1VJ7A

Crystal structure of the bifunctional catalytic fragment of relseq, the rela/spot homolog from streptococcus equisimilis.
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
367
structure length
326
Chain Sequence
INLTGEEVVALAAKYMNETDAAFVKKALDYATAAHFYQVRKSGEPYIVHPIQVAGILADLHLDAVTVACGFLHDVVEDTDITLDNIEFDFGKDVRDIVDGVTKLGHRKMLMAMSKDIRVILVKLADRLHNMRTLKQERISRETMEIYAPLAHRLGISRIKWELEDLAFRYLNETEFYKISHMMNEKRREREALVDDIVTKIKSYTTEQGLFGDVYGRPKHIYSIYRKMRDKKKRFDQIFDLIAIRCVMETQSDVYAMVGYIHELWRPMPGRFKDYIAAPKANGYQSIHTTVYGPKGPIEIQIRTKEMHQVAEYGVAANWIKELVEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bifunctional RELA/SPOT
publication title Conformational antagonism between opposing active sites in a bifunctional RelA/SpoT homolog modulates (p)ppGpp metabolism during the stringent response.
pubmed doi rcsb
source organism Streptococcus dysgalactiae subsp. equisimilis
molecule tags Hydrolase, transferase
total genus 119
structure length 326
sequence length 367
chains with identical sequence B
ec nomenclature ec 2.7.6.5: GTP diphosphokinase.
pdb deposition date 2004-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01966 HD HD domain
A PF04607 RelA_SpoT Region found in RelA / SpoT proteins
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3210.10 Mainly Alpha Orthogonal Bundle Hypothetical protein af1432 Hypothetical protein af1432 1vj7A01
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 1vj7A02
4YD2A 1ZQCA 4FHWA 4NKTA 4TNPA 4IQUA 4AT7B 4N6WA 1ZQLA 3P3QA 2BCSA 1JAJA 4XQ7A 4WBYA 1ZQHA 1MIYA 1ZQFA 5F2VO 4QZIA 5J0XA 3ISDA 3MDCA 4P4PA 2DR5A 4PGXA 1MQ3A 2CQZA 2PXIA 5J0WA 3RH4A 7ICUA 4PGYA 4KLJA 1MIWA 4WCWA 4QZHA 4QZEA 4L1JB 5HRDA 5DB9A 3C2KA 1ZQPA 2PGSA 4ZWGA 1ZQIA 4M9NA 4RPXA 8ICHA 4F5QA 3NYBA 4MLNA 4RQ0A 1ZQZA 2BCUA 4X4RA 4WC5A 2VANA 9ICRA 2O5AA 4KLQA 5TKAA 5BOLA 2GWSA 4BZBA 8ICQA 5DBAA 5CHGA 2ISOA 5J2EA 8ICEA 4M04A 4F5NA 4DOCA 2OGIA 1R89A 8ICFA 3TFSA 4WBZA 4RQ8A 1UEUA 4ZWEA 4Z6DA 1OU5A 4MCWA 3RJHA 8ICNA 3GDXA 4I2AA 5CB1A 4TUPA 9ICCA 8ICUA 5HREA 2PQ7A 1ZJMA 4O9MA 2NRKA 7ICSA 1ZQBA 8ICBA 4XRHA 4RWOA 4I2EA 4UB4A 1JQRA 1BPZA 4WC6A 5IINA 3RJKA 4LT6A 4QZFA 4FH5A 4QZ8A 4P4OA 4TO1A 3C66A 3HIYA 3MGHA 5DB7A 5DBBA 3LQCB 2Q66A 8ICKA 4I2IA 9ICOA 9ICQA 3HJ1A 1NOMA 1ZQYA 4I2JA 4QZAA 4NY8A 5HRGA 8ICSA 5IIIA 4QZCA 4UB5A 4IG8A 3RF0A 3UXPA 5AO1A 8ICTA 5TK6A 3MBYA 3AU2A 9ICWA 3I7AA 5TZVA 1WOTA 2ZH5A 3RJFA 4X4NA 4TUQA 3JPSA 4TUSA 4RQ1A 3NR1A 4TNRA 4UD5A 4F5RA 4RXSA 1NO5A 5HRKA 3LJXA 2O08A 2O6IA 4UB2A 4KLEA 5CP2A 5AO0A 4YN4A 4KLSA 1TV9A 3TMDA 5J0QA 2ISPA 2ZH3A 8ICZA 2BCRA 3H38A 1KDHA 4NLZA 1ZQJA 4LVSA 4KLTA 5J2HA 3RJIA 4TO4A 4YMOA 4Q7HA 1ZQXA 3HX0A 3HI0A 2DVIA 8ICMA 3JPQA 3JPNA 5AO2A 4NLNA 4FHPA 4M9LA 2FLOA 4TNXA 5HC9A 4RWNA 4AT8A 2ZH9A 4NM2A 4NKUA 5CJ7A 9ICSA 1F5AA 9ICPA 2BE3A 4L7WA 4I28A 3JPOA 1Q78A 2O1PA 1BPDA 3HWTA 1BPBA 4YD1A 1VQRA 4MFFA 2PFPA 3HJ4A 3UPQA 1MIVA 2ZH7A 8ICLA 2BCQA 5IIKA 3H39A 1ZQEA 4M47A 4X4VA 5HRBA 8ICXA 9ICJA 3RJGA 3UXOA 8ICGA 7ICTA 4PPXA 2ZHAA 3V72A 4YMMA 1BPYA 2DR9A 7ICEA 5CR0A 3WFPA 4WC4A 8ICJA 8ICIA 4RT3A 4P2HA 3WFOA 3ISCA 4KLHA 5J2IA 2GZ4A 5TK9A 1RPLA 3U1NA 5DB8A 4MFAA 4K4GA 4M2YA 1R8BA 2ZH1A 9ICMA 2PARA 4DMBA 4WC0A 1ZQOA 4UBBA 4PGQA 3OVBA 4X4SA 4RQ5A 4R64A 1ZQVA 4MDZA 3MGIA 4DOAA 1TFYA 4TO3A 4MFCA 4M9HA 2PFQA 1FA0A 2RFFA 1YOYA 1BPEA 2PAQA 3OUYA 7ICHA 1PX5A 4RXRA 5J2GA 4EBKA 5CWRA 3UQ2A 4LRLA 4X5VA 1R8AA 4QG4A 4K4HA 4RQ2A 5J2FA 1ZQKA 2DR8A 4I2FA 8ICYA 4UD4A 3OVSA 5D49A 4AT8B 3B0XA 3JPPA 3WFSC 4RQ3A 3NQWA 2IHMA 1ZQMA 3AU6A 3PMLA 2FMPA 2HHPA 3M1TA 4R66A 5D4BA 4K4IA 4E7XA 5DEDA 5J2AA 5CA7A 4QZDA 1XSPA 9ICKA 5J29A 4FHVA 4QZ9A 3UPSA 4F5PA 4EBJA 4MF8A 3RH5A 3OVAA 5J0OA 4TO2A 4DO9A 4YCXA 4RQ6A 1Q79A 2BPCA 5HHIA 9ICLA 3IRHA 4MF2A 2M2WA 5EOZA 1ZQAA 4TO0A 3RJJA 1ZQDA 4QG1A 5J0TA 3AUOA 4KLFA 4MZ7A 8ICVA 4EP7A 4I2DA 3TMCA 1ZQGA 2P66A 7ICRA 4KLLA 2ZH8A 3L9DA 4XA5A 4FO6A 5BPCA 4I2GA 3AQKA 2M2TA 5IIMA 2BPGA 1U6ZA 4Z6FA 4IQWA 7ICJA 1UEVA 4XUSA 4Z6EA 4TNZA 4JWNA 4RXOA 2I9GA 4E80A 1YNBA 1TVAA 3ISBA 4AT9A 5HRHA 3OUYB 4RT2A 5J0RA 3C2MA 4N71A 1RZTA 4KLOA 5IIOA 4O5CA 4PHPA 1HUZA 4X0AA 8ICPA 9ICHA 4TNYA 1MQ2A 4FHXA 5J0PA 9ICFA 4WC2A 4DOBA 3K75D 2DRBA 3H3AA 3LK9A 3JZ0A 3C5FA 5IILA 1XX7A 4P4MA 4X4QA 4QZBA 9ICAA 3C2LA 4GXIA 4M9JA 4WC1A 1ZQWA 