNA 3AQMA 3P3QA 4QZGA 5TKAA 3LK9A 1ZQPA 4AT9A 2DR7A 4QZDA 4FHWA 8ICHA 4PHAA 5AO0A 2IHMA 1KDHA 2ZH4A 4X5VA 1ZQQA 4XA5A 3H39A 5AO1A 3UQ2A 1BPZA 4FHVA 4N71A 1NOMA 4FH3A 1ZQGA 4MFCA 1XSNA 4EBKA 5HRIA 5J2IA 1TVAA 1ZQEA 5AO2A 7ICMA 2HEKA 3RJFA 2PXIA 5DB9A 3H3AA 7ICKA 3K75D 4ATBA 3B0XA 4TUPA 4GXJA 8ICPA 4RT2A 4QZFA 4BZBA 4R64A 4RT3A 4I2GA 5IIMA 2ZHAA 4K4GA 1MIVA 3HC1A 3HJ1A 1R8BA 4QQWA 9ICVA 4PHDA 4IQVA 1MQ2A 3JZ0A 2ZH5A 3TFRA 5HHIA 4TUSA 3LJXA 2PGSA 1ZQOA 4ZWEA 5CA7A 1BPEA 4TO1A 5J2FA 5DB6A 2DRBA 2I9GA 4ZWGA 4MF8A 5IIIA 4UB5A 4NM1A 4M9NA 9ICIA 4RXPA 5HHHA 4FHPA 3CCGA 3UXNA 4TO4A 3AU2A 4UAWA 2BPGA 2DR9A 5J0RA 1WOTA 4UBBA 1ZQMA 8ICUA 2HHPA 3PNCA 9ICRA 4RPYA 5TK9A 3C5GA 4KLDA 2ZH9A 4UD4A 1UEVA 4RQ4A 4KLGA 4QG0A 1ZQWA 4UB2A 3NYBA 4M9JA 2FLOA 4X4QA 4I2HA 4RXSA 4R66A 4IG8A 9ICTA 4RPZA 3HJ4A 3PMLA 1V4AA 3PMNA 3RJIA 4DOCA 3AU6A 4PGXA 3RJEA 2ZH7A 4AT7B 4RPXA 1ZQAA 2PFQA 9ICFA 5J2GA 8ICZA 7ICQA 1ZQRA 5DBBA 4WC3A 2NRKA 2ZH2A 4PHEA 1PX5A 4X4VA 4UAZA 4DO9A 3H37A 3U1NA 5J0WA 3JPSA 5CB1A 4N6WA 5J29A 4X0AA 3C2MA 2FMSA 1VQRA 2CQZA 4QZEA 2O5AA 5F2VO 5HRKA 4E7XA 4YN4A 5D49A 3TM8A 3BG2A 5TZVA 7ICPA 1ZQVA 8ICEA 4I29A 8ICYA 4MFFA 4M2YA 5HRBA 1NO5A 3MGHA 3WFOA 3HI0A 3I7AA 3SKDA 4RWPA 2PFOA 1ZQXA 1RPLA 2PARA 4F5PA 9ICCA 3L9DA 7ICFA 4R8ZA 1F5AA 1BPDA 8ICKA 1XSLA 4YMMA 5DB7A 1JN3A 4LZGA 4WC6A 3JPNA 4MCWA 4QZBA 4RWQA 4X4OA 8ICNA 5DDMA 4L1JB 4MLMA 3MDCA 2M2TA 5D4BA 3AUOA 5J0OA 2W9MA 1OU5A 3C5FA 4LT6A 3UPQA 3RJKA 4M9GA 1RZTA 4WC2A 9ICNA 1JAJA 1ZQSA 4KLLA 2M2UA 4WC1A 4UB1A 5AO3A 4JWMA 7ICSA 4DOBA 2ISOA 4Q2CA 4I2FA 8ICMA 5TK7A 5J0XA 2FMPA 4WC7A 9ICWA 3V7KA 9ICKA 2VANA 1ZQTA 4I2JA 1R8CA 3JPTA 1ZQUA 4AT9B 2BCRA 4FH5A 7ICRA 4ME4A 3ISBA 9ICLA 4NY8A 4I2IA 4WC0A 4M47A 5J2CA 4R63A 5J0PA 4TO2A 4FHXA 3JPOA 4RQ3A 8ICJA 4TUQA 2O08A 4YMOA 4UB4A 4LVSA 2BPCA 4X4PA 2PBEA 4WBYA 3B0YA 4EBJA 2ISPA 4F5OA 9ICPA 4Z6FA 3HX0A 7ICTA 3RJGA 3RH4A 4QFYA 5DDYA 1ZQBA 5IILA 5HRDA 8ICGA 4TNQA 5CWRA 5J2BA 4UBCA 3GDXA 4QQXA 1HUOA 4I2BA 5CJ7A 4X4NA 8ICLA 4Z6CA 4P4OA 5HRLA 1VJ7A 4KLTA 2M2WA 3TMCA 4FHYA 3NQWA 3RH5A 4X4UA 4RXRA 8ICSA 4Q2DA 7ICLA 5J2HA 4I2CA 4IQUA 4L7EA 4QZ8A 3MDAA 3WFQE 7ICGA 4TO3A 5EOZA 4QQYA 4Q7HA 3KQ5A 3C2KA 2RFFA 4RQ8A 5DKWA 4AT7A 3OUYB 3HIYA 4WBZA 5HR9A 3JPQA 4AT8B 4X4RA 1TV9A 1KNYA 3OVBA 3JPRA 4KLFA 2BCUA 4F5QA 4QFZA 8ICTA 3MEMA 4QG1A 4I28A 1MIYA 2FMQA 4I2AA 9ICMA 8ICCA 3C66A 9ICXA 5TK8A 3UQ0A 4UAYA 2Q66A 4TNRA 4O5CA 1ZQNA 1YNBA 2ZH6A 4LZDA 5HRHA 1YLQA 4RWOA 2BPFA 3JYYA 4WC4A 8ICVA 1JMSA 4E80A 3TMBA 4M9LA 3JPPA 4TURA 4O5EA 4NLKA 4KLUA 7ICHA 4KLIA 4KLHA 2ZH8A 2DR8A 3C2LA 4YD1A 4NXZA 5D46A 4QZHA 2Q14A 1TFYA 4KLMA 5BOLA 4L1JA 5J2DA 4BZCA 4K4HA 4QG2A 3LQCB 4IQTA 4IQWA 4R65A 3TFSA 4X9EA 5CP2A 4X4SA 5HC9A 3IRHA 4KLEA 4XQ7A 3UXPA 4F5RA 3OVSA 3RF0A 5IINA 4QFXA 7ICOA 3ISDA 9ICGA 4RXQA 4XUSA 4X0BA 1ZQZA 3V7JA 5J2KA 8ICOA 4TNZA 4WC5A 7ICJA 1FA0A 3HWTA 4O9MA 1UETA 5DB8A 3WFPA 5HRFA 4M04A 4L7WA 4NKTA 4NLZA 4MF2A 3MZOA 4I2DA 9ICAA 3AQNA 4I27A 3MGIA 