1YLQA

Crystal structure of putative nucleotidyltransferase
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
93
structure length
93
Chain Sequence
AGHMKEIKEITKKDVQDAEIYLYGSVVEGDYSIGLSDIDVAIVSDVFEDRNRKLEFFGKITKKFFDSPFEFHILTKKEWKMSKRFIRKYRRLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords putative nucleotidyltransferase, hypothetical protein AF0614
publication title Crystal structure of Hypothetical protein AF0614, putative nucleotidyltransferase
rcsb
source organism Archaeoglobus fulgidus
total genus 29
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01909 NTP_transf_2 Nucleotidyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 1ylqA00
4X4NA 4UD5A 3RH4A 1RZTA 3HW8A 7ICKA 3AQKA 1MIWA 3C5FA 7ICQA 4EBJA 4PPXA 4RQ6A 5J0SA 8ICIA 4FHXA 4M9LA 3UPQA 1PX5A 5IIOA 5IIKA 3RJKA 8ICAA 4FHYA 9ICMA 4RQ0A 9ICPA 4RQ3A 1XSLA 5DB6A 3OUYB 4KLLA 1R8AA 5HHHA 4YD1A 3PMLA 5J0TA 5J2CA 3MDAA 4E80A 5HRDA 4DOAA 3C66A 2PFOA 4QZ8A 4RPZA 5J2FA 3JPSA 2HHPA 4PHEA 4ATBA 4QZEA 3UXPA 3MBYA 4M9HA 9ICIA 1ZQWA 2FMPA 2ISOA 8ICVA 3OV7A 4WC1A 3UQ0A 4MFAA 1WOTA 2PXIA 4P4PA 5HRGA 9ICOA 1ZQIA 1R8CA 4XUSA 2FMQA 8ICBA 1JN3A 5J0RA 4X0BA 1JAJA 4I2AA 1MQ2A 2M2UA 4NKTA 3RH5A 4X4RA 2BPFA 4X4SA 4ATBB 9ICVA 3AU6A 2ZH2A 3RJFA 8ICCA 4DOBA 2ISPA 2BCVA 4P4OA 4E7XA 3HIYA 5J0OA 3H39A 4X0AA 4NLKA 3NYBA 4MFFA 3HX0A 4KLHA 8ICSA 4KLUA 3TFSA 4RQ1A 4UAWA 7ICFA 5J2GA 2Q66A 3UXNA 4UBCA 5J2IA 3OVSA 9ICNA 4MF8A 4WC5A 5TZVA 2ZH6A 1ZQRA 4YMOA 1ZQLA 9ICKA 5BPCA 3JPPA 4NKUA 3OGUA 1MIVA 1ZQOA 4XA5A 4RQ4A 1HUZA 4UD4A 1ZQNA 3OVAA 8ICHA 3C2LA 4UAZA 4I29A 5HRLA 5DECA 4NXZA 4LZDA 4TUPA 1ZQHA 1ZQEA 4M5DA 5CR0A 4RPYA 4GXIA 3UQ2A 5J2KA 1ZQUA 3WFPA 4Z6CA 4X4UA 1ZQYA 5J2DA 7ICVA 1UEVA 4R65A 4X5VA 4WBYA 2ZH8A 9ICCA 4UB3A 4KLJA 1BPYA 4KLTA 3AQMA 1MIYA 5HHIA 4K4GA 4PGQA 4UB5A 3JPRA 4XQ7A 5J2HA 8ICTA 3C2MA 8ICXA 4I2CA 4X4OA 5DBBA 4WC4A 4Z6FA 1XSNA 5J0WA 4I2EA 4M47A 4KLOA 3MGIA 4QZBA 1YLQA 4KLIA 9ICUA 4IQUA 2ZH4A 4X4TA 9ICWA 2ZHAA 3B0XA 3RJIA 4YCXA 7ICIA 4KLMA 3JZ0A 3OVBA 2BCQA 4F5OA 2DVIA 4M9JA 1ZQDA 1JQRA 4I2IA 4TUSA 4R64A 4AT9A 1ZQFA 5IINA 4NY8A 9ICBA 4O5EA 3HJ4A 3JPTA 3V7JA 4DO9A 4JWMA 4KLGA 5IIIA 5IILA 8ICKA 4X4PA 4M9NA 1ZQKA 3RJGA 4PGXA 3RJHA 