4E8FA 3HW8A 3OGUA 3CCGA 3V7JA 1ZQNA 4RPZA 2ID1A 4I29A 4X0BA 3C5GA 4JWMA 5J2DA 2ZH2A 5AO4A 8ICWA 1JMSA 3JPRA 7ICPA 1HUOA 4I2BA 7ICMA 4UAWA 4FHYA 1VFGA 4I2HA 4UB1A 5DDYA 9ICVA 9ICIA 1V4AA 4RXPA 5HRIA 2BCVA 4NLKA 7ICKA 2DQBA 7ICFA 3C18A 3AQMA 4M9GA 1ZJNA 3V7LA 4M5DA 3PMNA 5J2BA 3AQNA 4PH5A 4X4PA 4IQTA 4KLGA 7ICVA 4RQ7A 4TO6A 5J2CA 4QZGA 3JYYA 5J2JA 4PHDA 2PAUA 1KEJA 4AT9B 3H37A 5DDMA 4QFYA 5J0YA 4RWQA 4ATBA 2M2UA 5D46A 4O5EA 8ICCA 4LZGA 5AO3A 9ICGA 5J0SA 7ICNA 7ICGA 3TMBA 4RXQA 4I2CA 2DRAA 3B0YA 5DKWA 2FMSA 2BPFA 2W9MA 7ICLA 1UETA 4KLUA 1XSLA 4QFZA 7ICOA 1ZQTA 4RPYA 4I27A 5BOMA 3OV7A 4X4UA 4AT7A 2PFOA 4X9EA 4M0AA 3V7KA 3MEMA 4Z6CA 3RJEA 3TFRA 4ME4A 1YLQA 9ICXA 4UBCA 4GXJA 1ZQRA 1ZQQA 3PNCA 5DBCA 4UB3A 5HRLA 3WFRE 5TK8A 4FH3A 5J2KA 4S3NA 4WC7A 4L1JA 1ZQSA 3JPTA 4RQ4A 3BG2A 4RWPA 7ICQA 3UXNA 4R63A 4KLDA 3AQLA 9ICTA 5HHHA 3UQ0A 8ICRA 1ZQUA 4XQ8A 1BPXA 2DR7A 2ZH6A 4F5OA 1TFWA 3KH1A 1KNYA 4X4TA 4L7EA 4UAZA 2FMQA 8ICAA 3HC1A 4MLMA 4LZDA 3MDAA 2PFNA 4IQVA 4X4OA 4R8ZA 4YMNA 4WC3A 4UAYA 3WFQE 4PHEA 8ICOA 4TO5A 9ICNA 1VJ7A 9ICBA 4QFXA 4KLIA 5HR9A 5J0UA 4TURA 2M2VA 4ATBB 3RH6A 1XSNA 2ZH4A 4XDSA 1R8CA 4TNQA 7ICIA 4NXZA 4KLMA 5HRFA 2PBEA 9ICUA 3TM8A 4PHAA 4QG2A 5IIJA 4BZCA 4R65A 2Q14A 2ZHBA 3MZOA 5DECA 4QG0A 4NM1A 2HEKA 4GXKA 9ICEA 5DB6A 5TK7A 4O5KA 1JN3A
chains in the Genus database with same CATH superfamily
4YD2A 2FCLA 1ZQCA 4FHWA 4NKTA 4TNPA 4IQUA 4AT7B 4N6WA 1ZQLA 3P3QA 2BCSA 1JAJA 4XQ7A 4WBYA 1ZQHA 1MIYA 1ZQFA 5F2VO 4HX0A 4QZIA 5J0XA 3ISDA 3ER8C 3MDCA 4P4PA 2DR5A 4PGXA 1MQ3A 2CQZA 2PXIA 5J0WA 2B56A 3RH4A 7ICUA 4K9BA 4PGYA 4KLJA 1MIWA 4WCWA 4QZHA 4QZEA 4L1JB 5HRDA 5DB9A 3C2KA 1ZQPA 2PGSA 4ZWGA 1ZQIA 4M9NA 4RPXA 8ICHA 4F5QA 3NYBA 4MLNA 4RQ0A 1ZQZA 2BCUA 4X4RA 4WC5A 2VANA 9ICRA 3OWGA 2O5AA 4KLQA 4EGWA 5TKAA 5BOLA 2GWSA 4BZBA 8ICQA 4MKPA 5DBAA 5CHGA 2ISOA 5J2EA 8ICEA 4K9AA 4M04A 4F5NA 4DOCA 2OGIA 1R89A 2BBHA 8ICFA 3TFSA 4WBZA 4RQ8A 1UEUA 4ZWEA 4Z6DA 1OU5A 4WQLA 4MCWA 3RJHA 8ICNA 3GDXA 4I2AA 5CB1A 4TUPA 9ICCA 2IUBA 8ICUA 5HREA 2PQ7A 1ZJMA 4O9MA 2NRKA 7ICSA 4NXWA 1ZQBA 8ICBA 4XRHA 4RWOA 4I2EA 4UB4A 1JQRA 1BPZA 4O69A 4WC6A 5IINA 3RJKA 4LT6A 4QZFA 4LEVA 4QQWA 4FH5A 4QZ8A 4P4OA 4TO1A 3C66A 3HIYA 3MGHA 5DB7A 5DBBA 3LQCB 4EEDA 2Q66A 3EF2A 8ICKA 4I2IA 9ICOA 9ICQA 3HJ1A 1NOMA 1ZQYA 4K99A 4I2JA 4QZAA 4NY8A 5HRGA 8ICSA 5IIIA 4JLZA 3GW7A 4QZCA 4UB5A 4IG8A 3RF0A 4O67A 3UXPA 5AO1A 8ICTA 5TK6A 3MBYA 3AU2A 9ICWA 4I0UA 3I7AA 5TZVA 1WOTA 2ZH5A 3RJFA 4X4NA 4TUQA 3JPSA 5CFSA 4TUSA 4RQ1A 3NR1A 4NXVA 4TNRA 4UD5A 4F5RA 4RXSA 1NO5A 5HRKA 3LJXA 4O5KA 2O08A 2O6IA 4UB2A 4KLEA 5CP2A 3ERCC 5AO0A 3MCRA 4YN4A 4KLSA 1TV9A 3TMDA 5J0QA 2ISPA 2ZH3A 8ICZA 2BCRA 3H38A 1KDHA 4NLZA 1ZQJA 4LVSA 2IHOA 5J2HA 4KLTA 3RJIA 4TO4A 4YMOA 4Q7HA 1ZQXA 3HX0A 3HI0A 2DVIA 8ICMA 3JPQA 2GAFD 3JPNA 5AO2A 4NLNA 4FHPA 4M9LA 2FLOA 4TNXA 5HC9A 4RWNA 4AT8A 2ZH9A 4NM2A 4NKUA 5CJ7A 9ICSA 1F5AA 9ICPA 2BE3A 4L7WA 4I28A 3JPOA 1Q78A 2O1PA 1BPDA 4FO1A 4OAIZ 3HWTA 1BPBA 4YD1A 4O68A 1VQRA 2B51A 2PFPA 4MFFA 3HJ4A 3UPQA 1MIVA 2ZH7A 8ICLA 2BCQA 5IIKA 4LEWA 3H39A 1ZQEA 4M47A 4X4VA 5HRBA 8ICXA 9ICJA 3RJGA 3UXOA 8ICGA 4O6AA 4KM5A 7ICTA 4PPXA 2ZHAA 3V72A 4OAHA 4YMMA 1BPYA 2DR9A 7ICEA 5CR0A 3WFPA 4WC4A 8ICJA 8ICIA 4WH5A 4RT3A 4P2HA 3WFOA 3ISCA 4KLHA 5J2IA 2GZ4A 5TK9A 1RPLA 3U1NA 5DB8A 4MFAA 4K4GA 4M2YA 1R8BA 2ZH1A 9ICMA 2PARA 4DMBA 4WC0A 1ZQOA 4UBBA 4PGQA 3OVBA 4X4SA 4RQ5A 4R64A 1ZQVA 4MDZA 3MGIA 4DOAA 1TFYA 4TO3A 4MFCA 4M9HA 3NWIA 2PFQA 1FA0A 2RFFA 1YOYA 1BPEA 2PAQA 3OUYA 7ICHA 1PX5A 4RXRA 4EBKA 5CWRA 5J2GA 3UQ2A 4LRLA 4X5VA 1R8AA 4QG4A 5CFUA 4K4HA 4RQ2A 5J2FA 3S4LA 4WQKA 1ZQKA 2DR8A 4I2FA 8ICYA 4UD4A 3OVSA 5D49A 4AT8B 3B0XA 3NKUA 5JTGA 3JPPA 3WFSC 4RQ3A 3NQWA 2IHMA 1ZQMA 3AU6A 3PMLA 2FMPA 2HHPA 3JCFA 3M1TA 4R66A 5D4BA 4K98A 4K4IA 4E7XA 5DEDA 5J2AA 5CA7A 4QZDA 1XSPA 9ICKA 5J29A 4FHVA 4QZ9A 3UPSA 4F5PA 3PHZA 4EBJA 4MF8A 3RH5A 3OVAA 5J0OA 4TO2A 4DO9A 4YCXA 4RQ6A 1Q79A 2BPCA 5HHIA 9ICLA 3IRHA 4MF2A 4KB6A 2M2WA 5EOZA 1ZQAA 4TO0A 2B4VA 3RJJA 1ZQDA 4QG1A 5J0TA 3AUOA 4KLFA 4MZ7A 8ICVA 3SKDA 4EP7A 4I2DA 3TMCA 1ZQGA 2P66A 7ICRA 4KLLA 3CK6A 2ZH8A 4Q2CA 3L9DA 4XA5A 4FO6A 5BPCA 4I2GA 3AQKA 2M2TA 5IIMA 2BPGA 1U6ZA 4Z6FA 4IQWA 7ICJA 4WOYA 1UEVA 4XJEA 4XUSA 4Z6EA 4TNZA 4JWNA 4RXOA 4K96A 2I9GA 3SK9A 4K97A 4E80A 1YNBA 1TVAA 