1YOYA 2GWSA 4KLQA 5DBCA 4NLNA 1ZQFA 4MDZA 3RJHA 2ZH1A 4MZ7A 5DBAA 4M5DA 3H38A 3AQLA 1BPYA 4PPXA 4RWNA 9ICUA 9ICBA 2ZHBA 4QZ9A 2BE3A 4QZIA 1ZJNA 1ZQDA 1UEUA 4TO5A 2ID1A 2BCSA 8ICWA 1MIWA 3M1TA 3OVAA 8ICAA 4P4MA 1R8AA 4QQZA 9ICQA 4YCXA 4M9HA 3WFSC 2OGIA 3TMDA 4DOAA 4GXKA 1U6ZA 4PH5A 3ISCA 4QG4A 1BPXA 4XRHA 4WCWA 3UPSA 4Z6EA 4NKUA 2PAUA 1ZQIA 5J0UA 4ATBB 2DVIA 4DMBA 3OUYA 4AT8A 2PFPA 3V7LA 5J2EA 2ZH3A 8ICRA 4I2EA 1BPBA 4TO0A 2O1PA 4KLSA 1R89A 3GW7A 5J0TA 5J2JA 4M0AA 9ICSA 1ZQCA 8ICXA 2PAQA 5TK6A 3SK9A 3NR1A 4XDSA 4F5NA 2BCQA 8ICFA 7ICIA 4TNXA 4MLNA 4RQ2A 4X4TA 5AO4A 1HUZA 4XQ8A 4P2HA 1Q79A 4RXOA 4UD5A 4QZCA 7ICVA 5BPCA 1XX7A 2BCVA 4O5KA 4JWNA 7ICEA 3KH1A 5BOMA 4TO6A 4RQ6A 4GXIA 4MFAA 8ICQA 5J2AA 5J0QA 4P4PA 4QZAA 3RJJA 5HREA 3RH6A 4PGQA 1ZQKA 4PHPA 4KLJA 2DQBA 1Q78A 5IIKA 4RQ1A 5IIOA 7ICUA 4FO6A 1KEJA 1ZQYA 2GZ4A 4LRLA 5DECA 5J0SA 2P66A 3OV7A 1VFGA 3WFRE 9ICOA 3UXOA 4PGYA 1TFWA 2PQ7A 8ICIA 5J0YA 3S4LA 3OGUA 4RQ5A 1JQRA 4TNYA 4E8FA 1ZQJA 9ICEA 4UB3A 2M2VA 2DR5A 5DEDA 4RQ7A 3AQKA 4YD2A 5CHGA 3MBYA 2PFNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HRG A;  4Z6D A;  4KLO A;  4YMN A;  5IIJ A;  3HW8 A;  4NM2 A;  9ICH A;  4RQ0 A;  1ZQH A;  3C18 A;  4S3N A;  8ICB A;  4K4I A;  4TNP A;  1MQ3 A;  1ZQL A;  2O6I A;  3V72 A;  1XSP A;  5CR0 A;  2DRA A;  9ICJ A;  4EP7 A;  1ZJM A;  7ICN A;  3AQM A;  3P3Q A;  4QZG A;  5TKA A;  3LK9 A;  1ZQP A;  4AT9 A;  2DR7 A;  4QZD A;  4FHW A;  8ICH A;  4PHA A;  5AO0 A;  2IHM A;  1KDH A;  2ZH4 A;  4X5V A;  1ZQQ A;  4XA5 A;  3H39 A;  5AO1 A;  3UQ2 A;  1BPZ A;  4FHV A;  4N71 A;  1NOM A;  4FH3 A;  1ZQG A;  4MFC A;  1XSN A;  4EBK A;  5HRI A;  5J2I A;  1TVA A;  1ZQE A;  5AO2 A;  7ICM A;  2HEK A;  3RJF A;  2PXI A;  5DB9 A;  3H3A A;  7ICK A;  3K75 D;  4ATB A;  3B0X A;  4TUP A;  4GXJ A;  8ICP A;  4RT2 A;  4QZF A;  4BZB A;  4R64 A;  4RT3 A;  4I2G A;  5IIM A;  2ZHA A;  4K4G A;  1MIV A;  3HC1 A;  3HJ1 A;  1R8B A;  9ICV A;  4PHD A;  4IQV A;  1MQ2 A;  3JZ0 A;  2ZH5 A;  3TFR A;  5HHI A;  4TUS A;  3LJX A;  2PGS A;  1ZQO A;  4ZWE A;  5CA7 A;  1BPE A;  4TO1 A;  5J2F A;  5DB6 A;  2DRB A;  2I9G A;  4ZWG A;  4MF8 A;  5III A;  4UB5 A;  4NM1 A;  4M9N A;  9ICI A;  4RXP A;  5HHH A;  4FHP A;  3CCG A;  3UXN A;  4TO4 A;  3AU2 A;  4UAW A;  2BPG A;  2DR9 A;  5J0R A;  1WOT A;  4UBB A;  1ZQM A;  8ICU A;  2HHP A;  3PNC A;  9ICR A;  4RPY A;  5TK9 A;  3C5G A;  4KLD A;  2ZH9 A;  4UD4 A;  1UEV A;  4RQ4 A;  4KLG A;  4QG0 A;  1ZQW A;  4UB2 A;  3NYB A;  4M9J A;  2FLO A;  4X4Q A;  4I2H A;  4RXS A;  4R66 A;  4IG8 A;  9ICT A;  4RPZ A;  3HJ4 A;  3PML A;  1V4A A;  3PMN A;  3RJI A;  4DOC A;  3AU6 A;  4PGX A;  3RJE A;  2ZH7 A;  4AT7 B;  4RPX A;  1ZQA A;  2PFQ A;  9ICF A;  5J2G A;  8ICZ A;  7ICQ A;  1ZQR A;  5DBB A;  4WC3 A;  2NRK A;  2ZH2 A;  4PHE A;  1PX5 A;  4X4V A;  4UAZ A;  4DO9 A;  3H37 A;  3U1N A;  5J0W A;  3JPS A;  5CB1 A;  4N6W A;  5J29 A;  4X0A A;  3C2M A;  2FMS A;  1VQR A;  2CQZ A;  4QZE A;  2O5A A;  