1VJ7A

Crystal structure of the bifunctional catalytic fragment of relseq, the rela/spot homolog from streptococcus equisimilis.
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
367
structure length
326
Chain Sequence
INLTGEEVVALAAKYMNETDAAFVKKALDYATAAHFYQVRKSGEPYIVHPIQVAGILADLHLDAVTVACGFLHDVVEDTDITLDNIEFDFGKDVRDIVDGVTKLGHRKMLMAMSKDIRVILVKLADRLHNMRTLKQERISRETMEIYAPLAHRLGISRIKWELEDLAFRYLNETEFYKISHMMNEKRREREALVDDIVTKIKSYTTEQGLFGDVYGRPKHIYSIYRKMRDKKKRFDQIFDLIAIRCVMETQSDVYAMVGYIHELWRPMPGRFKDYIAAPKANGYQSIHTTVYGPKGPIEIQIRTKEMHQVAEYGVAANWIKELVEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational antagonism between opposing active sites in a bifunctional RelA/SpoT homolog modulates (p)ppGpp metabolism during the stringent response.
pubmed doi rcsb
source organism Streptococcus dysgalactiae subsp. equisimilis
molecule tags Hydrolase, transferase
molecule keywords Bifunctional RELA/SPOT
total genus 119
structure length 326
sequence length 367
chains with identical sequence B
ec nomenclature ec 2.7.6.5: GTP diphosphokinase.
pdb deposition date 2004-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01966 HD HD domain
A PF04607 RelA_SpoT Region found in RelA / SpoT proteins
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3210.10 Mainly Alpha Orthogonal Bundle Hypothetical protein af1432 Hypothetical protein af1432 1vj7A01
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 1vj7A02
3AQKA 5IIOA 4X4SA 3RJHA 7ICOA 3RJKA 4L7EA 7ICLA 4F5PA 5J0QA 5J0XA 1BPDA 4IQVA 4O9MA 4PGYA 2BPFA 3I7AA 2PARA 4KLOA 7ICTA 4QZDA 4TNPA 5J0PA 4N6WA 2ID1A 4R64A 4QZFA 4M0AA 4KLQA 2BCUA 4RPYA 5CHGA 7ICSA 2DRBA 3AU6A 3U1NA 5HRGA 2P66A 4RQ6A 4X4RA 4WC5A 9ICKA 4RWQA 3PMLA 4LVSA 3HC1A 4RQ2A 1ZQBA 5J2JA 7ICIA 4TNYA 2M2WA 3C2MA 3MGIA 4E7XA 3C18A 5J2DA 5DB6A 4GXKA 3RJEA 3C2KA 1R8AA 2ZH8A 4QG2A 2BCVA 2FMSA 1UETA 4AT7B 5IIIA 4EBKA 8ICLA 4QG0A 5DDYA 4AT8B 5HRFA 2ZHBA 8ICRA 3RH5A 4MLNA 2Q66A 4TNRA 2PFNA 2IHMA 4YD1A 4X0AA 8ICGA 1XX7A 1KDHA 4UAZA 2PFPA 5J2IA 9ICSA 4RWNA 5HRDA 3GDXA 4R8ZA 2BPCA 7ICQA 4LT6A 1TVAA 1ZQCA 1MIVA 1BPXA 4L1JA 3B0XA 3LQCB 3TMDA 2FMPA 4UAWA 4NM1A 4EP7A 5HRIA 5J2CA 3V72A 5IIJA 1RPLA 4MF2A 2PBEA 4QZHA 5TK8A 3JPNA 3PMNA 4NXZA 4I2DA 4YCXA 3MEMA 4M47A 3HI0A 5IIMA 2Q14A 9ICEA 3HJ1A 4RPXA 1ZQEA 9ICRA 5D4BA 4UD5A 4QFZA 2ZH2A 3RH6A 4YMOA 3JPPA 3LK9A 4I29A 4IQWA 9ICNA 9ICWA 1R8CA 3C5GA 4DOAA 4FHPA 4Z6CA 5F2VO 4F5QA 7ICNA 2DR7A 3C66A 1JN3A 4UD4A 1BPZA 2I9GA 4WBYA 4KLDA 4WC1A 1VQRA 4PHAA 5J2KA 5BPCA 5DEDA 5HREA 7ICGA 8ICPA 4TO5A 4P2HA 3H37A 3RJGA 4K4HA 4RXOA 4E80A 4WC2A 5AO2A 4RT2A 4MCWA 5AO4A 1UEVA 1FA0A 5BOMA 3JYYA 2PGSA 4IG8A 4Z6DA 2ISOA 5J2EA 2DVIA 8ICBA 4X4PA 2OGIA 4WC7A 4X4OA 7ICRA 5IIKA 4X9EA 4M9LA 4FH5A 4E8FA 3MDAA 3OUYA 5HRHA 5D49A 2PFQA 2PAQA 4UB3A 2ZH5A 4NY8A 4K4GA 4FHYA 4PPXA 4MFFA 1R8BA 2DR8A 4KLLA 4FHWA 4M9JA 9ICPA 2CQZA 3AQNA 9ICQA 4WC6A 5CP2A 3JZ0A 4ZWGA 5AO3A 4ATBB 3NYBA 1ZQYA 1Q78A 2NRKA 1NOMA 4AT8A 4NKUA 4DO9A 4ME4A 4M9HA 3OVBA 1ZQWA 3PNCA 4UB4A 5J29A 1ZQQA 3V7KA 4I2JA 3OVSA 4QZCA 1ZQLA 4KLGA 3TFRA 1ZQOA 4TO4A 1KEJA 4QZEA 2ZH3A 4PGXA 4RT3A 5DB8A 2ZH7A 4RXSA 1XSNA 4GXJA 1ZQFA 1ZQAA 4WC3A 5IINA 5CR0A 5CWRA 5TZVA 5CA7A 4TUSA 3BG2A 3TMCA 4UB2A 4KLTA 1VFGA 9ICFA 9ICMA 8ICFA 4AT7A 4FHXA 4XA5A 5HRBA 4PGQA 8ICMA 4MF8A 4X4UA 4DMBA 2BE3A 4XDSA 1ZQDA 1ZQUA 4M9NA 3AQMA 2GZ4A 4X4NA 1YOYA 3K75D 1RZTA 9ICCA 8ICIA 3WFSC 2O6IA 4IQUA 5J2FA 3RJFA 4X5VA 7ICMA 3ISDA 1ZQZA 9ICHA 4TURA 7ICKA 8ICZA 4L7WA 3UPSA 7ICEA 4UB1A 4I2IA 4P4MA 4I2FA 4P4PA 3H38A 5J2BA 2FMQA 3OGUA 4X4QA 3UXPA 4KLSA 1ZQTA 4F5OA 5AO1A 3WFOA 4RWOA 4TUPA 4Q7HA 4TO0A 8ICOA 3TMBA 3MBYA 4RQ5A 9ICLA 8ICJA 2HHPA 1MQ2A 5HHHA 5IILA 4AT9B 4MFAA 3MZOA 4MDZA 5TK6A 7ICJA 7ICHA 4Z6EA 1WOTA 8ICKA 2PXIA 3OUYB 4FH3A 3JPOA 1XSPA 3UQ0A 2W9MA 1XSLA 3L9DA 5CB1A 4LRLA 4L1JB 1BPYA 4I2EA 2BCSA 4QZBA 2DQBA 2BCQA 2ZH1A 5CJ7A 5BOLA 4ATBA 3AQLA 8ICAA 1BPBA 3B0YA 4WC4A 4PHPA 1ZQHA 5HRLA 2PAUA 5J2HA 4TNQA 5J0TA 2PQ7A 1HUZA 4NLZA 4X4TA 4EBJA 4XQ7A 4QFXA 4YD2A 3HIYA 4I2GA 4X4VA 2M2VA 4WBZA 4XQ8A 3RF0A 2DR5A 9ICGA 9ICAA 1OU5A 5AO0A 4NM2A 4O5KA 3UPQA 3H39A 2M2TA 4YN4A 1ZJMA 1TFYA 7ICVA 1R89A 1PX5A 8ICEA 4KLHA 4MLMA 4KLFA 5DB9A 4FO6A 4O5EA 4TO3A 4YMNA 3AUOA 4Z6FA 4I27A 4K4IA 2RFFA 4I2HA 2DRAA 4DOBA 4JWNA 8ICHA 