2DRBA 2BCSA 1ZQGA 4XRHA 2RFFA 2PBEA 4GXKA 4X4VA 3WFSC 1TVAA 4UBBA 4WC6A 3RH6A 4TURA 3LK9A 8ICJA 4Z6EA 5DB7A 4F5PA 4RQ8A 4NLNA 3TFRA 4AT9B 2ZH7A 2ID1A 7ICMA 1ZQJA 4I2GA 4O9MA 2BCRA 4KLSA 4GXJA 4RWPA 4FO6A 4QZAA 2ZHBA 9ICAA 4AT8A 4NM2A 3ISDA 4E8FA 2M2VA 5CA7A 4YN4A 3HJ1A 4EBKA 4RWOA 4I28A 4WC3A 3RJJA 3C2KA 2BPGA 5HRBA 4QZGA 2ZH1A 7ICEA 4QZFA 4UAYA 3LQCB 5J2JA 4P2HA 9ICEA 8ICYA 1ZQVA 4UB2A 2PFQA 4RPXA 1TFWA 3AQNA 4I2FA 1JMSA 4AT8B 8ICRA 3UXOA 3MGHA 5EOZA 7ICJA 5J29A 3UPSA 4RT3A 4KLEA 4X4QA 1MQ3A 4K4HA 8ICUA 9ICQA 4K4IA 3C5GA 1KNYA 4QZHA 3H37A 4JWNA 1R8BA 2ZH5A 1ZQPA 5HRHA 5DBAA 5DKWA 1BPBA 5J0YA 5D46A 9ICXA 8ICWA 3V7LA 9ICSA 1VFGA 4PH5A 4KLQA 2BCUA 4WC7A 4RQ7A 5BOMA 1RPLA 4PHAA 3AUOA 3MDCA 1BPEA 4NM1A 5J2AA 5CP2A 4UB1A 7ICPA 1ZQAA 4KLFA 2PFNA 4M04A 2O1PA 1XSPA 5HC9A 5CWRA 4R63A 1F5AA 4IQTA 1BPXA 2GWSA 4F5RA 4I27A 4XQ8A 3V7KA 8ICOA 5DB9A 4FHPA 4WC2A 4QZDA 4AT7A 4M2YA 1ZQMA 3WFOA 5HRFA 1Q78A 4YD2A 1ZQZA 9ICFA 4FH3A 4PGYA 1NOMA 5DDMA 4RWNA 4MFCA 2I9GA 4RQ5A 3GDXA 5F2VO 7ICTA 4WBZA 8ICEA 1ZQTA 4QZIA 1UETA 4F5QA 1TFYA 4LT6A 1ZQBA 4AT7B 5BOLA 3RJEA 9ICLA 5IIJA 5J2EA 5CHGA 4O5CA 2BPCA 9ICJA 4IG8A 4DOCA 1R89A 4LVSA 4Z6DA 4O5KA 7ICGA 4WC0A 2PFPA 1KDHA 2M2TA 3PMNA 3C18A 7ICHA 4RT2A 1VJ7A 4FH5A 4F5NA 1ZQSA 8ICMA 8ICZA 7ICLA 4I2BA 4YMNA 4LZGA 2DR9A 2P66A 8ICGA 5J0XA 4QZCA 5J0QA 1TV9A 2O5AA 1FA0A 1UEUA 1KEJA 1V4AA 5J2BA 1OU5A 9ICHA 5IIMA 4R66A 4PHDA 7ICOA 2DR7A 3B0YA 7ICUA 8ICLA 5DDYA 8ICQA 7ICNA 3JPNA 8ICPA 3V72A 4NLZA 3HWTA 4TUQA 1ZQQA 3H38A 4QZ9A 9ICTA 1HUOA 2NRKA 5HRKA 3K75D 2DR5A 1NO5A 2M2WA 5DBCA 4IQWA 2BE3A 8ICFA 8ICNA 3WFQE 1Q79A 4FHVA 3H3AA 4PHPA 4KLDA 4I2DA 4P4MA 1ZJMA 5DEDA 3WFRE 2W9MA 4I2JA 7ICRA 2VANA 9ICGA 2ZH3A 1BPDA 5HRIA 4RQ2A 3ISBA 2FMSA 3L9DA 5J0UA 4MF2A 4M0AA 1ZQCA 2DR8A 5CB1A 3JPOA 2DRAA 3AQLA 4YMMA 4EP7A 3JPQA 5D4BA 1ZJNA 4IQVA 4RWQA 3AU2A 1BPZA 7ICSA 4I2HA 1ZQXA 5J0PA 5HREA 4M9GA 5DB8A 3ISCA 3JYYA 2IHMA 9ICRA 4UB4A 4WCWA 4S3NA 2ZH9A 3PNCA 5HR9A 4FHWA 3OUYA 5CJ7A 5D49A
chains in the Genus database with same CATH superfamily