3ISBA 4AT9A 5HRHA 3OUYB 4EV6A 5J0RA 4RT2A 4N71A 3C2MA 1RZTA 4KLOA 5IIOA 4O5CA 2HN1A 4PHPA 1HUZA 4N7RA 4X0AA 8ICPA 9ICHA 4QQXA 4TNYA 5D62A 1MQ2A 4FHXA 5J0PA 9ICFA 4WC2A 4DOBA 3K75D 2DRBA 3H3AA 3LK9A 3JZ0A 3C5FA 5IILA 1XX7A 4P4MA 4X4QA 4QZBA 9ICAA 4LEZA 3C2LA 4GXIA 4M9JA 4QQYA 4WC1A 1ZQWA 4E8FA 3HW8A 4OAFA 3OGUA 3CCGA 3V7JA 5D63A 4NXXA 1ZQNA 4RPZA 2ID1A 4I29A 4K8VA 4Q2DA 4X0BA 3C5GA 4JWMA 5J2DA 2ZH2A 5AO4A 8ICWA 1JMSA 3JPRA 7ICPA 1GPJA 1HUOA 4I2BA 7ICMA 4UAWA 4FHYA 1VFGA 4I2HA 4UB1A 5DDYA 9ICVA 9ICIA 1V4AA 4RXPA 5HRIA 2BCVA 4NLKA 7ICKA 4OAGA 2DQBA 5CHEA 7ICFA 3C18A 3AQMA 4M9GA 5B3QA 1ZJNA 3V7LA 4M5DA 3PMNA 5J2BA 3AQNA 4PH5A 4X4PA 4IQTA 4KLGA 7ICVA 4RQ7A 4TO6A 5J2CA 4QZGA 3JYYA 5J2JA 4PHDA 2PAUA 1KEJA 4AT9B 3H37A 5DDMA 4QFYA 5J0YA 4RWQA 4ATBA 2M2UA 5D46A 4O5EA 8ICCA 4LZGA 5AO3A 9ICGA 5J0SA 7ICNA 7ICGA 3TMBA 4RXQA 4I2CA 2DRAA 3B0YA 5DKWA 2FMSA 2BPFA 2W9MA 5D61A 7ICLA 1UETA 4EEBA 4KLUA 1XSLA 4QFZA 7ICOA 1ZQTA 4RPYA 4I27A 5BOMA 3OV7A 4X4UA 4AT7A 2PFOA 3ER9B 5CFTA 4X9EA 3NVOA 4M0AA 3V7KA 3MEMA 4Z6CA 3RJEA 3TFRA 4ME4A 1YLQA 9ICXA 4UBCA 4GXJA 1ZQRA 1ZQQA 3PNCA 5DBCA 4UB3A 5HRLA 3WFRE 5TK8A 4FH3A 5J2KA 4S3NA 4WC7A 4L1JA 1ZQSA 3JPTA 4RQ4A 3BG2A 4RWPA 7ICQA 3UXNA 4R63A 4KLDA 3AQLA 9ICTA 5HHHA 3UQ0A 8ICRA 1ZQUA 4XQ8A 1BPXA 2DR7A 2ZH6A 4NXUA 4F5OA 4NXTA 1TFWA 4LEYA 3KH1A 1KNYA 4X4TA 5B3PA 4L7EA 4UAZA 2FMQA 8ICAA 3HC1A 4MLMA 4LZDA 3MDAA 2PFNA 4IQVA 4X4OA 4R8ZA 4YMNA 4WC3A 2HN2A 4UAYA 3WFQE 4JLXA 4PHEA 8ICOA 4TO5A 9ICNA 1VJ7A 9ICBA 4QFXA 4KLIA 5HR9A 5J0UA 4TURA 4QQZA 2M2VA 4ATBB 3RH6A 1XSNA 2ZH4A 4XDSA 1R8CA 2GA9D 4TNQA 7ICIA 4NXZA 3K7DA 4KLMA 5HRFA 2PBEA 9ICUA 3TM8A 4PHAA 3KQ5A 2BBJA 4QG2A 5IIJA 4BZCA 4R65A 2Q14A 2ZHBA 3MZOA 5DECA 4QG0A 4NM1A 2HEKA 4GXKA 9ICEA 5DB6A 5TK7A 2EWRA 1JN3A
chains in the Genus database with same CATH topology
4YD2A 1ZQCA 4FHWA 4NKTA 4TNPA 4IQUA 4AT7B 4N6WA 1ZQLA 3P3QA 2BCSA 1JAJA 4XQ7A 4WBYA 1ZQHA 1MIYA 1ZQFA 5F2VO 4QZIA 5J0XA 3ISDA 3MDCA 4P4PA 2DR5A 4PGXA 1MQ3A 2CQZA 2PXIA 5J0WA 3RH4A 7ICUA 4PGYA 4KLJA 1MIWA 4WCWA 4QZHA 4QZEA 4L1JB 5HRDA 5DB9A 3C2KA 1ZQPA 2PGSA 4ZWGA 1ZQIA 4M9NA 4RPXA 8ICHA 4F5QA 3NYBA 4MLNA 4RQ0A 1ZQZA 2BCUA 4X4RA 4WC5A 2VANA 9ICRA 2O5AA 4KLQA 5TKAA 5BOLA 2GWSA 4BZBA 8ICQA 5DBAA 5CHGA 2ISOA 5J2EA 8ICEA 4M04A 4F5NA 4DOCA 2OGIA 1R89A 8ICFA 3TFSA 4WBZA 4RQ8A 1UEUA 4ZWEA 4Z6DA 1OU5A 4MCWA 3RJHA 8ICNA 3GDXA 4I2AA 5CB1A 4TUPA 9ICCA 8ICUA 5HREA 2PQ7A 1ZJMA 4O9MA 2NRKA 7ICSA 1ZQBA 8ICBA 4XRHA 4RWOA 4I2EA 4UB4A 1JQRA 1BPZA 4WC6A 5IINA 3RJKA 4LT6A 4QZFA 4QQWA 4FH5A 4QZ8A 4P4OA 4TO1A 3C66A 3HIYA 3MGHA 5DBBA 5DB7A 3LQCB 2Q66A 8ICKA 4I2IA 9ICOA 9ICQA 3HJ1A 1NOMA 1ZQYA 4I2JA 4QZAA 4NY8A 5HRGA 8ICSA 5IIIA 3GW7A 4QZCA 4UB5A 4IG8A 3RF0A 3UXPA 5AO1A 8ICTA 5TK6A 3MBYA 3AU2A 9ICWA 3I7AA 5TZVA 1WOTA 2ZH5A 3RJFA 4X4NA 4TUQA 3JPSA 4TUSA 4RQ1A 3NR1A 4TNRA 4UD5A 4F5RA 4RXSA 1NO5A 5HRKA 3LJXA 2O08A 2O6IA 4UB2A 4KLEA 5CP2A 5AO0A 4YN4A 4KLSA 1TV9A 3TMDA 5J0QA 2ISPA 2ZH3A 8ICZA 2BCRA 3H38A 1KDHA 4NLZA 1ZQJA 4LVSA 4KLTA 5J2HA 3RJIA 4TO4A 4YMOA 4Q7HA 1ZQXA 3HX0A 3HI0A 2DVIA 8ICMA 3JPQA 3JPNA 5AO2A 4NLNA 4FHPA 4M9LA 2FLOA 4TNXA 5HC9A 4RWNA 4AT8A 2ZH9A 4NM2A 4NKUA 5CJ7A 9ICSA 1F5AA 9ICPA 2BE3A 4L7WA 4I28A 3JPOA 1Q78A 2O1PA 1BPDA 3HWTA 1BPBA 4YD1A 1VQRA 4MFFA 2PFPA 3HJ4A 3UPQA 1MIVA 2ZH7A 8ICLA 2BCQA 5IIKA 3H39A 1ZQEA 4M47A 4X4VA 5HRBA 8ICXA 9ICJA 3RJGA 3UXOA 8ICGA 7ICTA 4PPXA 2ZHAA 3V72A 4YMMA 1BPYA 2DR9A 7ICEA 5CR0A 3WFPA 4WC4A 8ICJA 8ICIA 4RT3A 4P2HA 3WFOA 3ISCA 4KLHA 5J2IA 2GZ4A 5TK9A 1RPLA 3U1NA 5DB8A 4MFAA 4K4GA 4M2YA 1R8BA 2ZH1A 9ICMA 2PARA 4DMBA 4WC0A 1ZQOA 4UBBA 4PGQA 3OVBA 4X4SA 4RQ5A 4R64A 1ZQVA 4MDZA 3MGIA 4DOAA 1TFYA 4TO3A 4MFCA 4M9HA 2PFQA 1FA0A 2RFFA 1YOYA 1BPEA 2PAQA 3OUYA 7ICHA 1PX5A 4RXRA 4EBKA 5CWRA 5J2GA 3UQ2A 4LRLA 4X5VA 1R8AA 4QG4A 4K4HA 4RQ2A 5J2FA 3S4LA 1ZQKA 2DR8A 4I2FA 8ICYA 4UD4A 3OVSA 5D49A 4AT8B 3B0XA 3JPPA 3WFSC 4RQ3A 3NQWA 2IHMA 1ZQMA 3AU6A 3PMLA 2FMPA 2HHPA 3M1TA 4R66A 5D4BA 4K4IA 4E7XA 5DEDA 5J2AA 5CA7A 4QZDA 1XSPA 9ICKA 5J29A 4FHVA 4QZ9A 3UPSA 4F5PA 4EBJA 4MF8A 3RH5A 3OVAA 5J0OA 4TO2A 4DO9A 4YCXA 4RQ6A 1Q79A 2BPCA 5HHIA 9ICLA 3IRHA 4MF2A 2M2WA 5EOZA 1ZQAA 4TO0A 3RJJA 1ZQDA 4QG1A 5J0TA 3AUOA 4KLFA 4MZ7A 8ICVA 3SKDA 4EP7A 4I2DA 3TMCA 1ZQGA 2P66A 7ICRA 4KLLA 2ZH8A 4Q2CA 3L9DA 4XA5A 4FO6A 5BPCA 