1YNBA 1BPEA 8ICYA 4BZCA 4RQ8A 3H3AA 1MIYA 7ICPA 3HJ4A 3WFPA 5DKWA 3ISCA 5DDMA 5HR9A 3V7JA 4PHDA 4KLJA 9ICBA 4QG4A 5DBCA 3ISBA 1TV9A 4KLMA 3WFQE 7ICUA 3TM8A 3UQ2A 4RQ0A 4I2CA 8ICWA 8ICUA 4QZAA 4O5CA 4I28A 3OV7A 1ZQVA 1JQRA 1ZQNA 1KNYA 4RWPA 9ICJA 3JPQA 3AU2A 2ZH4A 1JMSA 4LZGA 4TUQA 3NR1A 4KLEA 3NQWA 4XRHA 4ZWEA 8ICTA 3UXOA 4RPZA 4M2YA 4S3NA 1ZQGA 3WFRE 4X0BA 3IRHA 4RXRA 8ICNA 4BZBA 2ZH9A 4TO2A 5TKAA 4RQ1A 4WCWA 3RJIA 5DBAA 1HUOA 4AT9A 1ZQPA 2DR9A 4KLIA 4M9GA 4QZIA 3HW8A 8ICVA 2ZH6A 1ZQXA 5DBBA 5HC9A 5J0UA 1ZQIA 4MFCA 3MGHA 4NLNA 2ISPA 2O1PA 3C2LA 4IQTA 5J0YA 4R63A 9ICXA 4DOCA 5J0OA 8ICSA 4M5DA 4F5NA 4TO1A 4GXIA 1YLQA 1NO5A 4F5RA 3JPTA 3OVAA 5J0SA 4LZDA 4MZ7A 5HHIA 5TK7A 1ZQSA 3V7LA 5D46A 4NLKA 5J0RA 3UXNA 1F5AA 4RQ3A 5TK9A 4R65A 1Q79A 1VJ7A 1MIWA 5J0WA 4JWMA 9ICUA 4RXQA 2BCRA 4I2BA 4N71A 3LJXA 3CCGA 4TO6A 4QZGA 4R66A 3RH4A 2GWSA 1MQ3A 4UAYA 2O5AA 8ICCA 2O08A 4PH5A 2M2UA 2VANA 1TFWA 4M04A 5DB7A 3JPRA 4QZ9A 4UB5A 3KH1A 4UBCA 4PHEA 3HX0A 1ZQRA 9ICOA 3M1TA 3TFSA 3RJJA 9ICTA 4XUSA 4QG1A 3MDCA 1ZQMA 2FLOA 3HWTA 5J2GA 1ZJNA 9ICVA 5J2AA 4RQ7A 5DECA 4TNZA 4FHVA 4WC0A 4RQ4A 1JAJA 3C5FA 4RXPA 4YMMA 1V4AA 8ICQA 1U6ZA 5HRKA 4NKTA 2PFOA 4UBBA 3JPSA 1UEUA 1ZQKA 2BPGA 4QFYA 9ICIA 4QZ8A 8ICXA 2HEKA 4I2AA 2ZHAA 5EOZA 3P3QA 4TNXA 4P4OA 1ZQJA 4KLUA 7ICFA
chains in the Genus database with same CATH superfamily
3AQKA 5CFSA 5IIOA 4X4SA 3RJHA 7ICOA 3RJKA 4L7EA 7ICLA 4F5PA 5J0QA 5J0XA 1BPDA 4IQVA 4K9BA 4O9MA 4FO1A 4PGYA 2BPFA 3I7AA 2PARA 4KLOA 7ICTA 4QZDA 4TNPA 5J0PA 4N6WA 4HX0A 2ID1A 4R64A 4QZFA 4M0AA 4KLQA 2BCUA 4NXXA 4RPYA 5CHGA 7ICSA 2DRBA 3AU6A 3U1NA 5HRGA 2P66A 4RQ6A 4X4RA 4WC5A 9ICKA 4RWQA 3PMLA 4LVSA 3HC1A 4O68A 4RQ2A 1ZQBA 5J2JA 4JLXA 4WQLA 7ICIA 4TNYA 2M2WA 3C2MA 3MGIA 4E7XA 3C18A 5J2DA 5DB6A 4GXKA 3RJEA 3C2KA 1R8AA 2ZH8A 4QG2A 4N7RA 2BCVA 2B4VA 2FMSA 1UETA 4AT7B 5IIIA 4EBKA 8ICLA 4QG0A 5DDYA 4AT8B 5HRFA 2ZHBA 8ICRA 3RH5A 4MLNA 2Q66A 4TNRA 2PFNA 5D63A 2IHMA 4YD1A 4X0AA 8ICGA 1XX7A 1KDHA 4UAZA 2PFPA 5J2IA 9ICSA 4RWNA 5HRDA 3GDXA 4R8ZA 2BPCA 7ICQA 4LT6A 4XJEA 1TVAA 1ZQCA 1MIVA 1BPXA 4L1JA 3B0XA 3LQCB 3TMDA 2FMPA 4UAWA 4NM1A 4EP7A 5HRIA 5J2CA 3V72A 5IIJA 5CFUA 1RPLA 4MF2A 2PBEA 2HN1A 4QZHA 5TK8A 3JPNA 3PMNA 4NXZA 4I2DA 4YCXA 3MEMA 4M47A 3HI0A 2EWRA 5IIMA 2Q14A 9ICEA 3HJ1A 4RPXA 1ZQEA 3ERCC 9ICRA 5D4BA 4UD5A 4QFZA 2ZH2A 3RH6A 4MKPA 4YMOA 3JPPA 3LK9A 4I29A 4IQWA 9ICNA 9ICWA 1R8CA 4O69A 3C5GA 4DOAA 4FHPA 4Z6CA 5F2VO 4F5QA 7ICNA 2DR7A 3C66A 1JN3A 4UD4A 1BPZA 2I9GA 4WBYA 4KLDA 4WC1A 1VQRA 4PHAA 5J2KA 5BPCA 4K98A 5DEDA 5HREA 7ICGA 8ICPA 4TO5A 4P2HA 3H37A 3RJGA 4K4HA 4RXOA 4O67A 4E80A 4WC2A 4Q2CA 5AO2A 4RT2A 4MCWA 5AO4A 1UEVA 1FA0A 5BOMA 3JYYA 2PGSA 4IG8A 4Z6DA 2ISOA 5J2EA 3NVOA 2DVIA 8ICBA 4X4PA 2OGIA 4WC7A 4X4OA 7ICRA 4OAFA 5IIKA 4X9EA 4M9LA 4FH5A 4E8FA 3MDAA 3OUYA 4O6AA 5HRHA 5D49A 2PFQA 2PAQA 4UB3A 2ZH5A 4NY8A 4K4GA 4FHYA 4PPXA 4MFFA 1R8BA 4NXVA 2DR8A 4KLLA 4FHWA 4M9JA 9ICPA 2CQZA 3AQNA 9ICQA 4WH5A 5CP2A 3JZ0A 4WC6A 4ZWGA 5AO3A 4ATBB 4OAHA 4QQZA 4EV6A 3NYBA 1ZQYA 4K96A 1Q78A 2NRKA 1NOMA 4AT8A 4NKUA 4K97A 3SKDA 2HN2A 4ME4A 4DO9A 4KM5A 4M9HA 3OVBA 1ZQWA 3PNCA 4LEWA 4UB4A 5J29A 1ZQQA 3V7KA 2IHOA 4I2JA 3OVSA 4QZCA 1ZQLA 4KLGA 4LEZA 3TFRA 1ZQOA 4TO4A 4EGWA 5CFTA 1KEJA 4QZEA 2ZH3A 4PGXA 4RT3A 4K99A 5DB8A 2ZH7A 4RXSA 1XSNA 4GXJA 1ZQFA 1ZQAA 4WC3A 5IINA 5CR0A 2BBJA 4LEVA 5CWRA 5TZVA 5CA7A 4TUSA 3BG2A 3TMCA 4UB2A 4KLTA 1VFGA 9ICFA 9ICMA 8ICFA 4AT7A 4FHXA 4XA5A 5HRBA 4PGQA 8ICMA 4MF8A 4X4UA 4DMBA 3MCRA 2BE3A 4XDSA 1ZQDA 1ZQUA 4M9NA 3AQMA 2GZ4A 4X4NA 1YOYA 3K75D 1RZTA 9ICCA 8ICIA 3NWIA 3WFSC 2O6IA 4IQUA 5J2FA 3RJFA 4X5VA 7ICMA 3ISDA 1ZQZA 9ICHA 4TURA 7ICKA 5CHEA 8ICZA 4L7WA 3UPSA 7ICEA 4UB1A 4I2IA 4P4MA 4I2FA 4P4PA 4WQKA 3H38A 5J2BA 2FMQA 3OGUA 4X4QA 3UXPA 4Q2DA 4KLSA 4NXUA 1ZQTA 4F5OA 5AO1A 3WFOA 4RWOA 4TUPA 4Q7HA 4TO0A 8ICOA 3TMBA 3MBYA 4RQ5A 9ICLA 8ICJA 2HHPA 1MQ2A 5HHHA 5IILA 2BBHA 4AT9B 4MFAA 3MZOA 4MDZA 5TK6A 7ICJA 7ICHA 4K9AA 4Z6EA 1WOTA 8ICKA 2PXIA 3SK9A 3OUYB 3PHZA 4FH3A 5D62A 3JPOA 4NXTA 1XSPA 4OAGA 3UQ0A 2W9MA 1XSLA 3L9DA 5D61A 5CB1A 4LRLA 4L1JB 1BPYA 4I2EA 2BCSA 4QZBA 2DQBA 2BCQA 2ZH1A 5CJ7A 5BOLA 5B3QA 4ATBA 3AQLA 8ICAA 1BPBA 3B0YA 4WC4A 4PHPA 3JCFA 1ZQHA 5HRLA 2PAUA 5J2HA 4TNQA 5J0TA 2PQ7A 1HUZA 4NLZA 4X4TA 4EBJA 4XQ7A 4QFXA 4QQXA 4YD2A 