4LEVA 4WOYA 4X4NA 4UD5A 3RH4A 1RZTA 3HW8A 4FO1A 3ER9B 7ICKA 4KM5A 3AQKA 1MIWA 3C5FA 7ICQA 4EBJA 4PPXA 3CK6A 4I0UA 4RQ6A 5J0SA 8ICIA 4FHXA 4M9LA 3UPQA 1PX5A 5IIOA 5IIKA 3RJKA 8ICAA 4FHYA 2FCLA 9ICMA 4RQ0A 9ICPA 4RQ3A 1XSLA 5DB6A 3OUYB 4KLLA 1R8AA 5HHHA 4K98A 4YD1A 3PMLA 5J0TA 5J2CA 3MDAA 4E80A 5HRDA 4DOAA 3C66A 2PFOA 4QZ8A 2B56A 4RPZA 5J2FA 3JPSA 2HHPA 4PHEA 4ATBA 4QZEA 3UXPA 3MBYA 4M9HA 9ICIA 1ZQWA 4O67A 4OAIZ 2FMPA 2ISOA 8ICVA 3OV7A 4WC1A 3UQ0A 4MFAA 1WOTA 2PXIA 4P4PA 5HRGA 9ICOA 4KB6A 1R8CA 4XUSA 1ZQIA 4JLXA 5CFTA 2FMQA 8ICBA 1JN3A 2GAFD 2HN2A 5J0RA 4X0BA 1JAJA 4I2AA 1MQ2A 2M2UA 4NKTA 3NVOA 4X4RA 3RH5A 2BPFA 4JLZA 5JTGA 4X4SA 4ATBB 9ICVA 3AU6A 2ZH2A 3RJFA 8ICCA 4DOBA 2ISPA 2BCVA 4P4OA 4E7XA 3HIYA 5J0OA 3H39A 4X0AA 4NLKA 3NYBA 3K7DA 3ERCC 4MFFA 3HX0A 4KLHA 8ICSA 4KLUA 3TFSA 4RQ1A 4UAWA 7ICFA 5CFSA 5J2GA 2Q66A 3UXNA 4UBCA 5J2IA 3OVSA 9ICNA 4MF8A 4WC5A 5TZVA 2ZH6A 1ZQRA 4YMOA 1ZQLA 9ICKA 5BPCA 3JPPA 4NKUA 3OGUA 1MIVA 1ZQOA 4XA5A 4RQ4A 1HUZA 4UD4A 1ZQNA 3OVAA 8ICHA 3C2LA 4UAZA 4I29A 5HRLA 4NXTA 5DECA 4NXZA 4LZDA 4TUPA 3EF2A 1ZQHA 4WQKA 1ZQEA 4M5DA 5CR0A 4RPYA 3JCFA 4GXIA 3UQ2A 5J2KA 1ZQUA 3WFPA 4Z6CA 4X4UA 1ZQYA 4O69A 5J2DA 7ICVA 4K9BA 1UEVA 4R65A 4X5VA 4WBYA 2ZH8A 9ICCA 4UB3A 4KLJA 1BPYA 4KLTA 2GA9D 3OWGA 3AQMA 1MIYA 5HHIA 4K4GA 4PGQA 4UB5A 3JPRA 4XQ7A 5J2HA 4K96A 4OAGA 8ICTA 3C2MA 8ICXA 4I2CA 4X4OA 5DBBA 4WC4A 2IHOA 4Z6FA 1XSNA 5J0WA 4I2EA 4M47A 4KLOA 3MGIA 4QZBA 1YLQA 4KLIA 9ICUA 4IQUA 4EEBA 2ZH4A 4X4TA 9ICWA 2ZHAA 3B0XA 3RJIA 4YCXA 7ICIA 4KLMA 3JZ0A 3OVBA 2BCQA 4LEWA 3ER8C 4F5OA 2DVIA 4M9JA 1ZQDA 1JQRA 4I2IA 4TUSA 4R64A 4AT9A 1ZQFA 5IINA 4O6AA 4NY8A 9ICBA 4K99A 4O5EA 4N7RA 3HJ4A 3JPTA 3V7JA 4DO9A 4JWMA 4KLGA 5IIIA 3NKUA 5IILA 8ICKA 4X4PA 4M9NA 1ZQKA 3RJGA 4PGXA 3RJHA 2DRBA 2IUBA 2BCSA 1ZQGA 4XRHA 1GPJA 2RFFA 2PBEA 4GXKA 4X4VA 3WFSC 1TVAA 4UBBA 4WC6A 3RH6A 4TURA 3LK9A 8ICJA 4Z6EA 5DB7A 4F5PA 4RQ8A 4NLNA 3TFRA 4AT9B 2ID1A 2ZH7A 7ICMA 1ZQJA 4I2GA 4O9MA 2BCRA 4KLSA 4GXJA 4RWPA 4FO6A 4QZAA 2ZHBA 4LEYA 9ICAA 4AT8A 3PHZA 4NM2A 3ISDA 4E8FA 2M2VA 4WQLA 5CA7A 4YN4A 3HJ1A 4EBKA 4RWOA 4I28A 4WC3A 3RJJA 3C2KA 2BPGA 5HRBA 4QZGA 2ZH1A 7ICEA 4QZFA 4UAYA 3LQCB 5J2JA 4P2HA 4OAFA 9ICEA 8ICYA 1ZQVA 4UB2A 2PFQA 4RPXA 1TFWA 3AQNA 4I2FA 1JMSA 4AT8B 8ICRA 3UXOA 4NXXA 3MGHA 5EOZA 7ICJA 5J29A 3UPSA 4RT3A 4KLEA 4X4QA 4NXUA 1MQ3A 4K4HA 8ICUA 9ICQA 4K4IA 