5F2V O;  5HRK A;  4E7X A;  4YN4 A;  5D49 A;  3TM8 A;  3BG2 A;  5TZV A;  7ICP A;  1ZQV A;  8ICE A;  4I29 A;  8ICY A;  4MFF A;  4M2Y A;  5HRB A;  1NO5 A;  3MGH A;  3WFO A;  3HI0 A;  3I7A A;  4RWP A;  2PFO A;  1ZQX A;  1RPL A;  2PAR A;  4F5P A;  9ICC A;  3L9D A;  7ICF A;  4R8Z A;  1F5A A;  1BPD A;  8ICK A;  1XSL A;  4YMM A;  5DB7 A;  1JN3 A;  4LZG A;  4WC6 A;  3JPN A;  4MCW A;  4QZB A;  4RWQ A;  4X4O A;  8ICN A;  5DDM A;  4L1J B;  4MLM A;  3MDC A;  2M2T A;  5D4B A;  3AUO A;  5J0O A;  2W9M A;  1OU5 A;  3C5F A;  4LT6 A;  3UPQ A;  3RJK A;  4M9G A;  1RZT A;  4WC2 A;  9ICN A;  1JAJ A;  1ZQS A;  4KLL A;  2M2U A;  4WC1 A;  4UB1 A;  5AO3 A;  4JWM A;  7ICS A;  4DOB A;  2ISO A;  4I2F A;  8ICM A;  5TK7 A;  5J0X A;  2FMP A;  4WC7 A;  9ICW A;  3V7K A;  9ICK A;  2VAN A;  1ZQT A;  4I2J A;  1R8C A;  3JPT A;  1ZQU A;  4AT9 B;  2BCR A;  4FH5 A;  7ICR A;  4ME4 A;  3ISB A;  9ICL A;  4NY8 A;  4I2I A;  4WC0 A;  4M47 A;  5J2C A;  4R63 A;  5J0P A;  4TO2 A;  4FHX A;  3JPO A;  4RQ3 A;  8ICJ A;  4TUQ A;  2O08 A;  4YMO A;  4UB4 A;  4LVS A;  2BPC A;  4X4P A;  2PBE A;  4WBY A;  3B0Y A;  4EBJ A;  2ISP A;  4F5O A;  9ICP A;  4Z6F A;  3HX0 A;  7ICT A;  3RJG A;  3RH4 A;  4QFY A;  5DDY A;  1ZQB A;  5IIL A;  5HRD A;  8ICG A;  4TNQ A;  5CWR A;  5J2B A;  4UBC A;  3GDX A;  1HUO A;  4I2B A;  5CJ7 A;  4X4N A;  8ICL A;  4Z6C A;  4P4O A;  5HRL A;  1VJ7 A;  4KLT A;  2M2W A;  3TMC A;  4FHY A;  3NQW A;  3RH5 A;  4X4U A;  4RXR A;  8ICS A;  7ICL A;  5J2H A;  4I2C A;  4IQU A;  4L7E A;  4QZ8 A;  3MDA A;  3WFQ E;  7ICG A;  4TO3 A;  5EOZ A;  4Q7H A;  3C2K A;  2RFF A;  4RQ8 A;  5DKW A;  4AT7 A;  3OUY B;  3HIY A;  4WBZ A;  5HR9 A;  3JPQ A;  4AT8 B;  4X4R A;  1TV9 A;  1KNY A;  3OVB A;  3JPR A;  4KLF A;  2BCU A;  4F5Q A;  4QFZ A;  8ICT A;  3MEM A;  4QG1 A;  4I28 A;  1MIY A;  2FMQ A;  4I2A A;  9ICM A;  8ICC A;  3C66 A;  9ICX A;  5TK8 A;  3UQ0 A;  4UAY A;  2Q66 A;  4TNR A;  4O5C A;  1ZQN A;  1YNB A;  2ZH6 A;  4LZD A;  5HRH A;  1YLQ A;  4RWO A;  2BPF A;  3JYY A;  4WC4 A;  8ICV A;  1JMS A;  4E80 A;  3TMB A;  4M9L A;  3JPP A;  4TUR A;  4O5E A;  4NLK A;  4KLU A;  7ICH A;  4KLI A;  4KLH A;  2ZH8 A;  2DR8 A;  3C2L A;  4YD1 A;  4NXZ A;  5D46 A;  4QZH A;  2Q14 A;  1TFY A;  4KLM A;  5BOL A;  4L1J A;  5J2D A;  4BZC A;  4K4H A;  4QG2 A;  3LQC B;  4IQT A;  4IQW A;  4R65 A;  3TFS A;  4X9E A;  5CP2 A;  4X4S A;  5HC9 A;  3IRH A;  4KLE A;  4XQ7 A;  3UXP A;  4F5R A;  3OVS A;  3RF0 A;  5IIN A;  4QFX A;  7ICO A;  3ISD A;  9ICG A;  4RXQ A;  4XUS A;  4X0B A;  1ZQZ A;  3V7J A;  5J2K A;  8ICO A;  4TNZ A;  4WC5 A;  7ICJ A;  1FA0 A;  3HWT A;  4O9M A;  1UET A;  5DB8 A;  3WFP A;  5HRF A;  4M04 A;  4L7W A;  4NKT A;  4NLZ A;  4MF2 A;  3MZO A;  4I2D A;  9ICA A;  3AQN A;  4I27 A;  3MGI A;  1YOY A;  2GWS A;  4KLQ A;  5DBC A;  4NLN A;  1ZQF A;  4MDZ A;  3RJH A;  2ZH1 A;  4MZ7 A;  5DBA A;  4M5D A;  3H38 A;  3AQL A;  1BPY A;  4PPX A;  4RWN A;  9ICU A;  9ICB A;  2ZHB A;  4QZ9 A;  