3HIYA 4I2GA 4X4VA 2M2VA 4WBZA 4XQ8A 3RF0A 2DR5A 9ICGA 9ICAA 1OU5A 5AO0A 4NM2A 4O5KA 3UPQA 3H39A 2M2TA 4YN4A 1ZJMA 1TFYA 7ICVA 1R89A 1PX5A 8ICEA 4KLHA 4I0UA 4MLMA 4KLFA 5DB9A 4FO6A 3CK6A 4O5EA 4TO3A 4YMNA 3AUOA 4Z6FA 4I27A 4K4IA 2RFFA 4I2HA 2DRAA 4DOBA 4JWNA 8ICHA 1YNBA 1BPEA 8ICYA 4BZCA 4RQ8A 3H3AA 1MIYA 7ICPA 4KB6A 3HJ4A 1GPJA 3WFPA 5DKWA 3ISCA 4K8VA 5HR9A 5DDMA 3V7JA 4PHDA 4KLJA 9ICBA 4QG4A 5DBCA 3ISBA 1TV9A 4KLMA 3WFQE 7ICUA 3TM8A 3UQ2A 4RQ0A 4I2CA 2GA9D 8ICWA 8ICUA 4QZAA 4O5CA 4I28A 3OV7A 1ZQVA 1JQRA 1ZQNA 1KNYA 4RWPA 9ICJA 4JLZA 3JPQA 2B51A 3AU2A 2ZH4A 2GAFD 1JMSA 4LZGA 4TUQA 3NR1A 4KLEA 3NQWA 4XRHA 4ZWEA 8ICTA 3UXOA 4NXWA 4RPZA 4OAIZ 4M2YA 4S3NA 3GW7A 1ZQGA 3WFRE 3S4LA 5B3PA 3IRHA 4X0BA 4RXRA 8ICNA 3EF2A 4BZBA 2ZH9A 4TO2A 5TKAA 4RQ1A 4WCWA 3RJIA 5DBAA 1HUOA 4AT9A 1ZQPA 2DR9A 4KLIA 2FCLA 4QZIA 3HW8A 4M9GA 2ZH6A 8ICVA 1ZQXA 5DBBA 4WOYA 5J0UA 5HC9A 1ZQIA 3MGHA 4MFCA 4NLNA 2ISPA 2O1PA 3C2LA 3NKUA 4IQTA 5J0YA 4R63A 9ICXA 4DOCA 5J0OA 8ICSA 2IUBA 4M5DA 4F5NA 4TO1A 4GXIA 1YLQA 5JTGA 2B56A 1NO5A 4F5RA 3JPTA 3OVAA 4QQYA 5J0SA 4LZDA 4MZ7A 5HHIA 5TK7A 1ZQSA 3V7LA 5D46A 4NLKA 3ER8C 5J0RA 3UXNA 1F5AA 4RQ3A 5TK9A 4R65A 1Q79A 1VJ7A 4LEYA 1MIWA 5J0WA 4JWMA 9ICUA 4RXQA 2BCRA 4I2BA 4N71A 3LJXA 3CCGA 4TO6A 3K7DA 4QZGA 4R66A 3RH4A 2GWSA 1MQ3A 4UAYA 2O5AA 8ICCA 2O08A 4PH5A 2M2UA 2VANA 1TFWA 3KQ5A 4M04A 5DB7A 3JPRA 4QZ9A 4UB5A 3KH1A 4UBCA 4PHEA 3HX0A 3OWGA 1ZQRA 9ICOA 3M1TA 3TFSA 3RJJA 9ICTA 4XUSA 4QG1A 3MDCA 1ZQMA 2FLOA 3HWTA 4EEBA 5J2GA 1ZJNA 9ICVA 4QQWA 5J2AA 4RQ7A 5DECA 4TNZA 4FHVA 4WC0A 4RQ4A 1JAJA 4EEDA 3C5FA 4RXPA 4YMMA 1V4AA 8ICQA 1U6ZA 5HRKA 4NKTA 3ER9B 2PFOA 4UBBA 3JPSA 1UEUA 1ZQKA 2BPGA 4QFYA 9ICIA 4QZ8A 8ICXA 2HEKA 4I2AA 2ZHAA 5EOZA 3P3QA 4TNXA 4P4OA 1ZQJA 4KLUA 7ICFA
chains in the Genus database with same CATH topology
3AQKA 5IIOA 4X4SA 3RJHA 7ICOA 3RJKA 4L7EA 7ICLA 4F5PA 5J0QA 5J0XA 1BPDA 4IQVA 4O9MA 4PGYA 2BPFA 3I7AA 2PARA 4KLOA 7ICTA 4QZDA 4TNPA 5J0PA 4N6WA 2ID1A 4R64A 4QZFA 4M0AA 4KLQA 2BCUA 4RPYA 5CHGA 7ICSA 2DRBA 3AU6A 3U1NA 5HRGA 2P66A 4RQ6A 4X4RA 4WC5A 9ICKA 4RWQA 3PMLA 4LVSA 3HC1A 4RQ2A 1ZQBA 5J2JA 7ICIA 4TNYA 2M2WA 3C2MA 3MGIA 4E7XA 3C18A 5J2DA 5DB6A 4GXKA 3RJEA 3C2KA 1R8AA 2ZH8A 4QG2A 2BCVA 2FMSA 1UETA 4AT7B 5IIIA 4EBKA 8ICLA 4QG0A 5DDYA 4AT8B 5HRFA 2ZHBA 8ICRA 3RH5A 4MLNA 2Q66A 4TNRA 2PFNA 2IHMA 4YD1A 4X0AA 8ICGA 1XX7A 1KDHA 4UAZA 2PFPA 5J2IA 9ICSA 4RWNA 5HRDA 3GDXA 4R8ZA 2BPCA 7ICQA 4LT6A 1TVAA 1ZQCA 1MIVA 1BPXA 4L1JA 3B0XA 3LQCB 3TMDA 2FMPA 4UAWA 4NM1A 4EP7A 5HRIA 5J2CA 3V72A 5IIJA 1RPLA 4MF2A 2PBEA 4QZHA 5TK8A 3JPNA 3PMNA 4NXZA 4I2DA 4YCXA 3MEMA 4M47A 3HI0A 5IIMA 2Q14A 9ICEA 3HJ1A 4RPXA 1ZQEA 9ICRA 5D4BA 4UD5A 4QFZA 2ZH2A 3RH6A 4YMOA 3JPPA 3LK9A 4I29A 4IQWA 9ICNA 9ICWA 1R8CA 3C5GA 4DOAA 4FHPA 4Z6CA 5F2VO 4F5QA 7ICNA 2DR7A 3C66A 1JN3A 4UD4A 1BPZA 2I9GA 4WBYA 4KLDA 4WC1A 1VQRA 4PHAA 5J2KA 5BPCA 5DEDA 5HREA 7ICGA 8ICPA 4TO5A 4P2HA 3H37A 3RJGA 4K4HA 4RXOA 4E80A 4WC2A 4Q2CA 5AO2A 4RT2A 4MCWA 5AO4A 1UEVA 1FA0A 5BOMA 3JYYA 2PGSA 4IG8A 4Z6DA 2ISOA 5J2EA 2DVIA 8ICBA 4X4PA 2OGIA 4WC7A 4X4OA 7ICRA 5IIKA 4X9EA 4M9LA 4FH5A 4E8FA 3MDAA 3OUYA 5HRHA 5D49A 2PFQA 2PAQA 4UB3A 2ZH5A 4NY8A 4K4GA 4FHYA 4PPXA 4MFFA 1R8BA 2DR8A 4KLLA 4FHWA 4M9JA 9ICPA 2CQZA 3AQNA 9ICQA 4WC6A 5CP2A 3JZ0A 4ZWGA 5AO3A 4ATBB 4QQZA 3NYBA 1ZQYA 1Q78A 2NRKA 1NOMA 4AT8A 4NKUA 3SKDA 4DO9A 4ME4A 4M9HA 3OVBA 1ZQWA 3PNCA 4UB4A 5J29A 1ZQQA 3V7KA 4I2JA 3OVSA 4QZCA 1ZQLA 4KLGA 3TFRA 1ZQOA 4TO4A 1KEJA 4QZEA 2ZH3A 4PGXA 4RT3A 5DB8A 2ZH7A 4RXSA 1XSNA 4GXJA 1ZQFA 1ZQAA 4WC3A 5IINA 5CR0A 5CWRA 5TZVA 5CA7A 4TUSA 3BG2A 3TMCA 4UB2A 4KLTA 1VFGA 9ICFA 9ICMA 8ICFA 4AT7A 4FHXA 4XA5A 5HRBA 4PGQA 8ICMA 4MF8A 4X4UA 4DMBA 2BE3A 4XDSA 1ZQDA 1ZQUA 4M9NA 3AQMA 2GZ4A 4X4NA 1YOYA 3K75D 1RZTA 9ICCA 8ICIA 3WFSC 2O6IA 4IQUA 5J2FA 3RJFA 4X5VA 7ICMA 3ISDA 1ZQZA 9ICHA 4TURA 7ICKA 8ICZA 4L7WA 3UPSA 7ICEA 4UB1A 4I2IA 4P4MA 4I2FA 4P4PA 3H38A 5J2BA 2FMQA 3OGUA 4X4QA 3UXPA 4Q2DA 4KLSA 1ZQTA 4F5OA 5AO1A 3WFOA 4RWOA 4TUPA 4Q7HA 4TO0A 8ICOA 3TMBA 3MBYA 4RQ5A 9ICLA 8ICJA 2HHPA 1MQ2A 5HHHA 5IILA 4AT9B 4MFAA 3MZOA 4MDZA 5TK6A 7ICJA 7ICHA 4Z6EA 1WOTA 8ICKA 2PXIA 3SK9A 3OUYB 4FH3A 3JPOA 1XSPA 3UQ0A 2W9MA 1XSLA 3L9DA 5CB1A 4LRLA 4L1JB 1BPYA 4I2EA 2BCSA 4QZBA 2DQBA 2BCQA 2ZH1A 5CJ7A 5BOLA 4ATBA 3AQLA 8ICAA 