3C5GA 1KNYA 4QZHA 3H37A 4JWNA 1R8BA 2ZH5A 1ZQPA 5HRHA 5DBAA 2B51A 1BPBA 5DKWA 5J0YA 5D46A 9ICXA 8ICWA 3V7LA 9ICSA 1VFGA 4PH5A 4KLQA 2BCUA 4WC7A 4RQ7A 5BOMA 1RPLA 4PHAA 3AUOA 1BPEA 3MDCA 4NM1A 5J2AA 5CP2A 4UB1A 7ICPA 1ZQAA 4KLFA 2PFNA 4M04A 4EGWA 2O1PA 5D63A 1XSPA 5HC9A 5CWRA 4OAHA 4R63A 1F5AA 4IQTA 1BPXA 2GWSA 4F5RA 4I27A 4XQ8A 3V7KA 8ICOA 2EWRA 5DB9A 4EV6A 3MCRA 4FHPA 4NXVA 4WC2A 4QZDA 4O68A 4AT7A 4M2YA 1ZQMA 3WFOA 5HRFA 1Q78A 4YD2A 1ZQZA 9ICFA 4FH3A 4PGYA 5B3PA 1NOMA 4LEZA 5DDMA 4RWNA 5CFUA 4MFCA 5CHEA 2I9GA 4RQ5A 3GDXA 5F2VO 7ICTA 4WBZA 8ICEA 1ZQTA 4QZIA 1UETA 4F5QA 4XJEA 1TFYA 4LT6A 1ZQBA 4AT7B 5BOLA 3RJEA 9ICLA 5IIJA 5J2EA 5CHGA 4EEDA 4O5CA 2BPCA 4HX0A 9ICJA 4IG8A 5D61A 4DOCA 1R89A 4LVSA 4Z6DA 4O5KA 7ICGA 4WC0A 2B4VA 2PFPA 5D62A 1KDHA 2M2TA 3PMNA 3C18A 4MKPA 7ICHA 4RT2A 1VJ7A 4FH5A 4F5NA 1ZQSA 8ICMA 8ICZA 7ICLA 4I2BA 4YMNA 4LZGA 2HN1A 2DR9A 2P66A 8ICGA 5J0XA 4K97A 4QZCA 5J0QA 1TV9A 4K9AA 2O5AA 1FA0A 1UEUA 1KEJA 1V4AA 5J2BA 1OU5A 9ICHA 5IIMA 4R66A 2BBJA 4PHDA 7ICOA 2DR7A 3B0YA 7ICUA 8ICLA 5DDYA 8ICQA 7ICNA 3JPNA 8ICPA 3V72A 2BBHA 4NLZA 3HWTA 4TUQA 1ZQQA 3H38A 4QZ9A 9ICTA 1HUOA 2NRKA 5HRKA 3K75D 2DR5A 1NO5A 2M2WA 5DBCA 4IQWA 4WH5A 2BE3A 8ICFA 8ICNA 3WFQE 1Q79A 4FHVA 3H3AA 4PHPA 4KLDA 4I2DA 4P4MA 4NXWA 1ZJMA 4K8VA 5DEDA 3WFRE 2W9MA 4I2JA 7ICRA 2VANA 9ICGA 2ZH3A 1BPDA 5HRIA 4RQ2A 3ISBA 2FMSA 3L9DA 5J0UA 4MF2A 4M0AA 1ZQCA 3NWIA 2DR8A 5CB1A 3JPOA 2DRAA 3AQLA 4YMMA 4EP7A 3JPQA 5D4BA 1ZJNA 4IQVA 5B3QA 4RWQA 3AU2A 1BPZA 7ICSA 4I2HA 1ZQXA 5J0PA 5HREA 4M9GA 5DB8A 3ISCA 3JYYA 2IHMA 9ICRA 4UB4A 4WCWA 4S3NA 2ZH9A 3PNCA 5HR9A 4FHWA 3OUYA 5CJ7A 5D49A
chains in the Genus database with same CATH topology
4X4NA 4UD5A 3RH4A 1RZTA 3HW8A 7ICKA 3AQKA 1MIWA 3C5FA 7ICQA 4EBJA 4PPXA 4RQ6A 5J0SA 8ICIA 4FHXA 4M9LA 3UPQA 1PX5A 5IIOA 5IIKA 3RJKA 8ICAA 4FHYA 9ICMA 4RQ0A 9ICPA 4RQ3A 1XSLA 5DB6A 3OUYB 4KLLA 1R8AA 5HHHA 4YD1A 3PMLA 5J0TA 5J2CA 3MDAA 4E80A 5HRDA 4DOAA 3C66A 2PFOA 4QZ8A 4RPZA 5J2FA 3JPSA 2HHPA 4PHEA 4ATBA 4QZEA 3UXPA 3MBYA 4M9HA 9ICIA 1ZQWA 2FMPA 2ISOA 8ICVA 3OV7A 4WC1A 3UQ0A 4MFAA 1WOTA 2PXIA 4P4PA 5HRGA 9ICOA 1ZQIA 1R8CA 4XUSA 2FMQA 8ICBA 1JN3A 5J0RA 4X0BA 1JAJA 4I2AA 1MQ2A 2M2UA 4NKTA 3RH5A 