2BE3 A;  4QZI A;  1ZJN A;  1ZQD A;  1UEU A;  4TO5 A;  2ID1 A;  2BCS A;  8ICW A;  1MIW A;  3M1T A;  3OVA A;  8ICA A;  4P4M A;  1R8A A;  9ICQ A;  4YCX A;  4M9H A;  3WFS C;  2OGI A;  3TMD A;  4DOA A;  4GXK A;  1U6Z A;  4PH5 A;  3ISC A;  4QG4 A;  1BPX A;  4XRH A;  4WCW A;  3UPS A;  4Z6E A;  4NKU A;  2PAU A;  1ZQI A;  5J0U A;  4ATB B;  2DVI A;  4DMB A;  3OUY A;  4AT8 A;  2PFP A;  3V7L A;  5J2E A;  2ZH3 A;  8ICR A;  4I2E A;  1BPB A;  4TO0 A;  2O1P A;  4KLS A;  1R89 A;  5J0T A;  5J2J A;  4M0A A;  9ICS A;  1ZQC A;  8ICX A;  2PAQ A;  5TK6 A;  3NR1 A;  4XDS A;  4F5N A;  2BCQ A;  8ICF A;  7ICI A;  4TNX A;  4MLN A;  4RQ2 A;  4X4T A;  5AO4 A;  1HUZ A;  4XQ8 A;  4P2H A;  1Q79 A;  4RXO A;  4UD5 A;  4QZC A;  7ICV A;  5BPC A;  1XX7 A;  2BCV A;  4O5K A;  4JWN A;  7ICE A;  3KH1 A;  5BOM A;  4TO6 A;  4RQ6 A;  4GXI A;  4MFA A;  8ICQ A;  5J2A A;  5J0Q A;  4P4P A;  4QZA A;  3RJJ A;  5HRE A;  3RH6 A;  4PGQ A;  1ZQK A;  4PHP A;  4KLJ A;  2DQB A;  1Q78 A;  5IIK A;  4RQ1 A;  5IIO A;  7ICU A;  4FO6 A;  1KEJ A;  1ZQY A;  2GZ4 A;  4LRL A;  5DEC A;  5J0S A;  2P66 A;  3OV7 A;  1VFG A;  3WFR E;  9ICO A;  3UXO A;  4PGY A;  1TFW A;  2PQ7 A;  8ICI A;  5J0Y A;  3OGU A;  4RQ5 A;  1JQR A;  4TNY A;  4E8F A;  1ZQJ A;  9ICE A;  4UB3 A;  2M2V A;  2DR5 A;  5DED A;  4RQ7 A;  3AQK A;  4YD2 A;  5CHG A;  3MBY A;  2PFN A; 
#chains in the Genus database with same CATH topology
 5CFS A;  5HRG A;  4Z6D A;  4KLO A;  4YMN A;  5IIJ A;  3HW8 A;  4NM2 A;  9ICH A;  4RQ0 A;  1ZQH A;  3C18 A;  4S3N A;  8ICB A;  4K4I A;  4TNP A;  1MQ3 A;  1ZQL A;  2O6I A;  3V72 A;  1XSP A;  5CR0 A;  2DRA A;  9ICJ A;  4EP7 A;  1ZJM A;  7ICN A;  3AQM A;  3P3Q A;  4QZG A;  5TKA A;  3LK9 A;  1ZQP A;  4AT9 A;  2DR7 A;  4QZD A;  3NKU A;  2B56 A;  4FHW A;  4N7R A;  5D61 A;  8ICH A;  4PHA A;  5AO0 A;  3ERC C;  2IHM A;  1KDH A;  2ZH4 A;  4X5V A;  1ZQQ A;  4LEW A;  4XA5 A;  3H39 A;  5AO1 A;  3UQ2 A;  1BPZ A;  4FHV A;  4N71 A;  1NOM A;  4KM5 A;  4FH3 A;  1ZQG A;  4MFC A;  1XSN A;  4EBK A;  5HRI A;  5J2I A;  1TVA A;  1ZQE A;  5AO2 A;  7ICM A;  2HEK A;  3RJF A;  2PXI A;  5DB9 A;  3H3A A;  7ICK A;  4WOY A;  3K75 D;  4ATB A;  3B0X A;  4TUP A;  4GXJ A;  8ICP A;  4RT2 A;  4QZF A;  4MKP A;  4BZB A;  4R64 A;  2HN1 A;  4RT3 A;  5IIM A;  4I2G A;  2ZHA A;  4K4G A;  1MIV A;  3HC1 A;  3HJ1 A;  1R8B A;  4OAG A;  4QQW A;  4HX0 A;  9ICV A;  4PHD A;  4IQV A;  2B51 A;  1MQ2 A;  3JZ0 A;  3EF2 A;  2ZH5 A;  3TFR A;  5HHI A;  4TUS A;  3LJX A;  2PGS A;  1ZQO A;  4OAI Z;  4EV6 A;  4ZWE A;  5CA7 A;  1BPE A;  4TO1 A;  5J2F A;  5DB6 A;  2DRB A;  2I9G A;  4ZWG A;  4O67 A;  4MF8 A;  2BBJ A;  4EEB A;  5III A;  4UB5 A;  4NM1 A;  4M9N A;  9ICI A;  4RXP A;  5HHH A;  4I0U A;  4FHP A;  3CCG A;  3UXN A;  4TO4 A;  3AU2 A;  4UAW A;  2BPG A;  2DR9 A;  5J0R A;  1WOT A;  4UBB A;  1ZQM A;  8ICU A;  2HHP A;  3PNC A;  9ICR A;  4KB6 A;  4RPY A;  5TK9 A;  3C5G A;  4KLD A;  2ZH9 A;  4UD4 A;  1UEV A;  4RQ4 A;  4KLG