1BPBA 3B0YA 4WC4A 4PHPA 1ZQHA 5HRLA 2PAUA 5J2HA 4TNQA 5J0TA 2PQ7A 1HUZA 4NLZA 4X4TA 4EBJA 4XQ7A 4QFXA 4QQXA 4YD2A 3HIYA 4I2GA 4X4VA 2M2VA 4WBZA 4XQ8A 3RF0A 2DR5A 9ICGA 9ICAA 1OU5A 5AO0A 4NM2A 4O5KA 3UPQA 3H39A 2M2TA 4YN4A 1ZJMA 1TFYA 7ICVA 1R89A 1PX5A 8ICEA 4KLHA 4MLMA 4KLFA 5DB9A 4FO6A 4O5EA 4TO3A 4YMNA 3AUOA 4Z6FA 4I27A 4K4IA 2RFFA 4I2HA 2DRAA 4DOBA 4JWNA 8ICHA 1YNBA 1BPEA 8ICYA 4BZCA 4RQ8A 3H3AA 1MIYA 7ICPA 3HJ4A 3WFPA 5DKWA 3ISCA 5DDMA 5HR9A 3V7JA 4PHDA 4KLJA 9ICBA 4QG4A 5DBCA 3ISBA 1TV9A 4KLMA 3WFQE 7ICUA 3TM8A 3UQ2A 4RQ0A 4I2CA 8ICWA 8ICUA 4QZAA 4O5CA 4I28A 3OV7A 1ZQVA 1JQRA 1ZQNA 1KNYA 4RWPA 9ICJA 3JPQA 3AU2A 2ZH4A 1JMSA 4LZGA 4TUQA 3NR1A 4KLEA 3NQWA 4XRHA 4ZWEA 8ICTA 3UXOA 4RPZA 4M2YA 4S3NA 3GW7A 1ZQGA 3WFRE 3S4LA 4X0BA 3IRHA 4RXRA 8ICNA 4BZBA 2ZH9A 4TO2A 5TKAA 4RQ1A 4WCWA 3RJIA 5DBAA 1HUOA 4AT9A 1ZQPA 2DR9A 4KLIA 4M9GA 4QZIA 3HW8A 8ICVA 2ZH6A 1ZQXA 5DBBA 5HC9A 5J0UA 1ZQIA 4MFCA 3MGHA 4NLNA 2ISPA 2O1PA 3C2LA 4IQTA 5J0YA 4R63A 9ICXA 4DOCA 5J0OA 8ICSA 4M5DA 4F5NA 4TO1A 4GXIA 1YLQA 1NO5A 4F5RA 3JPTA 3OVAA 4QQYA 5J0SA 4LZDA 4MZ7A 5HHIA 5TK7A 1ZQSA 3V7LA 5D46A 4NLKA 5J0RA 3UXNA 1F5AA 4RQ3A 5TK9A 4R65A 1Q79A 1VJ7A 1MIWA 5J0WA 4JWMA 9ICUA 4RXQA 2BCRA 4I2BA 4N71A 3LJXA 3CCGA 4TO6A 4QZGA 4R66A 3RH4A 2GWSA 1MQ3A 4UAYA 2O5AA 8ICCA 2O08A 4PH5A 2M2UA 2VANA 1TFWA 3KQ5A 4M04A 5DB7A 3JPRA 4QZ9A 4UB5A 3KH1A 4UBCA 4PHEA 3HX0A 1ZQRA 9ICOA 3M1TA 3TFSA 3RJJA 9ICTA 4XUSA 4QG1A 3MDCA 1ZQMA 2FLOA 3HWTA 5J2GA 1ZJNA 9ICVA 4QQWA 5J2AA 4RQ7A 5DECA 4TNZA 4FHVA 4WC0A 4RQ4A 1JAJA 3C5FA 4RXPA 4YMMA 1V4AA 8ICQA 1U6ZA 5HRKA 4NKTA 2PFOA 4UBBA 3JPSA 1UEUA 1ZQKA 2BPGA 4QFYA 9ICIA 4QZ8A 8ICXA 2HEKA 4I2AA 2ZHAA 5EOZA 3P3QA 4TNXA 4P4OA 1ZQJA 4KLUA 7ICFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AQK A;  5IIO A;  4X4S A;  3RJH A;  7ICO A;  3RJK A;  4L7E A;  7ICL A;  4F5P A;  5J0Q A;  5J0X A;  1BPD A;  4IQV A;  4O9M A;  4PGY A;  2BPF A;  3I7A A;  2PAR A;  4KLO A;  7ICT A;  4QZD A;  4TNP A;  5J0P A;  4N6W A;  2ID1 A;  4R64 A;  4QZF A;  4M0A A;  4KLQ A;  2BCU A;  4RPY A;  5CHG A;  7ICS A;  2DRB A;  3AU6 A;  3U1N A;  5HRG A;  2P66 A;  4RQ6 A;  4X4R A;  4WC5 A;  9ICK A;  4RWQ A;  3PML A;  4LVS A;  3HC1 A;  4RQ2 A;  1ZQB A;  5J2J A;  7ICI A;  4TNY A;  2M2W A;  3C2M A;  3MGI A;  4E7X A;  3C18 A;  5J2D A;  5DB6 A;  4GXK A;  3RJE A;  3C2K A;  1R8A A;  2ZH8 A;  4QG2 A;  2BCV A;  2FMS A;  1UET A;  4AT7 B;  5III A;  4EBK A;  8ICL A;  4QG0 A;  5DDY A;  4AT8 B;  5HRF A;  2ZHB A;  8ICR A;  3RH5 A;  4MLN A;  2Q66 A;  4TNR A;  2PFN A;  2IHM A;  4YD1 A;  4X0A A;  8ICG A;  1XX7 A;  1KDH A;  4UAZ A;  2PFP A;  5J2I A;  9ICS A;  4RWN A;  5HRD A;  3GDX A;  4R8Z A;  2BPC A;  7ICQ A;  4LT6 A;  1TVA A;  1ZQC A;  1MIV A;  1BPX A;  4L1J A;  3B0X A;  3LQC B;  3TMD A;  2FMP A;  4UAW A;  4NM1 A;  4EP7 A;  5HRI A;  5J2C A;  3V72 A;  5IIJ A;  1RPL A;  4MF2 A;  2PBE A;  4QZH A;  5TK8 A;  3JPN A;  3PMN A;  4NXZ A;  4I2D A;  4YCX A;  3MEM A;  4M47 A;  3HI0 A;  5IIM A;  2Q14 A;  9ICE A;  3HJ1 A;  4RPX A;  1ZQE A;  9ICR A;  5D4B A;  4UD5 A;  4QFZ A;  2ZH2 A;  3RH6 A;  4YMO A;  3JPP A;  3LK9 A;  4I29 A;  4IQW A;  9ICN A;  9ICW A;  1R8C A;  3C5G A;  4DOA A;  4FHP A;  4Z6C A;  5F2V O;  4F5Q A;  7ICN A;  2DR7 A;  3C66 A;  1JN3 A;  4UD4 A;  1BPZ A;  2I9G A;  4WBY A;  4KLD A;  4WC1 A;  1VQR A;  4PHA A;  5J2K A;  5BPC A;  5DED A;  5HRE A;  7ICG A;  8ICP A;  4TO5 A;  4P2H A;  3H37 A;  3RJG A;  4K4H A;  4RXO A;  4E80 A;  4WC2 A;  5AO2 A;  4RT2 A;  4MCW A;  5AO4 A;  1UEV A;  1FA0 A;  5BOM A;  3JYY A;  2PGS A;  4IG8 A;  4Z6D A;  2ISO A;  5J2E A;  2DVI A;  8ICB A;  4X4P A;  2OGI A;  4WC7 A;  4X4O A;  7ICR A;  5IIK A;  4X9E A;  4M9L A;  4FH5 A;  4E8F A;  3MDA A;  3OUY A;  5HRH A;  5D49 A;  2PFQ A;  2PAQ A;  4UB3 A;  2ZH5 A;  4NY8 A;  4K4G A;  4FHY A;  4PPX A;  4MFF A;  1R8B A;  2DR8 A;  4KLL A;  4FHW A;  4M9J A;  9ICP A;  2CQZ A;  3AQN A;  9ICQ A;  4WC6 A;  5CP2 A;  3JZ0 A;  4ZWG A;  5AO3 A;  4ATB B;  3NYB A;  1ZQY A;  1Q78 A;  2NRK A;  1NOM A;  4AT8 A;  4NKU A;  4DO9 A;  4ME4 A;  4M9H A;  3OVB A;  1ZQW A;  3PNC A;  4UB4 A;  5J29 A;  1ZQQ A;  3V7K A;  4I2J A;  3OVS A;  4QZC A;  1ZQL A;  4KLG A;  3TFR A;  1ZQO A;  4TO4 A;  1KEJ A;  4QZE A;  2ZH3 A;  4PGX A;  4RT3 A;  5DB8 A;  2ZH7 A;  4RXS A;  1XSN