4I2GA 3AQKA 2M2TA 5IIMA 2BPGA 1U6ZA 4Z6FA 4IQWA 7ICJA 1UEVA 4XUSA 4Z6EA 4TNZA 4JWNA 4RXOA 2I9GA 3SK9A 4E80A 1YNBA 1TVAA 3ISBA 4AT9A 5HRHA 3OUYB 4RT2A 5J0RA 3C2MA 4N71A 1RZTA 4KLOA 5IIOA 4O5CA 4PHPA 1HUZA 4X0AA 8ICPA 9ICHA 4QQXA 4TNYA 1MQ2A 4FHXA 5J0PA 9ICFA 4WC2A 4DOBA 3K75D 2DRBA 3H3AA 3LK9A 3JZ0A 3C5FA 5IILA 1XX7A 4P4MA 4X4QA 4QZBA 9ICAA 3C2LA 4GXIA 4M9JA 4QQYA 4WC1A 1ZQWA 4E8FA 3HW8A 3OGUA 3CCGA 3V7JA 1ZQNA 4RPZA 2ID1A 4I29A 4Q2DA 4X0BA 3C5GA 4JWMA 5J2DA 2ZH2A 5AO4A 8ICWA 1JMSA 3JPRA 7ICPA 1HUOA 4I2BA 7ICMA 4UAWA 4FHYA 1VFGA 4I2HA 4UB1A 5DDYA 9ICVA 9ICIA 1V4AA 4RXPA 5HRIA 2BCVA 4NLKA 7ICKA 2DQBA 7ICFA 3C18A 3AQMA 4M9GA 1ZJNA 3V7LA 4M5DA 3PMNA 5J2BA 3AQNA 4PH5A 4X4PA 4IQTA 4KLGA 7ICVA 4RQ7A 4TO6A 5J2CA 4QZGA 3JYYA 5J2JA 4PHDA 2PAUA 1KEJA 4AT9B 3H37A 5DDMA 4QFYA 5J0YA 4RWQA 4ATBA 2M2UA 5D46A 4O5EA 8ICCA 4LZGA 5AO3A 9ICGA 5J0SA 7ICNA 7ICGA 3TMBA 4RXQA 4I2CA 2DRAA 3B0YA 5DKWA 2FMSA 2BPFA 2W9MA 7ICLA 1UETA 4KLUA 1XSLA 4QFZA 7ICOA 1ZQTA 4RPYA 4I27A 5BOMA 3OV7A 4X4UA 4AT7A 2PFOA 4X9EA 4M0AA 3V7KA 3MEMA 4Z6CA 3RJEA 3TFRA 4ME4A 1YLQA 9ICXA 4UBCA 4GXJA 1ZQRA 1ZQQA 3PNCA 5DBCA 4UB3A 5HRLA 3WFRE 5TK8A 4FH3A 5J2KA 4S3NA 4WC7A 4L1JA 1ZQSA 3JPTA 4RQ4A 3BG2A 4RWPA 7ICQA 3UXNA 4R63A 4KLDA 3AQLA 9ICTA 5HHHA 3UQ0A 8ICRA 1ZQUA 4XQ8A 1BPXA 2DR7A 2ZH6A 4F5OA 1TFWA 3KH1A 1KNYA 4X4TA 4L7EA 4UAZA 2FMQA 8ICAA 3HC1A 4MLMA 4LZDA 3MDAA 2PFNA 4IQVA 4X4OA 4R8ZA 4YMNA 4WC3A 4UAYA 3WFQE 4PHEA 8ICOA 4TO5A 9ICNA 1VJ7A 9ICBA 4QFXA 4KLIA 5HR9A 5J0UA 4TURA 4QQZA 2M2VA 4ATBB 3RH6A 1XSNA 2ZH4A 4XDSA 1R8CA 4TNQA 7ICIA 4NXZA 4KLMA 5HRFA 2PBEA 9ICUA 3TM8A 4PHAA 3KQ5A 4QG2A 5IIJA 4BZCA 4R65A 2Q14A 2ZHBA 3MZOA 5DECA 4QG0A 4NM1A 2HEKA 4GXKA 9ICEA 5DB6A 5TK7A 4O5KA 1JN3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YD2 A;  1ZQC A;  4FHW A;  4NKT A;  4TNP A;  4IQU A;  4AT7 B;  4N6W A;  1ZQL A;  3P3Q A;  2BCS A;  1JAJ A;  4XQ7 A;  4WBY A;  1ZQH A;  1MIY A;  1ZQF A;  5F2V O;  4QZI A;  5J0X A;  3ISD A;  3MDC A;  4P4P A;  2DR5 A;  4PGX A;  1MQ3 A;  2CQZ A;  2PXI A;  5J0W A;  3RH4 A;  7ICU A;  4PGY A;  4KLJ A;  1MIW A;  4WCW A;  4QZH A;  4QZE A;  4L1J B;  5HRD A;  5DB9 A;  3C2K A;  1ZQP A;  2PGS A;  4ZWG A;  1ZQI A;  4M9N A;  4RPX A;  8ICH A;  4F5Q A;  3NYB A;  4MLN A;  4RQ0 A;  1ZQZ A;  2BCU A;  4X4R A;  4WC5 A;  2VAN A;  9ICR A;  2O5A A;  4KLQ A;  5TKA A;  5BOL A;  2GWS A;  4BZB A;  8ICQ A;  5DBA A;  5CHG A;  2ISO A;  5J2E A;  8ICE A;  4M04 A;  4F5N A;  4DOC A;  2OGI A;  1R89 A;  8ICF A;  3TFS A;  4WBZ A;  4RQ8 A;  1UEU A;  4ZWE A;  4Z6D A;  1OU5 A;  4MCW A;  3RJH A;  8ICN A;  3GDX A;  4I2A A;  5CB1 A;  4TUP A;  9ICC A;  8ICU A;  5HRE A;  2PQ7 A;  1ZJM A;  4O9M A;  2NRK A;  7ICS A;  1ZQB A;  8ICB A;  4XRH A;  4RWO A;  4I2E A;  4UB4 A;  1JQR A;  1BPZ A;  4WC6 A;  5IIN A;  3RJK A;  4LT6 A;  4QZF A;  4FH5 A;  4QZ8 A;  4P4O A;  4TO1 A;  3C66 A;  3HIY A;  3MGH A;  5DB7 A;  5DBB A;  3LQC B;  2Q66 A;  8ICK A;  4I2I A;  9ICO A;  9ICQ A;  3HJ1 A;  1NOM A;  1ZQY A;  4I2J A;  4QZA A;  4NY8 A;  5HRG A;  8ICS A;  5III A;  4QZC A;  4UB5 A;  4IG8 A;  3RF0 A;  3UXP A;  5AO1 A;  8ICT A;  5TK6 A;  3MBY A;  3AU2 A;  9ICW A;  3I7A A;  5TZV A;  1WOT A;  2ZH5 A;  3RJF A;  4X4N A;  4TUQ A;  3JPS A;  4TUS A;  4RQ1 A;  3NR1 A;  4TNR A;  4UD5 A;  4F5R A;  4RXS A;  1NO5 A;  5HRK A;  3LJX A;  2O08 A;  2O6I A;  4UB2 A;  4KLE A;  5CP2 A;  5AO0 A;  4YN4 A;  4KLS A;  1TV9 A;  3TMD A;  5J0Q A;  2ISP A;  2ZH3 A;  8ICZ A;  2BCR A;  3H38 A;  1KDH A;  4NLZ A;  1ZQJ A;  4LVS A;  4KLT A;  5J2H A;  3RJI A;  4TO4 A;  4YMO A;  4Q7H A;  1ZQX A;  3HX0 A;  3HI0 A;  2DVI A;  8ICM A;  3JPQ A;  3JPN A;  5AO2 A;  4NLN A;  4FHP A;  4M9L A;  2FLO A;  4TNX A;  5HC9 A;  4RWN A;  4AT8 A;  2ZH9 A;  4NM2 A;  4NKU A;  5CJ7 A;  9ICS A;  1F5A A;  9ICP A;  2BE3 A;  4L7W A;  4I28 A;  3JPO A;  1Q78 A;  2O1P A;  1BPD A;  3HWT A;  1BPB A;  4YD1 A;  1VQR A;  4MFF A;  2PFP A;  3HJ4 A;  3UPQ A;  1MIV A;  2ZH7 A;  8ICL A;  2BCQ A;  5IIK A;  3H39 A;  1ZQE A;  4M47 A;  4X4V A;  5HRB A;  8ICX A;  9ICJ A;  3RJG A;  3UXO A;  8ICG A;  7ICT A;  4PPX A;  2ZHA A;  3V72 A;  4YMM A;  1BPY A;  2DR9 A;  7ICE A;  5CR0 A;  3WFP A;  4WC4 A;  8ICJ A;  8ICI A;  4RT3 A;  4P2H A;  3WFO A;  3ISC A;  4KLH A;  5J2I A;  2GZ4 A;  5TK9 A;  1RPL A;  3U1N A;  