A;  4QG0 A;  1ZQW A;  4UB2 A;  3NYB A;  4M9J A;  2FLO A;  4X4Q A;  4I2H A;  4RXS A;  4R66 A;  4IG8 A;  9ICT A;  4RPZ A;  3HJ4 A;  3PML A;  4O69 A;  1V4A A;  4OAH A;  3PMN A;  3RJI A;  4DOC A;  3AU6 A;  4PGX A;  3RJE A;  2ZH7 A;  2HN2 A;  4AT7 B;  4RPX A;  1ZQA A;  2GA9 D;  2PFQ A;  9ICF A;  5J2G A;  8ICZ A;  7ICQ A;  1ZQR A;  5DBB A;  4WC3 A;  2NRK A;  4O68 A;  2ZH2 A;  4PHE A;  1PX5 A;  3NWI A;  4X4V A;  3JCF A;  4UAZ A;  4DO9 A;  3H37 A;  5CHE A;  3U1N A;  4FO1 A;  5J0W A;  3JPS A;  5CB1 A;  4N6W A;  5J29 A;  4X0A A;  3C2M A;  2FMS A;  2BBH A;  3CK6 A;  1VQR A;  2CQZ A;  4QZE A;  2O5A A;  5F2V O;  5HRK A;  4E7X A;  4YN4 A;  5D49 A;  3TM8 A;  3BG2 A;  5TZV A;  7ICP A;  1ZQV A;  4K98 A;  4I29 A;  8ICE A;  8ICY A;  4MFF A;  4M2Y A;  5HRB A;  2IHO A;  1NO5 A;  3MGH A;  3OWG A;  3WFO A;  3HI0 A;  3I7A A;  3SKD A;  4RWP A;  2PFO A;  1ZQX A;  1RPL A;  2PAR A;  4F5P A;  9ICC A;  3L9D A;  7ICF A;  4R8Z A;  1F5A A;  1BPD A;  8ICK A;  1XSL A;  4YMM A;  5DB7 A;  1JN3 A;  4LZG A;  4WC6 A;  3K7D A;  3JPN A;  4MCW A;  4QZB A;  4RWQ A;  4X4O A;  8ICN A;  5DDM A;  4L1J B;  4MLM A;  3MDC A;  2M2T A;  5D4B A;  3AUO A;  5J0O A;  2W9M A;  1OU5 A;  3C5F A;  4LT6 A;  3UPQ A;  3RJK A;  4M9G A;  1RZT A;  5B3P A;  4WC2 A;  4XJE A;  9ICN A;  1JAJ A;  1ZQS A;  4KLL A;  2M2U A;  4WC1 A;  4UB1 A;  5AO3 A;  4JWM A;  7ICS A;  4DOB A;  2ISO A;  4Q2C A;  4I2F A;  8ICM A;  5TK7 A;  5J0X A;  2FMP A;  4WC7 A;  9ICW A;  3V7K A;  9ICK A;  2VAN A;  5CFU A;  1ZQT A;  4I2J A;  2B4V A;  4LEY A;  1R8C A;  3JPT A;  1ZQU A;  4AT9 B;  2BCR A;  4FH5 A;  7ICR A;  4ME4 A;  3ISB A;  9ICL A;  4NY8 A;  4I2I A;  4WC0 A;  4M47 A;  5J2C A;  4R63 A;  5J0P A;  4TO2 A;  4FHX A;  4NXX A;  4RQ3 A;  3JPO A;  4TUQ A;  2O08 A;  4YMO A;  4UB4 A;  4LVS A;  8ICJ A;  2BPC A;  4X4P A;  2PBE A;  4WBY A;  3B0Y A;  4EBJ A;  2ISP A;  4F5O A;  9ICP A;  4Z6F A;  3HX0 A;  7ICT A;  3RJG A;  3RH4 A;  4QFY A;  5DDY A;  5CFT A;  1ZQB A;  5IIL A;  5HRD A;  8ICG A;  4TNQ A;  5CWR A;  5J2B A;  4UBC A;  3GDX A;  4QQX A;  1HUO A;  4I2B A;  5CJ7 A;  4LEV A;  4X4N A;  8ICL A;  4Z6C A;  4P4O A;  5HRL A;  1VJ7 A;  4KLT A;  2M2W A;  3TMC A;  4FHY A;  3NQW A;  3RH5 A;  4X4U A;  4RXR A;  8ICS A;  4Q2D A;  7ICL A;  5J2H A;  4I2C A;  4IQU A;  2EWR A;  4L7E A;  4QZ8 A;  4JLZ A;  3MDA A;  3WFQ E;  7ICG A;  4TO3 A;  5EOZ A;  4QQY A;  4Q7H A;  3KQ5 A;  3C2K A;  2RFF A;  4RQ8 A;  5DKW A;  4K97 A;  4AT7 A;  3OUY B;  3HIY A;  4K9B A;  4WBZ A;  5D62 A;  5HR9 A;  3JPQ A;  4AT8 B;  4X4R A;  1TV9 A;  1KNY A;  3OVB A;  3JPR A;  4KLF A;  2BCU A;  4F5Q A;  4QFZ A;  8ICT A;  3MEM A;  4QG1 A;  4I28 A;  1MIY A;  2FMQ A;  4I2A A;  9ICM A;  8ICC A;  3C66 A;  9ICX A;  5TK8 A;  3UQ0 A;  4UAY A;  2Q66 A;  4TNR A;  4O5C A;  1ZQN A;  1YNB A;  2ZH6 A;  4WQK A;  4LZD A;  5HRH A;  1YLQ A;  4NXV A;  4RWO A;  2BPF A;  3JYY A;  4WC4 A;  8ICV A;  1JMS A;  4E80 A;  3TMB A;  4LEZ A;  4M9L A;  3JPP A;  4TUR