A;  4GXJ A;  1ZQF A;  1ZQA A;  4WC3 A;  5IIN A;  5CR0 A;  5CWR A;  5TZV A;  5CA7 A;  4TUS A;  3BG2 A;  3TMC A;  4UB2 A;  4KLT A;  1VFG A;  9ICF A;  9ICM A;  8ICF A;  4AT7 A;  4FHX A;  4XA5 A;  5HRB A;  4PGQ A;  8ICM A;  4MF8 A;  4X4U A;  4DMB A;  2BE3 A;  4XDS A;  1ZQD A;  1ZQU A;  4M9N A;  3AQM A;  2GZ4 A;  4X4N A;  1YOY A;  3K75 D;  1RZT A;  9ICC A;  8ICI A;  3WFS C;  2O6I A;  4IQU A;  5J2F A;  3RJF A;  4X5V A;  7ICM A;  3ISD A;  1ZQZ A;  9ICH A;  4TUR A;  7ICK A;  8ICZ A;  4L7W A;  3UPS A;  7ICE A;  4UB1 A;  4I2I A;  4P4M A;  4I2F A;  4P4P A;  3H38 A;  5J2B A;  2FMQ A;  3OGU A;  4X4Q A;  3UXP A;  4KLS A;  1ZQT A;  4F5O A;  5AO1 A;  3WFO A;  4RWO A;  4TUP A;  4Q7H A;  4TO0 A;  8ICO A;  3TMB A;  3MBY A;  4RQ5 A;  9ICL A;  8ICJ A;  2HHP A;  1MQ2 A;  5HHH A;  5IIL A;  4AT9 B;  4MFA A;  3MZO A;  4MDZ A;  5TK6 A;  7ICJ A;  7ICH A;  4Z6E A;  1WOT A;  8ICK A;  2PXI A;  3OUY B;  4FH3 A;  3JPO A;  1XSP A;  3UQ0 A;  2W9M A;  1XSL A;  3L9D A;  5CB1 A;  4LRL A;  4L1J B;  1BPY A;  4I2E A;  2BCS A;  4QZB A;  2DQB A;  2BCQ A;  2ZH1 A;  5CJ7 A;  5BOL A;  4ATB A;  3AQL A;  8ICA A;  1BPB A;  3B0Y A;  4WC4 A;  4PHP A;  1ZQH A;  5HRL A;  2PAU A;  5J2H A;  4TNQ A;  5J0T A;  2PQ7 A;  1HUZ A;  4NLZ A;  4X4T A;  4EBJ A;  4XQ7 A;  4QFX A;  4YD2 A;  3HIY A;  4I2G A;  4X4V A;  2M2V A;  4WBZ A;  4XQ8 A;  3RF0 A;  2DR5 A;  9ICG A;  9ICA A;  1OU5 A;  5AO0 A;  4NM2 A;  4O5K A;  3UPQ A;  3H39 A;  2M2T A;  4YN4 A;  1ZJM A;  1TFY A;  7ICV A;  1R89 A;  1PX5 A;  8ICE A;  4KLH A;  4MLM A;  4KLF A;  5DB9 A;  4FO6 A;  4O5E A;  4TO3 A;  4YMN A;  3AUO A;  4Z6F A;  4I27 A;  4K4I A;  2RFF A;  4I2H A;  2DRA A;  4DOB A;  4JWN A;  8ICH A;  1YNB A;  1BPE A;  8ICY A;  4BZC A;  4RQ8 A;  3H3A A;  1MIY A;  7ICP A;  3HJ4 A;  3WFP A;  5DKW A;  3ISC A;  5DDM A;  5HR9 A;  3V7J A;  4PHD A;  4KLJ A;  9ICB A;  4QG4 A;  5DBC A;  3ISB A;  1TV9 A;  4KLM A;  3WFQ E;  7ICU A;  3TM8 A;  3UQ2 A;  4RQ0 A;  4I2C A;  8ICW A;  8ICU A;  4QZA A;  4O5C A;  4I28 A;  3OV7 A;  1ZQV A;  1JQR A;  1ZQN A;  1KNY A;  4RWP A;  9ICJ A;  3JPQ A;  3AU2 A;  2ZH4 A;  1JMS A;  4LZG A;  4TUQ A;  3NR1 A;  4KLE A;  3NQW A;  4XRH A;  4ZWE A;  8ICT A;  3UXO A;  4RPZ A;  4M2Y A;  4S3N A;  1ZQG A;  3WFR E;  4X0B A;  3IRH A;  4RXR A;  8ICN A;  4BZB A;  2ZH9 A;  4TO2 A;  5TKA A;  4RQ1 A;  4WCW A;  3RJI A;  5DBA A;  1HUO A;  4AT9 A;  1ZQP A;  2DR9 A;  4KLI A;  4M9G A;  4QZI A;  3HW8 A;  8ICV A;  2ZH6 A;  1ZQX A;  5DBB A;  5HC9 A;  5J0U A;  1ZQI A;  4MFC A;  3MGH A;  4NLN A;  2ISP A;  2O1P A;  3C2L A;  4IQT A;  5J0Y A;  4R63 A;  9ICX A;  4DOC A;  5J0O A;  8ICS A;  4M5D A;  4F5N A;  4TO1 A;  4GXI A;  1YLQ A;  1NO5 A;  4F5R A;  3JPT A;  3OVA A;  5J0S A;  4LZD A;  4MZ7 A;  5HHI A;  5TK7 A;  1ZQS A;  3V7L A;  5D46 A;  4NLK A;  5J0R A;  3UXN A;  1F5A A;  4RQ3 A;  5TK9 A;  4R65 A;  1Q79 A;  1VJ7 A;  1MIW A;  5J0W A;  4JWM A;  9ICU A;  4RXQ A;  2BCR A;  4I2B A;  4N71 A;  3LJX A;  3CCG A;  4TO6 A;  4QZG A;  4R66 A;  3RH4 A;  2GWS A;  1MQ3 A;  4UAY A;  2O5A A;  8ICC A;  2O08 A;  4PH5 A;  2M2U A;  2VAN A;  1TFW A;  4M04 A;  5DB7 A;  3JPR A;  4QZ9 A;  4UB5 A;  3KH1 A;  4UBC A;  4PHE A;  3HX0 A;  1ZQR A;  9ICO A;  3M1T A;  3TFS A;  3RJJ A;  9ICT A;  4XUS A;  4QG1 A;  3MDC A;  1ZQM A;  2FLO A;  3HWT A;  5J2G A;  1ZJN A;  9ICV A;  5J2A A;  4RQ7 A;  5DEC A;  4TNZ A;  4FHV A;  4WC0 A;  4RQ4 A;  1JAJ A;  3C5F A;  4RXP A;  4YMM A;  1V4A A;  8ICQ A;  1U6Z A;  5HRK A;  4NKT A;  2PFO A;  4UBB A;  3JPS A;  1UEU A;  1ZQK A;  2BPG A;  4QFY A;  9ICI A;  4QZ8 A;  8ICX A;  2HEK A;  4I2A A;  2ZHA A;  5EOZ A;  3P3Q A;  4TNX A;  4P4O A;  1ZQJ A;  4KLU A;  7ICF A; 
#chains in the Genus database with same CATH topology