4X4RA 2BPFA 4X4SA 4ATBB 9ICVA 3AU6A 2ZH2A 3RJFA 8ICCA 4DOBA 2ISPA 2BCVA 4P4OA 4E7XA 3HIYA 5J0OA 3H39A 4X0AA 4NLKA 3NYBA 4MFFA 3HX0A 4KLHA 8ICSA 4KLUA 3TFSA 4RQ1A 4UAWA 7ICFA 5J2GA 2Q66A 3UXNA 4UBCA 5J2IA 3OVSA 9ICNA 4MF8A 4WC5A 5TZVA 2ZH6A 1ZQRA 4YMOA 1ZQLA 9ICKA 5BPCA 3JPPA 4NKUA 3OGUA 1MIVA 1ZQOA 4XA5A 4RQ4A 1HUZA 4UD4A 1ZQNA 3OVAA 8ICHA 3C2LA 4UAZA 4I29A 5HRLA 5DECA 4NXZA 4LZDA 4TUPA 1ZQHA 1ZQEA 4M5DA 5CR0A 4RPYA 4GXIA 3UQ2A 5J2KA 1ZQUA 3WFPA 4Z6CA 4X4UA 1ZQYA 5J2DA 7ICVA 1UEVA 4R65A 4X5VA 4WBYA 2ZH8A 9ICCA 4UB3A 4KLJA 1BPYA 4KLTA 3AQMA 1MIYA 5HHIA 4K4GA 4PGQA 4UB5A 3JPRA 4XQ7A 5J2HA 8ICTA 3C2MA 8ICXA 4I2CA 4X4OA 5DBBA 4WC4A 4Z6FA 1XSNA 5J0WA 4I2EA 4M47A 4KLOA 3MGIA 4QZBA 1YLQA 4KLIA 9ICUA 4IQUA 2ZH4A 4X4TA 9ICWA 2ZHAA 3B0XA 3RJIA 4YCXA 7ICIA 4KLMA 3JZ0A 3OVBA 2BCQA 4F5OA 2DVIA 4M9JA 1ZQDA 1JQRA 4I2IA 4TUSA 4R64A 4AT9A 1ZQFA 5IINA 4NY8A 9ICBA 4O5EA 3HJ4A 3JPTA 3V7JA 4DO9A 4JWMA 4KLGA 5IIIA 5IILA 8ICKA 4X4PA 4M9NA 1ZQKA 3RJGA 4PGXA 3RJHA 2DRBA 2BCSA 1ZQGA 4XRHA 2RFFA 2PBEA 4GXKA 4X4VA 3WFSC 1TVAA 4UBBA 4WC6A 3RH6A 4TURA 3LK9A 8ICJA 4Z6EA 5DB7A 4F5PA 4RQ8A 4NLNA 3TFRA 4AT9B 2ZH7A 2ID1A 7ICMA 1ZQJA 4I2GA 4O9MA 2BCRA 4KLSA 4GXJA 4RWPA 4FO6A 4QZAA 2ZHBA 9ICAA 4AT8A 4NM2A 3ISDA 4E8FA 2M2VA 5CA7A 4YN4A 3HJ1A 4EBKA 4RWOA 4I28A 4WC3A 3RJJA 3C2KA 2BPGA 5HRBA 4QZGA 2ZH1A 7ICEA 4QZFA 4UAYA 3LQCB 5J2JA 4P2HA 9ICEA 8ICYA 1ZQVA 4UB2A 2PFQA 4RPXA 1TFWA 3AQNA 4I2FA 1JMSA 4AT8B 8ICRA 3UXOA 3MGHA 5EOZA 7ICJA 5J29A 3UPSA 4RT3A 4KLEA 4X4QA 1MQ3A 4K4HA 8ICUA 9ICQA 4K4IA 3C5GA 1KNYA 4QZHA 3H37A 4JWNA 1R8BA 2ZH5A 1ZQPA 5HRHA 5DBAA 5DKWA 1BPBA 5J0YA 5D46A 9ICXA 8ICWA 3V7LA 9ICSA 1VFGA 4PH5A 4KLQA 2BCUA 4WC7A 4RQ7A 5BOMA 1RPLA 4PHAA 3AUOA 3MDCA 1BPEA 4NM1A 5J2AA 5CP2A 4UB1A 7ICPA 1ZQAA 4KLFA 2PFNA 4M04A 2O1PA 1XSPA 5HC9A 5CWRA 4R63A 1F5AA 4IQTA 1BPXA 2GWSA 4F5RA 4I27A 4XQ8A 3V7KA 8ICOA 5DB9A 4FHPA 4WC2A 4QZDA 4AT7A 4M2YA 1ZQMA 3WFOA 5HRFA 1Q78A 4YD2A 1ZQZA 9ICFA 4FH3A 4PGYA 1NOMA 5DDMA 4RWNA 4MFCA 2I9GA 4RQ5A 3GDXA 5F2VO 7ICTA 4WBZA 8ICEA 1ZQTA 4QZIA 1UETA 4F5QA 1TFYA 4LT6A 1ZQBA 4AT7B 5BOLA 3RJEA 9ICLA 5IIJA 5J2EA 5CHGA 4O5CA 2BPCA 9ICJA 4IG8A 4DOCA 1R89A 4LVSA 4Z6DA 4O5KA 7ICGA 4WC0A 2PFPA 1KDHA 2M2TA 