5DB8 A;  4MFA A;  4K4G A;  4M2Y A;  1R8B A;  2ZH1 A;  9ICM A;  2PAR A;  4DMB A;  4WC0 A;  1ZQO A;  4UBB A;  4PGQ A;  3OVB A;  4X4S A;  4RQ5 A;  4R64 A;  1ZQV A;  4MDZ A;  3MGI A;  4DOA A;  1TFY A;  4TO3 A;  4MFC A;  4M9H A;  2PFQ A;  1FA0 A;  2RFF A;  1YOY A;  1BPE A;  2PAQ A;  3OUY A;  7ICH A;  1PX5 A;  4RXR A;  5J2G A;  4EBK A;  5CWR A;  3UQ2 A;  4LRL A;  4X5V A;  1R8A A;  4QG4 A;  4K4H A;  4RQ2 A;  5J2F A;  1ZQK A;  2DR8 A;  4I2F A;  8ICY A;  4UD4 A;  3OVS A;  5D49 A;  4AT8 B;  3B0X A;  3JPP A;  3WFS C;  4RQ3 A;  3NQW A;  2IHM A;  1ZQM A;  3AU6 A;  3PML A;  2FMP A;  2HHP A;  3M1T A;  4R66 A;  5D4B A;  4K4I A;  4E7X A;  5DED A;  5J2A A;  5CA7 A;  4QZD A;  1XSP A;  9ICK A;  5J29 A;  4FHV A;  4QZ9 A;  3UPS A;  4F5P A;  4EBJ A;  4MF8 A;  3RH5 A;  3OVA A;  5J0O A;  4TO2 A;  4DO9 A;  4YCX A;  4RQ6 A;  1Q79 A;  2BPC A;  5HHI A;  9ICL A;  3IRH A;  4MF2 A;  2M2W A;  5EOZ A;  1ZQA A;  4TO0 A;  3RJJ A;  1ZQD A;  4QG1 A;  5J0T A;  3AUO A;  4KLF A;  4MZ7 A;  8ICV A;  4EP7 A;  4I2D A;  3TMC A;  1ZQG A;  2P66 A;  7ICR A;  4KLL A;  2ZH8 A;  3L9D A;  4XA5 A;  4FO6 A;  5BPC A;  4I2G A;  3AQK A;  2M2T A;  5IIM A;  2BPG A;  1U6Z A;  4Z6F A;  4IQW A;  7ICJ A;  1UEV A;  4XUS A;  4Z6E A;  4TNZ A;  4JWN A;  4RXO A;  2I9G A;  4E80 A;  1YNB A;  1TVA A;  3ISB A;  4AT9 A;  5HRH A;  3OUY B;  4RT2 A;  5J0R A;  3C2M A;  4N71 A;  1RZT A;  4KLO A;  5IIO A;  4O5C A;  4PHP A;  1HUZ A;  4X0A A;  8ICP A;  9ICH A;  4TNY A;  1MQ2 A;  4FHX A;  5J0P A;  9ICF A;  4WC2 A;  4DOB A;  3K75 D;  2DRB A;  3H3A A;  3LK9 A;  3JZ0 A;  3C5F A;  5IIL A;  1XX7 A;  4P4M A;  4X4Q A;  4QZB A;  9ICA A;  3C2L A;  4GXI A;  4M9J A;  4WC1 A;  1ZQW A;  4E8F A;  3HW8 A;  3OGU A;  3CCG A;  3V7J A;  1ZQN A;  4RPZ A;  2ID1 A;  4I29 A;  4X0B A;  3C5G A;  4JWM A;  5J2D A;  2ZH2 A;  5AO4 A;  8ICW A;  1JMS A;  3JPR A;  7ICP A;  1HUO A;  4I2B A;  7ICM A;  4UAW A;  4FHY A;  1VFG A;  4I2H A;  4UB1 A;  5DDY A;  9ICV A;  9ICI A;  1V4A A;  4RXP A;  5HRI A;  2BCV A;  4NLK A;  7ICK A;  2DQB A;  7ICF A;  3C18 A;  3AQM A;  4M9G A;  1ZJN A;  3V7L A;  4M5D A;  3PMN A;  5J2B A;  3AQN A;  4PH5 A;  4X4P A;  4IQT A;  4KLG A;  7ICV A;  4RQ7 A;  4TO6 A;  5J2C A;  4QZG A;  3JYY A;  5J2J A;  4PHD A;  2PAU A;  1KEJ A;  4AT9 B;  3H37 A;  5DDM A;  4QFY A;  5J0Y A;  4RWQ A;  4ATB A;  2M2U A;  5D46 A;  4O5E A;  8ICC A;  4LZG A;  5AO3 A;  9ICG A;  5J0S A;  7ICN A;  7ICG A;  3TMB A;  4RXQ A;  4I2C A;  2DRA A;  3B0Y A;  5DKW A;  2FMS A;  2BPF A;  2W9M A;  7ICL A;  1UET A;  4KLU A;  1XSL A;  4QFZ A;  7ICO A;  1ZQT A;  4RPY A;  4I27 A;  5BOM A;  3OV7 A;  4X4U A;  4AT7 A;  2PFO A;  4X9E A;  4M0A A;  3V7K A;  3MEM A;  4Z6C A;  3RJE A;  3TFR A;  4ME4 A;  1YLQ A;  9ICX A;  4UBC A;  4GXJ A;  1ZQR A;  1ZQQ A;  3PNC A;  5DBC A;  4UB3 A;  5HRL A;  3WFR E;  5TK8 A;  4FH3 A;  5J2K A;  4S3N A;  4WC7 A;  4L1J A;  1ZQS A;  3JPT A;  4RQ4 A;  3BG2 A;  4RWP A;  7ICQ A;  3UXN A;  4R63 A;  4KLD A;  3AQL A;  9ICT A;  5HHH A;  3UQ0 A;  8ICR A;  1ZQU A;  4XQ8 A;  1BPX A;  2DR7 A;  2ZH6 A;  4F5O A;  1TFW A;  3KH1 A;  1KNY A;  4X4T A;  4L7E A;  4UAZ A;  2FMQ A;  8ICA A;  3HC1 A;  4MLM A;  4LZD A;  3MDA A;  2PFN A;  4IQV A;  4X4O A;  4R8Z A;  4YMN A;  4WC3 A;  4UAY A;  3WFQ E;  4PHE A;  8ICO A;  4TO5 A;  9ICN A;  1VJ7 A;  9ICB A;  4QFX A;  4KLI A;  5HR9 A;  5J0U A;  4TUR A;  2M2V A;  4ATB B;  3RH6 A;  1XSN A;  2ZH4 A;  4XDS A;  1R8C A;  4TNQ A;  7ICI A;  4NXZ A;  4KLM A;  5HRF A;  2PBE A;  9ICU A;  3TM8 A;  4PHA A;  4QG2 A;  5IIJ A;  4BZC A;  4R65 A;  2Q14 A;  2ZHB A;  3MZO A;  5DEC A;  4QG0 A;  4NM1 A;  2HEK A;  4GXK A;  9ICE A;  5DB6 A;  5TK7 A;  4O5K A;  1JN3 A; 
#chains in the Genus database with same CATH topology