 3AQK A;  5CFS A;  5IIO A;  4X4S A;  3RJH A;  7ICO A;  3RJK A;  4L7E A;  7ICL A;  4F5P A;  5J0Q A;  5J0X A;  1BPD A;  4IQV A;  4K9B A;  4O9M A;  4FO1 A;  4PGY A;  2BPF A;  3I7A A;  2PAR A;  4KLO A;  7ICT A;  4QZD A;  4TNP A;  5J0P A;  4N6W A;  4HX0 A;  2ID1 A;  4R64 A;  4QZF A;  4M0A A;  4KLQ A;  2BCU A;  4NXX A;  4RPY A;  5CHG A;  7ICS A;  2DRB A;  3AU6 A;  3U1N A;  5HRG A;  2P66 A;  4RQ6 A;  4X4R A;  4WC5 A;  9ICK A;  4RWQ A;  3PML A;  4LVS A;  3HC1 A;  4O68 A;  4RQ2 A;  1ZQB A;  5J2J A;  4JLX A;  4WQL A;  7ICI A;  4TNY A;  2M2W A;  3C2M A;  3MGI A;  4E7X A;  3C18 A;  5J2D A;  5DB6 A;  4GXK A;  3RJE A;  3C2K A;  1R8A A;  2ZH8 A;  4QG2 A;  4N7R A;  2BCV A;  2B4V A;  2FMS A;  1UET A;  4AT7 B;  5III A;  4EBK A;  8ICL A;  4QG0 A;  5DDY A;  4AT8 B;  5HRF A;  2ZHB A;  8ICR A;  3RH5 A;  4MLN A;  2Q66 A;  4TNR A;  2PFN A;  5D63 A;  2IHM A;  4YD1 A;  4X0A A;  8ICG A;  1XX7 A;  1KDH A;  4UAZ A;  2PFP A;  5J2I A;  9ICS A;  4RWN A;  5HRD A;  3GDX A;  4R8Z A;  2BPC A;  7ICQ A;  4LT6 A;  4XJE A;  1TVA A;  1ZQC A;  1MIV A;  1BPX A;  4L1J A;  3B0X A;  3LQC B;  3TMD A;  2FMP A;  4UAW A;  4NM1 A;  4EP7 A;  5HRI A;  5J2C A;  3V72 A;  5IIJ A;  5CFU A;  1RPL A;  4MF2 A;  2PBE A;  2HN1 A;  4QZH A;  5TK8 A;  3JPN A;  3PMN A;  4NXZ A;  4I2D A;  4YCX A;  3MEM A;  4M47 A;  3HI0 A;  2EWR A;  5IIM A;  2Q14 A;  9ICE A;  3HJ1 A;  4RPX A;  1ZQE A;  3ERC C;  9ICR A;  5D4B A;  4UD5 A;  4QFZ A;  2ZH2 A;  3RH6 A;  4MKP A;  4YMO A;  3JPP A;  3LK9 A;  4I29 A;  4IQW A;  9ICN A;  9ICW A;  1R8C A;  4O69 A;  3C5G A;  4DOA A;  4FHP A;  4Z6C A;  5F2V O;  4F5Q A;  7ICN A;  2DR7 A;  3C66 A;  1JN3 A;  4UD4 A;  1BPZ A;  2I9G A;  4WBY A;  4KLD A;  4WC1 A;  1VQR A;  4PHA A;  5J2K A;  5BPC A;  4K98 A;  5DED A;  5HRE A;  7ICG A;  8ICP A;  4TO5 A;  4P2H A;  3H37 A;  3RJG A;  4K4H A;  4RXO A;  4O67 A;  4E80 A;  4WC2 A;  4Q2C A;  5AO2 A;  4RT2 A;  4MCW A;  5AO4 A;  1UEV A;  1FA0 A;  5BOM A;  3JYY A;  2PGS A;  4IG8 A;  4Z6D A;  2ISO A;  5J2E A;  3NVO A;  2DVI A;  8ICB A;  4X4P A;  2OGI A;  4WC7 A;  4X4O A;  7ICR A;  4OAF A;  5IIK A;  4X9E A;  4M9L A;  4FH5 A;  4E8F A;  3MDA A;  3OUY A;  4O6A A;  5HRH A;  5D49 A;  2PFQ A;  2PAQ A;  4UB3 A;  2ZH5 A;  4NY8 A;  4K4G A;  4FHY A;  4PPX A;  4MFF A;  1R8B A;  4NXV A;  2DR8 A;  4KLL A;  4FHW A;  4M9J A;  9ICP A;  2CQZ A;  3AQN A;  9ICQ A;  4WH5 A;  5CP2 A;  3JZ0 A;  4WC6 A;  4ZWG A;  5AO3 A;  4ATB B;  4OAH A;  4QQZ A;  4EV6 A;  3NYB A;  1ZQY A;  4K96 A;  1Q78 A;  2NRK A;  1NOM A;  4AT8 A;  4NKU A;  4K97 A;  3SKD A;  2HN2 A;  4ME4 A;  4DO9 A;  4KM5 A;  4M9H A;  3OVB A;  1ZQW A;  3PNC A;  4LEW A;  4UB4 A;  5J29 A;  1ZQQ A;  3V7K A;  2IHO A;  4I2J A;  3OVS A;  4QZC A;  1ZQL A;  4KLG A;  4LEZ A;  3TFR A;  1ZQO A;  4TO4 A;  4EGW A;  5CFT A;  1KEJ A;  4QZE A;  2ZH3 A;  4PGX A;  4RT3 A;  4K99 A;  5DB8 A;  2ZH7 A;  4RXS A;  1XSN A;  4GXJ A;  1ZQF A;  1ZQA A;  4WC3 A;  5IIN A;  5CR0 A;  2BBJ A;  4LEV A;  5CWR A;  5TZV A;  5CA7 A;  4TUS A;  3BG2 A;  3TMC A;  4UB2 A;  4KLT A;  1VFG A;  9ICF A;  9ICM A;  8ICF A;  4AT7 A;  4FHX A;  4XA5 A;  5HRB A;  4PGQ A;  8ICM A;  4MF8 A;  4X4U A;  4DMB A;  3MCR A;  2BE3 A;  4XDS A;  1ZQD A;  1ZQU A;  4M9N A;  3AQM A;  2GZ4 A;  4X4N A;  1YOY A;  3K75 D;  1RZT A;  9ICC A;  8ICI A;  3NWI A;  3WFS C;  2O6I A;  4IQU A;  5J2F A;  3RJF A;  4X5V A;  7ICM A;  3ISD A;  1ZQZ A;  9ICH A;  4TUR A;  7ICK A;  5CHE A;  8ICZ A;  4L7W A;  3UPS A;  7ICE A;  4UB1 A;  4I2I A;  4P4M A;  4I2F A;  4P4P A;  4WQK A;  3H38 A;  5J2B A;  2FMQ A;  3OGU A;  4X4Q A;  3UXP A;  4Q2D A;  4KLS A;  4NXU A;  1ZQT A;  4F5O A;  5AO1 A;  3WFO A;  4RWO A;  4TUP A;  4Q7H A;  4TO0 A;  8ICO A;  3TMB A;  3MBY A;  4RQ5 A;  9ICL A;  8ICJ A;  2HHP A;  1MQ2 A;  5HHH A;  5IIL A;  2BBH A;  4AT9 B;  4MFA A;  3MZO A;  4MDZ A;  5TK6 A;  7ICJ A;  7ICH A;  4K9A A;  4Z6E A;  1WOT A;  8ICK A;  2PXI A;  3SK9 A;  3OUY B;  3PHZ A;  4FH3 A;  5D62 A;  3JPO A;  4NXT A;  1XSP A;  4OAG A;  3UQ0 A;  2W9M A;  1XSL A;  3L9D A;  5D61 A;  5CB1 A;  4LRL A;  4L1J B;  1BPY A;  4I2E A;  2BCS A;  4QZB A;  2DQB A;  2BCQ A;  2ZH1 A;  5CJ7 A;  5BOL A;  5B3Q A;  4ATB A;  3AQL A;  8ICA A;  1BPB A;  3B0Y A;  4WC4 A;  4PHP A;  3JCF A;  1ZQH A;  5HRL A;  2PAU A;  5J2H A;  4TNQ A;  5J0T A;  2PQ7 A;  1HUZ A;  4NLZ A;  4X4T A;  4EBJ A;  4XQ7 A;  4QFX A;  4QQX A;  4YD2 A;  3HIY A;  4I2G A;  4X4V A;  2M2V A;  4WBZ A;  4XQ8 A;  3RF0 A;  2DR5 A;  9ICG A;  9ICA A;  1OU5 A;  5AO0 A;  4NM2 A;  4O5K A;  3UPQ A;  3H39 A;  2M2T A;  4YN4 A;  1ZJM A;  1TFY A;  7ICV A;  1R89 A;  1PX5 A;  8ICE A;  4KLH A;  4I0U A;  4MLM A;  4KLF A;  5DB9 A;  4FO6 A;  3CK6 A;  4O5E A;  4TO3 A;  4YMN A;  3AUO A;  4Z6F A;  4I27 A;  4K4I A;  2RFF A;  4I2H A;  2DRA A;  4DOB A;  4JWN A;  8ICH A;  1YNB A;  1BPE A;  8ICY A;  4BZC A;  4RQ8 A;  3H3A A;  1MIY