A;  4O5E A;  4NXU A;  4NLK A;  4KLU A;  7ICH A;  4KLI A;  4KLH A;  2ZH8 A;  2DR8 A;  3C2L A;  4YD1 A;  4NXZ A;  5D46 A;  4QZH A;  2Q14 A;  1TFY A;  4KLM A;  5BOL A;  4L1J A;  5J2D A;  4BZC A;  4K4H A;  4QG2 A;  3LQC B;  4IQT A;  4IQW A;  4R65 A;  3TFS A;  4X9E A;  5CP2 A;  5JTG A;  4X4S A;  3IRH A;  5HC9 A;  4KLE A;  4XQ7 A;  3UXP A;  4F5R A;  3OVS A;  3RF0 A;  5IIN A;  4QFX A;  3ER8 C;  4JLX A;  7ICO A;  3ISD A;  1GPJ A;  9ICG A;  4K99 A;  4RXQ A;  4XUS A;  4X0B A;  1ZQZ A;  3V7J A;  5J2K A;  4WH5 A;  8ICO A;  4TNZ A;  4WC5 A;  7ICJ A;  1FA0 A;  3HWT A;  4O9M A;  1UET A;  5DB8 A;  3WFP A;  5HRF A;  4M04 A;  4L7W A;  4NKT A;  4NLZ A;  4MF2 A;  3MZO A;  4I2D A;  9ICA A;  3AQN A;  4I27 A;  3MGI A;  1YOY A;  2GWS A;  4KLQ A;  5DBC A;  4NLN A;  1ZQF A;  4MDZ A;  3RJH A;  2ZH1 A;  4MZ7 A;  4O6A A;  5DBA A;  4M5D A;  3H38 A;  3AQL A;  1BPY A;  4PPX A;  2FCL A;  4RWN A;  4WQL A;  9ICU A;  9ICB A;  2ZHB A;  4QZ9 A;  2BE3 A;  4QZI A;  1ZJN A;  1ZQD A;  1UEU A;  4TO5 A;  4NXW A;  2ID1 A;  2BCS A;  8ICW A;  1MIW A;  3M1T A;  3OVA A;  8ICA A;  4P4M A;  1R8A A;  4QQZ A;  9ICQ A;  4YCX A;  4M9H A;  3WFS C;  2OGI A;  3TMD A;  4DOA A;  4GXK A;  1U6Z A;  4PH5 A;  3ISC A;  4OAF A;  4QG4 A;  1BPX A;  4XRH A;  4WCW A;  3UPS A;  4Z6E A;  4NKU A;  2PAU A;  1ZQI A;  5J0U A;  4ATB B;  2DVI A;  4DMB A;  2GAF D;  3OUY A;  4AT8 A;  4K9A A;  2PFP A;  3V7L A;  5J2E A;  2ZH3 A;  8ICR A;  4I2E A;  1BPB A;  4TO0 A;  2O1P A;  4KLS A;  1R89 A;  3GW7 A;  5J0T A;  5J2J A;  4M0A A;  9ICS A;  1ZQC A;  8ICX A;  2PAQ A;  5TK6 A;  3SK9 A;  3PHZ A;  4K8V A;  3NR1 A;  4XDS A;  4K96 A;  4F5N A;  2BCQ A;  8ICF A;  7ICI A;  4TNX A;  4MLN A;  4RQ2 A;  4X4T A;  5D63 A;  5AO4 A;  1HUZ A;  4NXT A;  4XQ8 A;  4P2H A;  1Q79 A;  4RXO A;  4UD5 A;  4QZC A;  7ICV A;  5BPC A;  1XX7 A;  2BCV A;  4O5K A;  4JWN A;  7ICE A;  3KH1 A;  5BOM A;  5B3Q A;  4TO6 A;  4RQ6 A;  4GXI A;  4MFA A;  8ICQ A;  5J2A A;  5J0Q A;  4P4P A;  4QZA A;  3RJJ A;  5HRE A;  3RH6 A;  4PGQ A;  1ZQK A;  4PHP A;  4KLJ A;  2DQB A;  2IUB A;  1Q78 A;  5IIK A;  4RQ1 A;  5IIO A;  7ICU A;  4FO6 A;  1KEJ A;  1ZQY A;  2GZ4 A;  4LRL A;  5DEC A;  5J0S A;  2P66 A;  3OV7 A;  1VFG A;  3WFR E;  9ICO A;  3UXO A;  4PGY A;  1TFW A;  2PQ7 A;  8ICI A;  5J0Y A;  3S4L A;  4EGW A;  3OGU A;  3MCR A;  4RQ5 A;  1JQR A;  3NVO A;  4TNY A;  3ER9 B;  4E8F A;  4EED A;  1ZQJ A;  4UB3 A;  9ICE A;  2M2V A;  2DR5 A;  5DED A;  4RQ7 A;  3AQK A;  4YD2 A;  5CHG A;  3MBY A;  2PFN A; 
#chains in the Genus database with same CATH homology