3PMNA 3C18A 7ICHA 4RT2A 1VJ7A 4FH5A 4F5NA 1ZQSA 8ICMA 8ICZA 7ICLA 4I2BA 4YMNA 4LZGA 2DR9A 2P66A 8ICGA 5J0XA 4QZCA 5J0QA 1TV9A 2O5AA 1FA0A 1UEUA 1KEJA 1V4AA 5J2BA 1OU5A 9ICHA 5IIMA 4R66A 4PHDA 7ICOA 2DR7A 3B0YA 7ICUA 8ICLA 5DDYA 8ICQA 7ICNA 3JPNA 8ICPA 3V72A 4NLZA 3HWTA 4TUQA 1ZQQA 3H38A 4QZ9A 9ICTA 1HUOA 2NRKA 5HRKA 3K75D 2DR5A 1NO5A 2M2WA 5DBCA 4IQWA 2BE3A 8ICFA 8ICNA 3WFQE 1Q79A 4FHVA 3H3AA 4PHPA 4KLDA 4I2DA 4P4MA 1ZJMA 5DEDA 3WFRE 2W9MA 4I2JA 7ICRA 2VANA 9ICGA 2ZH3A 1BPDA 5HRIA 4RQ2A 3ISBA 2FMSA 3L9DA 5J0UA 4MF2A 4M0AA 1ZQCA 2DR8A 5CB1A 3JPOA 2DRAA 3AQLA 4YMMA 4EP7A 3JPQA 5D4BA 1ZJNA 4IQVA 4RWQA 3AU2A 1BPZA 7ICSA 4I2HA 1ZQXA 5J0PA 5HREA 4M9GA 5DB8A 3ISCA 3JYYA 2IHMA 9ICRA 4UB4A 4WCWA 4S3NA 2ZH9A 3PNCA 5HR9A 4FHWA 3OUYA 5CJ7A 5D49A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X4N A;  4UD5 A;  3RH4 A;  1RZT A;  3HW8 A;  7ICK A;  3AQK A;  1MIW A;  3C5F A;  7ICQ A;  4EBJ A;  4PPX A;  4RQ6 A;  5J0S A;  8ICI A;  4FHX A;  4M9L A;  3UPQ A;  1PX5 A;  5IIO A;  5IIK A;  3RJK A;  8ICA A;  4FHY A;  9ICM A;  4RQ0 A;  9ICP A;  4RQ3 A;  1XSL A;  5DB6 A;  3OUY B;  4KLL A;  1R8A A;  5HHH A;  4YD1 A;  3PML A;  5J0T A;  5J2C A;  3MDA A;  4E80 A;  5HRD A;  4DOA A;  3C66 A;  2PFO A;  4QZ8 A;  4RPZ A;  5J2F A;  3JPS A;  2HHP A;  4PHE A;  4ATB A;  4QZE A;  3UXP A;  3MBY A;  4M9H A;  9ICI A;  1ZQW A;  2FMP A;  2ISO A;  8ICV A;  3OV7 A;  4WC1 A;  3UQ0 A;  4MFA A;  1WOT A;  2PXI A;  4P4P A;  5HRG A;  9ICO A;  1ZQI A;  1R8C A;  4XUS A;  2FMQ A;  8ICB A;  1JN3 A;  5J0R A;  4X0B A;  1JAJ A;  4I2A A;  1MQ2 A;  2M2U A;  4NKT A;  3RH5 A;  4X4R A;  2BPF A;  4X4S A;  4ATB B;  9ICV A;  3AU6 A;  2ZH2 A;  3RJF A;  8ICC A;  4DOB A;  2ISP A;  2BCV A;  4P4O A;  4E7X A;  3HIY A;  5J0O A;  3H39 A;  4X0A A;  4NLK A;  3NYB A;  4MFF A;  3HX0 A;  4KLH A;  8ICS A;  4KLU A;  3TFS A;  4RQ1 A;  4UAW A;  7ICF A;  5J2G A;  2Q66 A;  3UXN A;  4UBC A;  5J2I A;  3OVS A;  9ICN A;  4MF8 A;  4WC5 A;  5TZV A;  2ZH6 A;  1ZQR A;  4YMO A;  1ZQL A;  9ICK A;  5BPC A;  3JPP A;  4NKU A;  3OGU A;  1MIV A;  1ZQO A;  4XA5 A;  4RQ4 A;  1HUZ A;  4UD4 A;  1ZQN A;  3OVA A;  8ICH A;  3C2L A;  4UAZ A;  4I29 A;  5HRL A;  5DEC A;  4NXZ A;  4LZD A;  