A;  7ICP A;  4KB6 A;  3HJ4 A;  1GPJ A;  3WFP A;  5DKW A;  3ISC A;  4K8V A;  5HR9 A;  5DDM A;  3V7J A;  4PHD A;  4KLJ A;  9ICB A;  4QG4 A;  5DBC A;  3ISB A;  1TV9 A;  4KLM A;  3WFQ E;  7ICU A;  3TM8 A;  3UQ2 A;  4RQ0 A;  4I2C A;  2GA9 D;  8ICW A;  8ICU A;  4QZA A;  4O5C A;  4I28 A;  3OV7 A;  1ZQV A;  1JQR A;  1ZQN A;  1KNY A;  4RWP A;  9ICJ A;  4JLZ A;  3JPQ A;  2B51 A;  3AU2 A;  2ZH4 A;  2GAF D;  1JMS A;  4LZG A;  4TUQ A;  3NR1 A;  4KLE A;  3NQW A;  4XRH A;  4ZWE A;  8ICT A;  3UXO A;  4NXW A;  4RPZ A;  4OAI Z;  4M2Y A;  4S3N A;  3GW7 A;  1ZQG A;  3WFR E;  3S4L A;  5B3P A;  3IRH A;  4X0B A;  4RXR A;  8ICN A;  3EF2 A;  4BZB A;  2ZH9 A;  4TO2 A;  5TKA A;  4RQ1 A;  4WCW A;  3RJI A;  5DBA A;  1HUO A;  4AT9 A;  1ZQP A;  2DR9 A;  4KLI A;  2FCL A;  4QZI A;  3HW8 A;  4M9G A;  2ZH6 A;  8ICV A;  1ZQX A;  5DBB A;  4WOY A;  5J0U A;  5HC9 A;  1ZQI A;  3MGH A;  4MFC A;  4NLN A;  2ISP A;  2O1P A;  3C2L A;  3NKU A;  4IQT A;  5J0Y A;  4R63 A;  9ICX A;  4DOC A;  5J0O A;  8ICS A;  2IUB A;  4M5D A;  4F5N A;  4TO1 A;  4GXI A;  1YLQ A;  5JTG A;  2B56 A;  1NO5 A;  4F5R A;  3JPT A;  3OVA A;  4QQY A;  5J0S A;  4LZD A;  4MZ7 A;  5HHI A;  5TK7 A;  1ZQS A;  3V7L A;  5D46 A;  4NLK A;  3ER8 C;  5J0R A;  3UXN A;  1F5A A;  4RQ3 A;  5TK9 A;  4R65 A;  1Q79 A;  1VJ7 A;  4LEY A;  1MIW A;  5J0W A;  4JWM A;  9ICU A;  4RXQ A;  2BCR A;  4I2B A;  4N71 A;  3LJX A;  3CCG A;  4TO6 A;  3K7D A;  4QZG A;  4R66 A;  3RH4 A;  2GWS A;  1MQ3 A;  4UAY A;  2O5A A;  8ICC A;  2O08 A;  4PH5 A;  2M2U A;  2VAN A;  1TFW A;  3KQ5 A;  4M04 A;  5DB7 A;  3JPR A;  4QZ9 A;  4UB5 A;  3KH1 A;  4UBC A;  4PHE A;  3HX0 A;  3OWG A;  1ZQR A;  9ICO A;  3M1T A;  3TFS A;  3RJJ A;  9ICT A;  4XUS A;  4QG1 A;  3MDC A;  1ZQM A;  2FLO A;  3HWT A;  4EEB A;  5J2G A;  1ZJN A;  9ICV A;  4QQW A;  5J2A A;  4RQ7 A;  5DEC A;  4TNZ A;  4FHV A;  4WC0 A;  4RQ4 A;  1JAJ A;  4EED A;  3C5F A;  4RXP A;  4YMM A;  1V4A A;  8ICQ A;  1U6Z A;  5HRK A;  4NKT A;  3ER9 B;  2PFO A;  4UBB A;  3JPS A;  1UEU A;  1ZQK A;  2BPG A;  4QFY A;  9ICI A;  4QZ8 A;  8ICX A;  2HEK A;  4I2A A;  2ZHA A;  5EOZ A;  3P3Q A;  4TNX A;  4P4O A;  1ZQJ A;  4KLU A;  7ICF A; 
#chains in the Genus database with same CATH homology
 3AQK A;  5IIO A;  4X4S A;  3RJH A;  7ICO A;  3RJK A;  4L7E A;  7ICL A;  4F5P A;  5J0Q A;  5J0X A;  1BPD A;  4IQV A;  4O9M A;  4PGY A;  2BPF A;  3I7A A;  2PAR A;  4KLO A;  7ICT A;  4QZD A;  4TNP A;  5J0P A;  4N6W A;  2ID1 A;  4R64 A;  4QZF A;  4M0A A;  4KLQ A;  2BCU A;  4RPY A;  5CHG A;  7ICS A;  2DRB A;  3AU6 A;  3U1N A;  5HRG A;  2P66 A;  4RQ6 A;  4X4R A;  4WC5 A;  9ICK A;  4RWQ A;  3PML A;  4LVS A;  3HC1 A;  4RQ2 A;  1ZQB A;  5J2J A;  7ICI A;  4TNY A;  2M2W A;  3C2M A;  3MGI A;  4E7X A;  3C18 A;  5J2D A;  5DB6 A;  4GXK A;  3RJE A;  3C2K A;  1R8A A;  2ZH8 A;  4QG2 A;  2BCV A;  2FMS A;  1UET A;  4AT7 B;  5III A;  4EBK A;  8ICL A;  4QG0 A;  5DDY A;  4AT8 B;  5HRF A;  2ZHB A;  8ICR A;  3RH5 A;  4MLN A;  2Q66 A;  4TNR A;  2PFN A;  2IHM A;  4YD1 A;  4X0A A;  8ICG A;  1XX7 A;  1KDH A;  4UAZ A;  2PFP A;  5J2I A;  9ICS A;  4RWN A;  5HRD A;  3GDX A;  4R8Z A;  2BPC A;  7ICQ A;  4LT6 A;  1TVA A;  1ZQC A;  1MIV A;  1BPX A;  4L1J A;  3B0X A;  3LQC B;  3TMD A;  2FMP A;  4UAW A;  4NM1 A;  4EP7 A;  5HRI A;  5J2C A;  3V72 A;  5IIJ A;  1RPL A;  4MF2 A;  2PBE A;  4QZH A;  5TK8 A;  3JPN A;  3PMN A;  4NXZ A;  4I2D A;  4YCX A;  3MEM A;  4M47 A;  3HI0 A;  5IIM A;  2Q14 A;  9ICE A;  3HJ1 A;  4RPX A;  1ZQE A;  9ICR A;  5D4B A;  4UD5 A;  4QFZ A;  2ZH2 A;  3RH6 A;  4YMO A;  3JPP A;  3LK9 A;  4I29 A;  4IQW A;  9ICN A;  9ICW A;  1R8C A;  3C5G A;  4DOA A;  4FHP A;  4Z6C A;  5F2V O;  4F5Q A;  7ICN A;  2DR7 A;  3C66 A;  1JN3 A;  4UD4 A;  1BPZ A;  2I9G A;  4WBY A;  4KLD A;  4WC1 A;  1VQR A;  4PHA A;  5J2K A;  5BPC A;  5DED A;  5HRE A;  7ICG A;  8ICP A;  4TO5 A;  4P2H A;  3H37 A;  3RJG A;  4K4H A;  4RXO A;  4E80 A;  4WC2 A;  4Q2C A;  5AO2 A;  4RT2 A;  4MCW A;  5AO4 A;  1UEV A;  1FA0 A;  5BOM A;  3JYY A;  2PGS A;  4IG8 A;  4Z6D A;  2ISO A;  5J2E A;  2DVI A;  8ICB A;  4X4P A;  2OGI A;  4WC7 A;  4X4O A;  7ICR A;  5IIK A;  4X9E A;  4M9L A;  4FH5 A;  4E8F A;  3MDA A;  3OUY A;  5HRH A;  5D49 A;  2PFQ A;  2PAQ A;  4UB3 A;  2ZH5 A;  4NY8 A;  4K4G A;  4FHY A;  4PPX