 4YD2 A;  2FCL A;  1ZQC A;  4FHW A;  4NKT A;  4TNP A;  4IQU A;  4AT7 B;  4N6W A;  1ZQL A;  3P3Q A;  2BCS A;  1JAJ A;  4XQ7 A;  4WBY A;  1ZQH A;  1MIY A;  1ZQF A;  5F2V O;  4HX0 A;  4QZI A;  5J0X A;  3ISD A;  3ER8 C;  3MDC A;  4P4P A;  2DR5 A;  4PGX A;  1MQ3 A;  2CQZ A;  2PXI A;  5J0W A;  2B56 A;  3RH4 A;  7ICU A;  4K9B A;  4PGY A;  4KLJ A;  1MIW A;  4WCW A;  4QZH A;  4QZE A;  4L1J B;  5HRD A;  5DB9 A;  3C2K A;  1ZQP A;  2PGS A;  4ZWG A;  1ZQI A;  4M9N A;  4RPX A;  8ICH A;  4F5Q A;  3NYB A;  4MLN A;  4RQ0 A;  1ZQZ A;  2BCU A;  4X4R A;  4WC5 A;  2VAN A;  9ICR A;  3OWG A;  2O5A A;  4KLQ A;  4EGW A;  5TKA A;  5BOL A;  2GWS A;  4BZB A;  8ICQ A;  4MKP A;  5DBA A;  5CHG A;  2ISO A;  5J2E A;  8ICE A;  4K9A A;  4M04 A;  4F5N A;  4DOC A;  2OGI A;  1R89 A;  2BBH A;  8ICF A;  3TFS A;  4WBZ A;  4RQ8 A;  1UEU A;  4ZWE A;  4Z6D A;  1OU5 A;  4WQL A;  4MCW A;  3RJH A;  8ICN A;  3GDX A;  4I2A A;  5CB1 A;  4TUP A;  9ICC A;  2IUB A;  8ICU A;  5HRE A;  2PQ7 A;  1ZJM A;  4O9M A;  2NRK A;  7ICS A;  4NXW A;  1ZQB A;  8ICB A;  4XRH A;  4RWO A;  4I2E A;  4UB4 A;  1JQR A;  1BPZ A;  4O69 A;  4WC6 A;  5IIN A;  3RJK A;  4LT6 A;  4QZF A;  4LEV A;  4QQW A;  4FH5 A;  4QZ8 A;  4P4O A;  4TO1 A;  3C66 A;  3HIY A;  3MGH A;  5DB7 A;  5DBB A;  3LQC B;  4EED A;  2Q66 A;  3EF2 A;  8ICK A;  4I2I A;  9ICO A;  9ICQ A;  3HJ1 A;  1NOM A;  1ZQY A;  4K99 A;  4I2J A;  4QZA A;  4NY8 A;  5HRG A;  8ICS A;  5III A;  4JLZ A;  3GW7 A;  4QZC A;  4UB5 A;  4IG8 A;  3RF0 A;  4O67 A;  3UXP A;  5AO1 A;  8ICT A;  5TK6 A;  3MBY A;  3AU2 A;  9ICW A;  4I0U A;  3I7A A;  5TZV A;  1WOT A;  2ZH5 A;  3RJF A;  4X4N A;  4TUQ A;  3JPS A;  5CFS A;  4TUS A;  4RQ1 A;  3NR1 A;  4NXV A;  4TNR A;  4UD5 A;  4F5R A;  4RXS A;  1NO5 A;  5HRK A;  3LJX A;  4O5K A;  2O08 A;  2O6I A;  4UB2 A;  4KLE A;  5CP2 A;  3ERC C;  5AO0 A;  3MCR A;  4YN4 A;  4KLS A;  1TV9 A;  3TMD A;  5J0Q A;  2ISP A;  2ZH3 A;  8ICZ A;  2BCR A;  3H38 A;  1KDH A;  4NLZ A;  1ZQJ A;  4LVS A;  2IHO A;  5J2H A;  4KLT A;  3RJI A;  4TO4 A;  4YMO A;  4Q7H A;  1ZQX A;  3HX0 A;  3HI0 A;  2DVI A;  8ICM A;  3JPQ A;  2GAF D;  3JPN A;  5AO2 A;  4NLN A;  4FHP A;  4M9L A;  2FLO A;  4TNX A;  5HC9 A;  4RWN A;  4AT8 A;  2ZH9 A;  4NM2 A;  4NKU A;  5CJ7 A;  9ICS A;  1F5A A;  9ICP A;  2BE3 A;  4L7W A;  4I28 A;  3JPO A;  1Q78 A;  2O1P A;  1BPD A;  4FO1 A;  4OAI Z;  3HWT A;  1BPB A;  4YD1 A;  4O68 A;  1VQR A;  2B51 A;  2PFP A;  4MFF A;  3HJ4 A;  3UPQ A;  1MIV A;  2ZH7 A;  8ICL A;  2BCQ A;  5IIK A;  4LEW A;  3H39 A;  1ZQE A;  4M47 A;  4X4V A;  5HRB A;  8ICX A;  9ICJ A;  3RJG A;  3UXO A;  8ICG A;  4O6A A;  4KM5 A;  7ICT A;  4PPX A;  2ZHA A;  3V72 A;  4OAH A;  4YMM A;  1BPY A;  2DR9 A;  7ICE A;  5CR0 A;  3WFP A;  4WC4 A;  8ICJ A;  8ICI A;  4WH5 A;  4RT3 A;  4P2H A;  3WFO A;  3ISC A;  4KLH A;  5J2I A;  2GZ4 A;  5TK9 A;  1RPL A;  3U1N A;  5DB8 A;  4MFA A;  4K4G A;  4M2Y A;  1R8B A;  2ZH1 A;  9ICM A;  2PAR A;  4DMB A;  4WC0 A;  1ZQO A;  4UBB A;  4PGQ A;  3OVB A;  4X4S A;  4RQ5 A;  4R64 A;  1ZQV A;  4MDZ A;  3MGI A;  4DOA A;  1TFY A;  4TO3 A;  4MFC A;  4M9H A;  3NWI A;  2PFQ A;  1FA0 A;  2RFF A;  1YOY A;  1BPE A;  2PAQ A;  3OUY A;  7ICH A;  1PX5 A;  4RXR A;  4EBK A;  5CWR A;  5J2G A;  3UQ2 A;  4LRL A;  4X5V A;  1R8A A;  4QG4 A;  5CFU A;  4K4H A;  4RQ2 A;  5J2F A;  3S4L A;  4WQK A;  1ZQK A;  2DR8 A;  4I2F A;  8ICY A;  4UD4 A;  3OVS A;  5D49 A;  4AT8 B;  3B0X A;  3NKU A;  5JTG A;  3JPP A;  3WFS C;  4RQ3 A;  3NQW A;  2IHM A;  1ZQM A;  3AU6 A;  3PML A;  2FMP A;  2HHP A;  3JCF A;  3M1T A;  4R66 A;  5D4B A;  4K98 A;  4K4I A;  4E7X A;  5DED A;  5J2A A;  5CA7 A;  4QZD A;  1XSP A;  9ICK A;  5J29 A;  4FHV A;  4QZ9 A;  3UPS A;  4F5P A;  3PHZ A;  4EBJ A;  4MF8 A;  3RH5 A;  3OVA A;  5J0O A;  4TO2 A;  4DO9 A;  4YCX A;  4RQ6 A;  1Q79 A;  2BPC A;  5HHI A;  9ICL A;  3IRH A;  4MF2 A;  4KB6 A;  2M2W A;  5EOZ A;  1ZQA A;  4TO0 A;  2B4V A;  3RJJ A;  1ZQD A;  4QG1 A;  5J0T A;  3AUO A;  4KLF A;  4MZ7 A;  8ICV A;  3SKD A;  4EP7 A;  4I2D A;  3TMC A;  1ZQG A;  2P66 A;  7ICR A;  4KLL A;  3CK6 A;  2ZH8 A;  4Q2C A;  3L9D A;  4XA5 A;  4FO6 A;  5BPC A;  4I2G A;  3AQK A;  2M2T A;  5IIM A;  2BPG A;  1U6Z A;  4Z6F A;  4IQW A;  7ICJ A;  4WOY A;  1UEV A;  4XJE A;  4XUS A;  4Z6E A;  4TNZ A;  4JWN A;  4RXO A;  4K96 A;  2I9G A;  3SK9 A;  4K97 A;  4E80 A;  1YNB A;  1TVA A;  3ISB A;  4AT9 A;  5HRH A;  3OUY B;  4EV6 A;  5J0R A;  4RT2 A;  4N71 A;  3C2M A;  1RZT A;  4KLO A;  5IIO A;  4O5C A;  2HN1 A;  4PHP A;  1HUZ A;  4N7R A;  4X0A A;  8ICP A;  9ICH A;  4QQX A;  4TNY A;  5D62 A;  1MQ2 A;  4FHX A;  5J0P A;  9ICF A;  4WC2 A;  4DOB A;  3K75 D;  2DRB A;  3H3A A;  3LK9 A;  3JZ0 A;  3C5F A;  5IIL A;  1XX7 A;  4P4M A;  4X4Q A;  4QZB A;  9ICA A;  4LEZ A;  3C2L A;  4GXI A;  4M9J A;  4QQY A;  4WC1 A;  1ZQW A;  4E8F A;  3HW8 A;  4OAF A;  3OGU