4TUP A;  1ZQH A;  1ZQE A;  4M5D A;  5CR0 A;  4RPY A;  4GXI A;  3UQ2 A;  5J2K A;  1ZQU A;  3WFP A;  4Z6C A;  4X4U A;  1ZQY A;  5J2D A;  7ICV A;  1UEV A;  4R65 A;  4X5V A;  4WBY A;  2ZH8 A;  9ICC A;  4UB3 A;  4KLJ A;  1BPY A;  4KLT A;  3AQM A;  1MIY A;  5HHI A;  4K4G A;  4PGQ A;  4UB5 A;  3JPR A;  4XQ7 A;  5J2H A;  8ICT A;  3C2M A;  8ICX A;  4I2C A;  4X4O A;  5DBB A;  4WC4 A;  4Z6F A;  1XSN A;  5J0W A;  4I2E A;  4M47 A;  4KLO A;  3MGI A;  4QZB A;  1YLQ A;  4KLI A;  9ICU A;  4IQU A;  2ZH4 A;  4X4T A;  9ICW A;  2ZHA A;  3B0X A;  3RJI A;  4YCX A;  7ICI A;  4KLM A;  3JZ0 A;  3OVB A;  2BCQ A;  4F5O A;  2DVI A;  4M9J A;  1ZQD A;  1JQR A;  4I2I A;  4TUS A;  4R64 A;  4AT9 A;  1ZQF A;  5IIN A;  4NY8 A;  9ICB A;  4O5E A;  3HJ4 A;  3JPT A;  3V7J A;  4DO9 A;  4JWM A;  4KLG A;  5III A;  5IIL A;  8ICK A;  4X4P A;  4M9N A;  1ZQK A;  3RJG A;  4PGX A;  3RJH A;  2DRB A;  2BCS A;  1ZQG A;  4XRH A;  2RFF A;  2PBE A;  4GXK A;  4X4V A;  3WFS C;  1TVA A;  4UBB A;  4WC6 A;  3RH6 A;  4TUR A;  3LK9 A;  8ICJ A;  4Z6E A;  5DB7 A;  4F5P A;  4RQ8 A;  4NLN A;  3TFR A;  4AT9 B;  2ZH7 A;  2ID1 A;  7ICM A;  1ZQJ A;  4I2G A;  4O9M A;  2BCR A;  4KLS A;  4GXJ A;  4RWP A;  4FO6 A;  4QZA A;  2ZHB A;  9ICA A;  4AT8 A;  4NM2 A;  3ISD A;  4E8F A;  2M2V A;  5CA7 A;  4YN4 A;  3HJ1 A;  4EBK A;  4RWO A;  4I28 A;  4WC3 A;  3RJJ A;  3C2K A;  2BPG A;  5HRB A;  4QZG A;  2ZH1 A;  7ICE A;  4QZF A;  4UAY A;  3LQC B;  5J2J A;  4P2H A;  9ICE A;  8ICY A;  1ZQV A;  4UB2 A;  2PFQ A;  4RPX A;  1TFW A;  3AQN A;  4I2F A;  1JMS A;  4AT8 B;  8ICR A;  3UXO A;  3MGH A;  5EOZ A;  7ICJ A;  5J29 A;  3UPS A;  4RT3 A;  4KLE A;  4X4Q A;  1MQ3 A;  4K4H A;  8ICU A;  9ICQ A;  4K4I A;  3C5G A;  1KNY A;  4QZH A;  3H37 A;  4JWN A;  1R8B A;  2ZH5 A;  1ZQP A;  5HRH A;  5DBA A;  5DKW A;  1BPB A;  5J0Y A;  5D46 A;  9ICX A;  8ICW A;  3V7L A;  9ICS A;  1VFG A;  4PH5 A;  4KLQ A;  2BCU A;  4WC7 A;  4RQ7 A;  5BOM A;  1RPL A;  4PHA A;  3AUO A;  3MDC A;  1BPE A;  4NM1 A;  5J2A A;  5CP2 A;  4UB1 A;  7ICP A;  1ZQA A;  4KLF A;  2PFN A;  4M04 A;  2O1P A;  1XSP A;  5HC9 A;  5CWR A;  4R63 A;  1F5A A;  4IQT A;  1BPX A;  2GWS A;  4F5R A;  4I27 A;  4XQ8 A;  3V7K A;  8ICO A;  