A;  4MFF A;  1R8B A;  2DR8 A;  4KLL A;  4FHW A;  4M9J A;  9ICP A;  2CQZ A;  3AQN A;  9ICQ A;  4WC6 A;  5CP2 A;  3JZ0 A;  4ZWG A;  5AO3 A;  4ATB B;  4QQZ A;  3NYB A;  1ZQY A;  1Q78 A;  2NRK A;  1NOM A;  4AT8 A;  4NKU A;  3SKD A;  4DO9 A;  4ME4 A;  4M9H A;  3OVB A;  1ZQW A;  3PNC A;  4UB4 A;  5J29 A;  1ZQQ A;  3V7K A;  4I2J A;  3OVS A;  4QZC A;  1ZQL A;  4KLG A;  3TFR A;  1ZQO A;  4TO4 A;  1KEJ A;  4QZE A;  2ZH3 A;  4PGX A;  4RT3 A;  5DB8 A;  2ZH7 A;  4RXS A;  1XSN A;  4GXJ A;  1ZQF A;  1ZQA A;  4WC3 A;  5IIN A;  5CR0 A;  5CWR A;  5TZV A;  5CA7 A;  4TUS A;  3BG2 A;  3TMC A;  4UB2 A;  4KLT A;  1VFG A;  9ICF A;  9ICM A;  8ICF A;  4AT7 A;  4FHX A;  4XA5 A;  5HRB A;  4PGQ A;  8ICM A;  4MF8 A;  4X4U A;  4DMB A;  2BE3 A;  4XDS A;  1ZQD A;  1ZQU A;  4M9N A;  3AQM A;  2GZ4 A;  4X4N A;  1YOY A;  3K75 D;  1RZT A;  9ICC A;  8ICI A;  3WFS C;  2O6I A;  4IQU A;  5J2F A;  3RJF A;  4X5V A;  7ICM A;  3ISD A;  1ZQZ A;  9ICH A;  4TUR A;  7ICK A;  8ICZ A;  4L7W A;  3UPS A;  7ICE A;  4UB1 A;  4I2I A;  4P4M A;  4I2F A;  4P4P A;  3H38 A;  5J2B A;  2FMQ A;  3OGU A;  4X4Q A;  3UXP A;  4Q2D A;  4KLS A;  1ZQT A;  4F5O A;  5AO1 A;  3WFO A;  4RWO A;  4TUP A;  4Q7H A;  4TO0 A;  8ICO A;  3TMB A;  3MBY A;  4RQ5 A;  9ICL A;  8ICJ A;  2HHP A;  1MQ2 A;  5HHH A;  5IIL A;  4AT9 B;  4MFA A;  3MZO A;  4MDZ A;  5TK6 A;  7ICJ A;  7ICH A;  4Z6E A;  1WOT A;  8ICK A;  2PXI A;  3SK9 A;  3OUY B;  4FH3 A;  3JPO A;  1XSP A;  3UQ0 A;  2W9M A;  1XSL A;  3L9D A;  5CB1 A;  4LRL A;  4L1J B;  1BPY A;  4I2E A;  2BCS A;  4QZB A;  2DQB A;  2BCQ A;  2ZH1 A;  5CJ7 A;  5BOL A;  4ATB A;  3AQL A;  8ICA A;  1BPB A;  3B0Y A;  4WC4 A;  4PHP A;  1ZQH A;  5HRL A;  2PAU A;  5J2H A;  4TNQ A;  5J0T A;  2PQ7 A;  1HUZ A;  4NLZ A;  4X4T A;  4EBJ A;  4XQ7 A;  4QFX A;  4QQX A;  4YD2 A;  3HIY A;  4I2G A;  4X4V A;  2M2V A;  4WBZ A;  4XQ8 A;  3RF0 A;  2DR5 A;  9ICG A;  9ICA A;  1OU5 A;  5AO0 A;  4NM2 A;  4O5K A;  3UPQ A;  3H39 A;  2M2T A;  4YN4 A;  1ZJM A;  1TFY A;  7ICV A;  1R89 A;  1PX5 A;  8ICE A;  4KLH A;  4MLM A;  4KLF A;  5DB9 A;  4FO6 A;  4O5E A;  4TO3 A;  4YMN A;  3AUO A;  4Z6F A;  4I27 A;  4K4I A;  2RFF A;  4I2H A;  2DRA A;  4DOB A;  4JWN A;  8ICH A;  1YNB A;  1BPE A;  8ICY A;  4BZC A;  4RQ8 A;  3H3A A;  1MIY A;  7ICP A;  3HJ4 A;  3WFP A;  5DKW A;  3ISC A;  5DDM A;  5HR9 A;  3V7J A;  4PHD A;  4KLJ A;  9ICB A;  4QG4 A;  5DBC A;  3ISB A;  1TV9 A;  4KLM A;  3WFQ E;  7ICU A;  3TM8 A;  3UQ2 A;  4RQ0 A;  4I2C A;  8ICW A;  8ICU A;  4QZA A;  4O5C A;  4I28 A;  3OV7 A;  1ZQV A;  1JQR A;  1ZQN A;  1KNY A;  4RWP A;  9ICJ A;  3JPQ A;  3AU2 A;  2ZH4 A;  1JMS A;  4LZG A;  4TUQ A;  3NR1 A;  4KLE A;  3NQW A;  4XRH A;  4ZWE A;  8ICT A;  3UXO A;  4RPZ A;  4M2Y A;  4S3N A;  3GW7 A;  1ZQG A;  3WFR E;  3S4L A;  4X0B A;  3IRH A;  4RXR A;  8ICN A;  4BZB A;  2ZH9 A;  4TO2 A;  5TKA A;  4RQ1 A;  4WCW A;  3RJI A;  5DBA A;  1HUO A;  4AT9 A;  1ZQP A;  2DR9 A;  4KLI A;  4M9G A;  4QZI A;  3HW8 A;  8ICV A;  2ZH6 A;  1ZQX A;  5DBB A;  5HC9 A;  5J0U A;  1ZQI A;  4MFC A;  3MGH A;  4NLN A;  2ISP A;  2O1P A;  3C2L A;  4IQT A;  5J0Y A;  4R63 A;  9ICX A;  4DOC A;  5J0O A;  8ICS A;  4M5D A;  4F5N A;  4TO1 A;  4GXI A;  1YLQ A;  1NO5 A;  4F5R A;  3JPT A;  3OVA A;  4QQY A;  5J0S A;  4LZD A;  4MZ7 A;  5HHI A;  5TK7 A;  1ZQS A;  3V7L A;  5D46 A;  4NLK A;  5J0R A;  3UXN A;  1F5A A;  4RQ3 A;  5TK9 A;  4R65 A;  1Q79 A;  1VJ7 A;  1MIW A;  5J0W A;  4JWM A;  9ICU A;  4RXQ A;  2BCR A;  4I2B A;  4N71 A;  3LJX A;  3CCG A;  4TO6 A;  4QZG A;  4R66 A;  3RH4 A;  2GWS A;  1MQ3 A;  4UAY A;  2O5A A;  8ICC A;  2O08 A;  4PH5 A;  2M2U A;  2VAN A;  1TFW A;  3KQ5 A;  4M04 A;  5DB7 A;  3JPR A;  4QZ9 A;  4UB5 A;  3KH1 A;  4UBC A;  4PHE A;  3HX0 A;  1ZQR A;  9ICO A;  3M1T A;  3TFS A;  3RJJ A;  9ICT A;  4XUS A;  4QG1 A;  3MDC A;  1ZQM A;  2FLO A;  3HWT A;  5J2G A;  1ZJN A;  9ICV A;  4QQW A;  5J2A A;  4RQ7 A;  5DEC A;  4TNZ A;  4FHV A;  4WC0 A;  4RQ4 A;  1JAJ A;  3C5F A;  4RXP A;  4YMM A;  1V4A A;  8ICQ A;  1U6Z A;  5HRK A;  4NKT A;  2PFO A;  4UBB A;  3JPS A;  1UEU A;  1ZQK A;  2BPG A;  4QFY A;  9ICI A;  4QZ8 A;  8ICX A;  2HEK A;  4I2A A;  2ZHA A;  5EOZ A;  3P3Q A;  4TNX A;  4P4O A;  1ZQJ A;  4KLU A;  7ICF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...