A;  3CCG A;  3V7J A;  5D63 A;  4NXX A;  1ZQN A;  4RPZ A;  2ID1 A;  4I29 A;  4K8V A;  4Q2D A;  4X0B A;  3C5G A;  4JWM A;  5J2D A;  2ZH2 A;  5AO4 A;  8ICW A;  1JMS A;  3JPR A;  7ICP A;  1GPJ A;  1HUO A;  4I2B A;  7ICM A;  4UAW A;  4FHY A;  1VFG A;  4I2H A;  4UB1 A;  5DDY A;  9ICV A;  9ICI A;  1V4A A;  4RXP A;  5HRI A;  2BCV A;  4NLK A;  7ICK A;  4OAG A;  2DQB A;  5CHE A;  7ICF A;  3C18 A;  3AQM A;  4M9G A;  5B3Q A;  1ZJN A;  3V7L A;  4M5D A;  3PMN A;  5J2B A;  3AQN A;  4PH5 A;  4X4P A;  4IQT A;  4KLG A;  7ICV A;  4RQ7 A;  4TO6 A;  5J2C A;  4QZG A;  3JYY A;  5J2J A;  4PHD A;  2PAU A;  1KEJ A;  4AT9 B;  3H37 A;  5DDM A;  4QFY A;  5J0Y A;  4RWQ A;  4ATB A;  2M2U A;  5D46 A;  4O5E A;  8ICC A;  4LZG A;  5AO3 A;  9ICG A;  5J0S A;  7ICN A;  7ICG A;  3TMB A;  4RXQ A;  4I2C A;  2DRA A;  3B0Y A;  5DKW A;  2FMS A;  2BPF A;  2W9M A;  5D61 A;  7ICL A;  1UET A;  4EEB A;  4KLU A;  1XSL A;  4QFZ A;  7ICO A;  1ZQT A;  4RPY A;  4I27 A;  5BOM A;  3OV7 A;  4X4U A;  4AT7 A;  2PFO A;  3ER9 B;  5CFT A;  4X9E A;  3NVO A;  4M0A A;  3V7K A;  3MEM A;  4Z6C A;  3RJE A;  3TFR A;  4ME4 A;  1YLQ A;  9ICX A;  4UBC A;  4GXJ A;  1ZQR A;  1ZQQ A;  3PNC A;  5DBC A;  4UB3 A;  5HRL A;  3WFR E;  5TK8 A;  4FH3 A;  5J2K A;  4S3N A;  4WC7 A;  4L1J A;  1ZQS A;  3JPT A;  4RQ4 A;  3BG2 A;  4RWP A;  7ICQ A;  3UXN A;  4R63 A;  4KLD A;  3AQL A;  9ICT A;  5HHH A;  3UQ0 A;  8ICR A;  1ZQU A;  4XQ8 A;  1BPX A;  2DR7 A;  2ZH6 A;  4NXU A;  4F5O A;  4NXT A;  1TFW A;  4LEY A;  3KH1 A;  1KNY A;  4X4T A;  5B3P A;  4L7E A;  4UAZ A;  2FMQ A;  8ICA A;  3HC1 A;  4MLM A;  4LZD A;  3MDA A;  2PFN A;  4IQV A;  4X4O A;  4R8Z A;  4YMN A;  4WC3 A;  2HN2 A;  4UAY A;  3WFQ E;  4JLX A;  4PHE A;  8ICO A;  4TO5 A;  9ICN A;  1VJ7 A;  9ICB A;  4QFX A;  4KLI A;  5HR9 A;  5J0U A;  4TUR A;  4QQZ A;  2M2V A;  4ATB B;  3RH6 A;  1XSN A;  2ZH4 A;  4XDS A;  1R8C A;  2GA9 D;  4TNQ A;  7ICI A;  4NXZ A;  3K7D A;  4KLM A;  5HRF A;  2PBE A;  9ICU A;  3TM8 A;  4PHA A;  3KQ5 A;  2BBJ A;  4QG2 A;  5IIJ A;  4BZC A;  4R65 A;  2Q14 A;  2ZHB A;  3MZO A;  5DEC A;  4QG0 A;  4NM1 A;  2HEK A;  4GXK A;  9ICE A;  5DB6 A;  5TK7 A;  2EWR A;  1JN3 A; 
#chains in the Genus database with same CATH homology
 4YD2 A;  1ZQC A;  4FHW A;  4NKT A;  4TNP A;  4IQU A;  4AT7 B;  4N6W A;  1ZQL A;  3P3Q A;  2BCS A;  1JAJ A;  4XQ7 A;  4WBY A;  1ZQH A;  1MIY A;  1ZQF A;  5F2V O;  4QZI A;  5J0X A;  3ISD A;  3MDC A;  4P4P A;  2DR5 A;  4PGX A;  1MQ3 A;  2CQZ A;  2PXI A;  5J0W A;  3RH4 A;  7ICU A;  4PGY A;  4KLJ A;  1MIW A;  4WCW A;  4QZH A;  4QZE A;  4L1J B;  5HRD A;  5DB9 A;  3C2K A;  1ZQP A;  2PGS A;  4ZWG A;  1ZQI A;  4M9N A;  4RPX A;  8ICH A;  4F5Q A;  3NYB A;  4MLN A;  4RQ0 A;  1ZQZ A;  2BCU A;  4X4R A;  4WC5 A;  2VAN A;  9ICR A;  2O5A A;  4KLQ A;  5TKA A;  5BOL A;  2GWS A;  4BZB A;  8ICQ A;  5DBA A;  5CHG A;  2ISO A;  5J2E A;  8ICE A;  4M04 A;  4F5N A;  4DOC A;  2OGI A;  1R89 A;  8ICF A;  3TFS A;  4WBZ A;  4RQ8 A;  1UEU A;  4ZWE A;  4Z6D A;  1OU5 A;  4MCW A;  3RJH A;  8ICN A;  3GDX A;  4I2A A;  5CB1 A;  4TUP A;  9ICC A;  8ICU A;  5HRE A;  2PQ7 A;  1ZJM A;  4O9M A;  2NRK A;  7ICS A;  1ZQB A;  8ICB A;  4XRH A;  4RWO A;  4I2E A;  4UB4 A;  1JQR A;  1BPZ A;  4WC6 A;  5IIN A;  3RJK A;  4LT6 A;  4QZF A;  4QQW A;  4FH5 A;  4QZ8 A;  4P4O A;  4TO1 A;  3C66 A;  3HIY A;  3MGH A;  5DBB A;  5DB7 A;  3LQC B;  2Q66 A;  8ICK A;  4I2I A;  9ICO A;  9ICQ A;  3HJ1 A;  1NOM A;  1ZQY A;  4I2J A;  4QZA A;  4NY8 A;  5HRG A;  8ICS A;  5III A;  3GW7 A;  4QZC A;  4UB5 A;  4IG8 A;  3RF0 A;  3UXP A;  5AO1 A;  8ICT A;  5TK6 A;  3MBY A;  3AU2 A;  9ICW A;  3I7A A;  5TZV A;  1WOT A;  2ZH5 A;  3RJF A;  4X4N A;  4TUQ A;  3JPS A;  4TUS A;  4RQ1 A;  3NR1 A;  4TNR A;  4UD5 A;  4F5R A;  4RXS A;  1NO5 A;  5HRK A;  3LJX A;  2O08 A;  2O6I A;  4UB2 A;  4KLE A;  5CP2 A;  5AO0 A;  4YN4 A;  4KLS A;  1TV9 A;  3TMD A;  5J0Q A;  2ISP A;  2ZH3 A;  8ICZ A;  2BCR A;  3H38 A;  1KDH A;  4NLZ A;  1ZQJ A;  4LVS A;  4KLT A;  5J2H A;  3RJI A;  4TO4 A;  4YMO A;  4Q7H A;  1ZQX A;  3HX0 A;  3HI0 A;  2DVI A;  8ICM A;  3JPQ A;  3JPN A;  5AO2 A;  4NLN A;  4FHP A;  4M9L A;  2FLO A;  4TNX A;  5HC9 A;  4RWN A;  4AT8 A;  2ZH9 A;  4NM2 A;  4NKU A;  5CJ7 A;  9ICS A;  1F5A A;  9ICP A;  2BE3 A;  4L7W A;  4I28 