 5HRG A;  4Z6D A;  4KLO A;  4YMN A;  5IIJ A;  3HW8 A;  4NM2 A;  9ICH A;  4RQ0 A;  1ZQH A;  3C18 A;  4S3N A;  8ICB A;  4K4I A;  4TNP A;  1MQ3 A;  1ZQL A;  2O6I A;  3V72 A;  1XSP A;  5CR0 A;  2DRA A;  9ICJ A;  4EP7 A;  1ZJM A;  7ICN A;  3AQM A;  3P3Q A;  4QZG A;  5TKA A;  3LK9 A;  1ZQP A;  4AT9 A;  2DR7 A;  4QZD A;  4FHW A;  8ICH A;  4PHA A;  5AO0 A;  2IHM A;  1KDH A;  2ZH4 A;  4X5V A;  1ZQQ A;  4XA5 A;  3H39 A;  5AO1 A;  3UQ2 A;  1BPZ A;  4FHV A;  4N71 A;  1NOM A;  4FH3 A;  1ZQG A;  4MFC A;  1XSN A;  4EBK A;  5HRI A;  5J2I A;  1TVA A;  1ZQE A;  5AO2 A;  7ICM A;  2HEK A;  3RJF A;  2PXI A;  5DB9 A;  3H3A A;  7ICK A;  3K75 D;  4ATB A;  3B0X A;  4TUP A;  4GXJ A;  8ICP A;  4RT2 A;  4QZF A;  4BZB A;  4R64 A;  4RT3 A;  4I2G A;  5IIM A;  2ZHA A;  4K4G A;  1MIV A;  3HC1 A;  3HJ1 A;  1R8B A;  4QQW A;  9ICV A;  4PHD A;  4IQV A;  1MQ2 A;  3JZ0 A;  2ZH5 A;  3TFR A;  5HHI A;  4TUS A;  3LJX A;  2PGS A;  1ZQO A;  4ZWE A;  5CA7 A;  1BPE A;  4TO1 A;  5J2F A;  5DB6 A;  2DRB A;  2I9G A;  4ZWG A;  4MF8 A;  5III A;  4UB5 A;  4NM1 A;  4M9N A;  9ICI A;  4RXP A;  5HHH A;  4FHP A;  3CCG A;  3UXN A;  4TO4 A;  3AU2 A;  4UAW A;  2BPG A;  2DR9 A;  5J0R A;  1WOT A;  4UBB A;  1ZQM A;  8ICU A;  2HHP A;  3PNC A;  9ICR A;  4RPY A;  5TK9 A;  3C5G A;  4KLD A;  2ZH9 A;  4UD4 A;  1UEV A;  4RQ4 A;  4KLG A;  4QG0 A;  1ZQW A;  4UB2 A;  3NYB A;  4M9J A;  2FLO A;  4X4Q A;  4I2H A;  4RXS A;  4R66 A;  4IG8 A;  9ICT A;  4RPZ A;  3HJ4 A;  3PML A;  1V4A A;  3PMN A;  3RJI A;  4DOC A;  3AU6 A;  4PGX A;  3RJE A;  2ZH7 A;  4AT7 B;  4RPX A;  1ZQA A;  2PFQ A;  9ICF A;  5J2G A;  8ICZ A;  7ICQ A;  1ZQR A;  5DBB A;  4WC3 A;  2NRK A;  2ZH2 A;  4PHE A;  1PX5 A;  4X4V A;  4UAZ A;  4DO9 A;  3H37 A;  3U1N A;  5J0W A;  3JPS A;  5CB1 A;  4N6W A;  5J29 A;  4X0A A;  3C2M A;  2FMS A;  1VQR A;  2CQZ A;  4QZE A;  2O5A A;  5F2V O;  5HRK A;  4E7X A;  4YN4 A;  5D49 A;  3TM8 A;  3BG2 A;  5TZV A;  7ICP A;  1ZQV A;  8ICE A;  4I29 A;  8ICY A;  4MFF A;  4M2Y A;  5HRB A;  1NO5 A;  3MGH A;  3WFO A;  3HI0 A;  3I7A A;  3SKD A;  4RWP A;  2PFO A;  1ZQX A;  1RPL A;  2PAR A;  4F5P A;  9ICC A;  3L9D A;  7ICF A;  4R8Z A;  1F5A A;  1BPD A;  8ICK A;  1XSL A;  4YMM A;  5DB7 A;  1JN3 A;  4LZG A;  4WC6 A;  3JPN A;  4MCW A;  4QZB A;  4RWQ A;  4X4O A;  8ICN A;  5DDM A;  4L1J B;  4MLM A;  3MDC A;  2M2T A;  5D4B A;  3AUO A;  5J0O A;  2W9M A;  1OU5 A;  3C5F A;  4LT6 A;  3UPQ A;  3RJK A;  4M9G A;  1RZT A;  4WC2 A;  9ICN A;  1JAJ A;  1ZQS A;  4KLL A;  2M2U A;  4WC1 A;  4UB1 A;  5AO3 A;  4JWM A;  7ICS A;  4DOB A;  2ISO A;  4Q2C A;  4I2F A;  8ICM A;  5TK7 A;  5J0X A;  2FMP A;  4WC7 A;  9ICW A;  3V7K A;  9ICK A;  2VAN A;  1ZQT A;  4I2J A;  1R8C A;  3JPT A;  1ZQU A;  4AT9 B;  2BCR A;  4FH5 A;  7ICR A;  4ME4 A;  3ISB A;  9ICL A;  4NY8 A;  4I2I A;  4WC0 A;  4M47 A;  5J2C A;  4R63 A;  5J0P A;  4TO2 A;  4FHX A;  3JPO A;  4RQ3 A;  8ICJ A;  4TUQ A;  2O08 A;  4YMO A;  4UB4 A;  4LVS A;  2BPC A;  4X4P A;  2PBE A;  4WBY A;  3B0Y A;  4EBJ A;  2ISP A;  4F5O A;  9ICP A;  4Z6F A;  3HX0 A;  7ICT A;  3RJG A;  3RH4 A;  4QFY A;  5DDY A;  1ZQB A;  5IIL A;  5HRD A;  8ICG A;  4TNQ A;  5CWR A;  5J2B A;  4UBC A;  3GDX A;  4QQX A;  1HUO A;  4I2B A;  5CJ7 A;  4X4N A;  8ICL A;  4Z6C A;  4P4O A;  5HRL A;  1VJ7 A;  4KLT A;  2M2W A;  3TMC A;  4FHY A;  3NQW A;  3RH5 A;  4X4U A;  4RXR A;  8ICS A;  4Q2D A;  7ICL A;  5J2H A;  4I2C A;  4IQU A;  4L7E A;  4QZ8 A;  3MDA A;  3WFQ E;  7ICG A;  4TO3 A;  5EOZ A;  4QQY A;  4Q7H A;  3KQ5 A;  3C2K A;  2RFF A;  4RQ8 A;  5DKW A;  4AT7 A;  3OUY B;  3HIY A;  4WBZ A;  5HR9 A;  3JPQ A;  4AT8 B;  4X4R A;  1TV9 A;  1KNY A;  3OVB A;  3JPR A;  4KLF A;  2BCU A;  4F5Q A;  4QFZ A;  8ICT A;  3MEM A;  4QG1 A;  4I28 A;  1MIY A;  2FMQ A;  4I2A A;  9ICM A;  8ICC A;  3C66 A;  9ICX A;  5TK8 A;  3UQ0 A;  4UAY A;  2Q66 A;  4TNR A;  4O5C A;  1ZQN A;  1YNB A;  2ZH6 A;  4LZD A;  5HRH A;  1YLQ A;  4RWO A;  2BPF A;  3JYY A;  4WC4 A;  8ICV A;  1JMS A;  4E80 A;  3TMB A;  4M9L A;  3JPP A;  4TUR A;  4O5E A;  4NLK A;  4KLU A;  7ICH A;  4KLI A;  4KLH A;  2ZH8 A;  2DR8 A;  3C2L A;  4YD1 A;  4NXZ A;  5D46 A;  4QZH A;  2Q14 A;  1TFY A;  4KLM A;  5BOL A;  4L1J A;  5J2D A;  4BZC A;  4K4H A;  4QG2 A;  3LQC B;  4IQT A;  4IQW A;  4R65 A;  3TFS A;  4X9E A;  5CP2 A;  4X4S A;  5HC9 A;  3IRH A;  4KLE A;  4XQ7 A;  3UXP A;  4F5R A;  3OVS A;  3RF0 A;  5IIN A;  4QFX A;  7ICO A;  3ISD A;  9ICG A;  4RXQ A;  4XUS A;  4X0B A;  1ZQZ A;  3V7J A;  5J2K A;  8ICO A;  4TNZ A;  4WC5 A;  7ICJ A;  1FA0 A;  3HWT A;  4O9M A;  1UET A;  5DB8 A;  3WFP A;  5HRF A;  4M04 A;  4L7W A;  4NKT A;  4NLZ A;  4MF2 A;  3MZO A;  4I2D A;  9ICA A;  3AQN A;  4I27 A;  3MGI A;  1YOY A;  2GWS A;  4KLQ A;  5DBC A;  4NLN A;  1ZQF A;  4MDZ A;  3RJH A;  2ZH1 A;  4MZ7 A;  5DBA A;  4M5D A;  3H38 A;  3AQL A;  1BPY A;  4PPX A;  4RWN A;  9ICU A;  9ICB A;  2ZHB A;  4QZ9 A;  2BE3 A;  4QZI A;  1ZJN A;  1ZQD A;  1UEU A;  4TO5 A;  2ID1 A;  2BCS A;  8ICW A;  1MIW A;  3M1T A;  3OVA A;  8ICA A;  4P4M A;  1R8A A;  4QQZ A;  9ICQ A;  4YCX A;  4M9H A;  3WFS C;  2OGI A;  3TMD A;  4DOA A;  4GXK A;  1U6Z A;  4PH5 A;  3ISC A;  4QG4 A;  1BPX A;  4XRH A;  4WCW A;  3UPS A;  4Z6E A;  4NKU A;  2PAU A;  1ZQI A;  5J0U A;  4ATB B;  2DVI A;  4DMB A;  3OUY A;  4AT8 A;  2PFP A;  3V7L A;  5J2E A;  2ZH3 A;  8ICR A;  4I2E A;  1BPB A;  4TO0 A;  2O1P A;  4KLS A;  1R89 A;  3GW7 A;  5J0T A;  5J2J A;  4M0A A;  9ICS A;  1ZQC A;  8ICX A;  2PAQ A;  5TK6 A;  3SK9 A;  3NR1 A;  4XDS A;  4F5N A;  2BCQ A;  8ICF A;  7ICI A;  4TNX A;  4MLN A;  4RQ2 A;  4X4T A;  5AO4 A;  1HUZ A;  4XQ8 A;  4P2H A;  1Q79 A;  4RXO A;  4UD5 A;  4QZC A;  7ICV A;  5BPC A;  1XX7 A;  2BCV A;  4O5K A;  4JWN A;  7ICE A;  3KH1 A;  5BOM A;  4TO6 A;  4RQ6 A;  4GXI A;  4MFA A;  8ICQ A;  5J2A A;  5J0Q A;  4P4P A;  4QZA A;  3RJJ A;  5HRE A;  3RH6 A;  4PGQ A;  1ZQK A;  4PHP A;  4KLJ A;  2DQB A;  1Q78 A;  5IIK A;  4RQ1 A;  5IIO A;  7ICU A;  4FO6 A;  1KEJ A;  1ZQY A;  2GZ4 A;  4LRL A;  5DEC A;  5J0S A;  2P66 A;  3OV7 A;  1VFG A;  3WFR E;  9ICO A;  3UXO A;  4PGY A;  1TFW A;  2PQ7 A;  8ICI A;  5J0Y A;  3S4L A;  3OGU A;  4RQ5 A;  1JQR A;  4TNY A;  4E8F A;  1ZQJ A;  9ICE A;  4UB3 A;  2M2V A;  2DR5 A;  5DED A;  4RQ7 A;  3AQK A;  4YD2 A;  5CHG A;  3MBY A;  2PFN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...