A;  3JPO A;  1Q78 A;  2O1P A;  1BPD A;  3HWT A;  1BPB A;  4YD1 A;  1VQR A;  4MFF A;  2PFP A;  3HJ4 A;  3UPQ A;  1MIV A;  2ZH7 A;  8ICL A;  2BCQ A;  5IIK A;  3H39 A;  1ZQE A;  4M47 A;  4X4V A;  5HRB A;  8ICX A;  9ICJ A;  3RJG A;  3UXO A;  8ICG A;  7ICT A;  4PPX A;  2ZHA A;  3V72 A;  4YMM A;  1BPY A;  2DR9 A;  7ICE A;  5CR0 A;  3WFP A;  4WC4 A;  8ICJ A;  8ICI A;  4RT3 A;  4P2H A;  3WFO A;  3ISC A;  4KLH A;  5J2I A;  2GZ4 A;  5TK9 A;  1RPL A;  3U1N A;  5DB8 A;  4MFA A;  4K4G A;  4M2Y A;  1R8B A;  2ZH1 A;  9ICM A;  2PAR A;  4DMB A;  4WC0 A;  1ZQO A;  4UBB A;  4PGQ A;  3OVB A;  4X4S A;  4RQ5 A;  4R64 A;  1ZQV A;  4MDZ A;  3MGI A;  4DOA A;  1TFY A;  4TO3 A;  4MFC A;  4M9H A;  2PFQ A;  1FA0 A;  2RFF A;  1YOY A;  1BPE A;  2PAQ A;  3OUY A;  7ICH A;  1PX5 A;  4RXR A;  4EBK A;  5CWR A;  5J2G A;  3UQ2 A;  4LRL A;  4X5V A;  1R8A A;  4QG4 A;  4K4H A;  4RQ2 A;  5J2F A;  3S4L A;  1ZQK A;  2DR8 A;  4I2F A;  8ICY A;  4UD4 A;  3OVS A;  5D49 A;  4AT8 B;  3B0X A;  3JPP A;  3WFS C;  4RQ3 A;  3NQW A;  2IHM A;  1ZQM A;  3AU6 A;  3PML A;  2FMP A;  2HHP A;  3M1T A;  4R66 A;  5D4B A;  4K4I A;  4E7X A;  5DED A;  5J2A A;  5CA7 A;  4QZD A;  1XSP A;  9ICK A;  5J29 A;  4FHV A;  4QZ9 A;  3UPS A;  4F5P A;  4EBJ A;  4MF8 A;  3RH5 A;  3OVA A;  5J0O A;  4TO2 A;  4DO9 A;  4YCX A;  4RQ6 A;  1Q79 A;  2BPC A;  5HHI A;  9ICL A;  3IRH A;  4MF2 A;  2M2W A;  5EOZ A;  1ZQA A;  4TO0 A;  3RJJ A;  1ZQD A;  4QG1 A;  5J0T A;  3AUO A;  4KLF A;  4MZ7 A;  8ICV A;  3SKD A;  4EP7 A;  4I2D A;  3TMC A;  1ZQG A;  2P66 A;  7ICR A;  4KLL A;  2ZH8 A;  4Q2C A;  3L9D A;  4XA5 A;  4FO6 A;  5BPC A;  4I2G A;  3AQK A;  2M2T A;  5IIM A;  2BPG A;  1U6Z A;  4Z6F A;  4IQW A;  7ICJ A;  1UEV A;  4XUS A;  4Z6E A;  4TNZ A;  4JWN A;  4RXO A;  2I9G A;  3SK9 A;  4E80 A;  1YNB A;  1TVA A;  3ISB A;  4AT9 A;  5HRH A;  3OUY B;  4RT2 A;  5J0R A;  3C2M A;  4N71 A;  1RZT A;  4KLO A;  5IIO A;  4O5C A;  4PHP A;  1HUZ A;  4X0A A;  8ICP A;  9ICH A;  4QQX A;  4TNY A;  1MQ2 A;  4FHX A;  5J0P A;  9ICF A;  4WC2 A;  4DOB A;  3K75 D;  2DRB A;  3H3A A;  3LK9 A;  3JZ0 A;  3C5F A;  5IIL A;  1XX7 A;  4P4M A;  4X4Q A;  4QZB A;  9ICA A;  3C2L A;  4GXI A;  4M9J A;  4QQY A;  4WC1 A;  1ZQW A;  4E8F A;  3HW8 A;  3OGU A;  3CCG A;  3V7J A;  1ZQN A;  4RPZ A;  2ID1 A;  4I29 A;  4Q2D A;  4X0B A;  3C5G A;  4JWM A;  5J2D A;  2ZH2 A;  5AO4 A;  8ICW A;  1JMS A;  3JPR A;  7ICP A;  1HUO A;  4I2B A;  7ICM A;  4UAW A;  4FHY A;  1VFG A;  4I2H A;  4UB1 A;  5DDY A;  9ICV A;  9ICI A;  1V4A A;  4RXP A;  5HRI A;  2BCV A;  4NLK A;  7ICK A;  2DQB A;  7ICF A;  3C18 A;  3AQM A;  4M9G A;  1ZJN A;  3V7L A;  4M5D A;  3PMN A;  5J2B A;  3AQN A;  4PH5 A;  4X4P A;  4IQT A;  4KLG A;  7ICV A;  4RQ7 A;  4TO6 A;  5J2C A;  4QZG A;  3JYY A;  5J2J A;  4PHD A;  2PAU A;  1KEJ A;  4AT9 B;  3H37 A;  5DDM A;  4QFY A;  5J0Y A;  4RWQ A;  4ATB A;  2M2U A;  5D46 A;  4O5E A;  8ICC A;  4LZG A;  5AO3 A;  9ICG A;  5J0S A;  7ICN A;  7ICG A;  3TMB A;  4RXQ A;  4I2C A;  2DRA A;  3B0Y A;  5DKW A;  2FMS A;  2BPF A;  2W9M A;  7ICL A;  1UET A;  4KLU A;  1XSL A;  4QFZ A;  7ICO A;  1ZQT A;  4RPY A;  4I27 A;  5BOM A;  3OV7 A;  4X4U A;  4AT7 A;  2PFO A;  4X9E A;  4M0A A;  3V7K A;  3MEM A;  4Z6C A;  3RJE A;  3TFR A;  4ME4 A;  1YLQ A;  9ICX A;  4UBC A;  4GXJ A;  1ZQR A;  1ZQQ A;  3PNC A;  5DBC A;  4UB3 A;  5HRL A;  3WFR E;  5TK8 A;  4FH3 A;  5J2K A;  4S3N A;  4WC7 A;  4L1J A;  1ZQS A;  3JPT A;  4RQ4 A;  3BG2 A;  4RWP A;  7ICQ A;  3UXN A;  4R63 A;  4KLD A;  3AQL A;  9ICT A;  5HHH A;  3UQ0 A;  8ICR A;  1ZQU A;  4XQ8 A;  1BPX A;  2DR7 A;  2ZH6 A;  4F5O A;  1TFW A;  3KH1 A;  1KNY A;  4X4T A;  4L7E A;  4UAZ A;  2FMQ A;  8ICA A;  3HC1 A;  4MLM A;  4LZD A;  3MDA A;  2PFN A;  4IQV A;  4X4O A;  4R8Z A;  4YMN A;  4WC3 A;  4UAY A;  3WFQ E;  4PHE A;  8ICO A;  4TO5 A;  9ICN A;  1VJ7 A;  9ICB A;  4QFX A;  4KLI A;  5HR9 A;  5J0U A;  4TUR A;  4QQZ A;  2M2V A;  4ATB B;  3RH6 A;  1XSN A;  2ZH4 A;  4XDS A;  1R8C A;  4TNQ A;  7ICI A;  4NXZ A;  4KLM A;  5HRF A;  2PBE A;  9ICU A;  3TM8 A;  4PHA A;  3KQ5 A;  4QG2 A;  5IIJ A;  4BZC A;  4R65 A;  2Q14 A;  2ZHB A;  3MZO A;  5DEC A;  4QG0 A;  4NM1 A;  2HEK A;  4GXK A;  9ICE A;  5DB6 A;  5TK7 A;  4O5K A;  1JN3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...