5DB9 A;  4FHP A;  4WC2 A;  4QZD A;  4AT7 A;  4M2Y A;  1ZQM A;  3WFO A;  5HRF A;  1Q78 A;  4YD2 A;  1ZQZ A;  9ICF A;  4FH3 A;  4PGY A;  1NOM A;  5DDM A;  4RWN A;  4MFC A;  2I9G A;  4RQ5 A;  3GDX A;  5F2V O;  7ICT A;  4WBZ A;  8ICE A;  1ZQT A;  4QZI A;  1UET A;  4F5Q A;  1TFY A;  4LT6 A;  1ZQB A;  4AT7 B;  5BOL A;  3RJE A;  9ICL A;  5IIJ A;  5J2E A;  5CHG A;  4O5C A;  2BPC A;  9ICJ A;  4IG8 A;  4DOC A;  1R89 A;  4LVS A;  4Z6D A;  4O5K A;  7ICG A;  4WC0 A;  2PFP A;  1KDH A;  2M2T A;  3PMN A;  3C18 A;  7ICH A;  4RT2 A;  1VJ7 A;  4FH5 A;  4F5N A;  1ZQS A;  8ICM A;  8ICZ A;  7ICL A;  4I2B A;  4YMN A;  4LZG A;  2DR9 A;  2P66 A;  8ICG A;  5J0X A;  4QZC A;  5J0Q A;  1TV9 A;  2O5A A;  1FA0 A;  1UEU A;  1KEJ A;  1V4A A;  5J2B A;  1OU5 A;  9ICH A;  5IIM A;  4R66 A;  4PHD A;  7ICO A;  2DR7 A;  3B0Y A;  7ICU A;  8ICL A;  5DDY A;  8ICQ A;  7ICN A;  3JPN A;  8ICP A;  3V72 A;  4NLZ A;  3HWT A;  4TUQ A;  1ZQQ A;  3H38 A;  4QZ9 A;  9ICT A;  1HUO A;  2NRK A;  5HRK A;  3K75 D;  2DR5 A;  1NO5 A;  2M2W A;  5DBC A;  4IQW A;  2BE3 A;  8ICF A;  8ICN A;  3WFQ E;  1Q79 A;  4FHV A;  3H3A A;  4PHP A;  4KLD A;  4I2D A;  4P4M A;  1ZJM A;  5DED A;  3WFR E;  2W9M A;  4I2J A;  7ICR A;  2VAN A;  9ICG A;  2ZH3 A;  1BPD A;  5HRI A;  4RQ2 A;  3ISB A;  2FMS A;  3L9D A;  5J0U A;  4MF2 A;  4M0A A;  1ZQC A;  2DR8 A;  5CB1 A;  3JPO A;  2DRA A;  3AQL A;  4YMM A;  4EP7 A;  3JPQ A;  5D4B A;  1ZJN A;  4IQV A;  4RWQ A;  3AU2 A;  1BPZ A;  7ICS A;  4I2H A;  1ZQX A;  5J0P A;  5HRE A;  4M9G A;  5DB8 A;  3ISC A;  3JYY A;  2IHM A;  9ICR A;  4UB4 A;  4WCW A;  4S3N A;  2ZH9 A;  3PNC A;  5HR9 A;  4FHW A;  3OUY A;  5CJ7 A;  5D49 A; 
#chains in the Genus database with same CATH topology
 4LEV A;  4WOY A;  4X4N A;  4UD5 A;  3RH4 A;  1RZT A;  3HW8 A;  4FO1 A;  3ER9 B;  7ICK A;  4KM5 A;  3AQK A;  1MIW A;  3C5F A;  7ICQ A;  4EBJ A;  4PPX A;  3CK6 A;  4I0U A;  4RQ6 A;  5J0S A;  8ICI A;  4FHX A;  4M9L A;  3UPQ A;  1PX5 A;  5IIO A;  5IIK A;  3RJK A;  8ICA A;  4FHY A;  2FCL A;  9ICM A;  4RQ0 A;  9ICP A;  4RQ3 A;  1XSL A;  5DB6 A;  3OUY B;  4KLL A;  1R8A A;  5HHH A;  4K98 A;  4YD1 A;  3PML A;  5J0T A;  5J2C A;  3MDA A;  4E80 A;  5HRD A;  4DOA A;  3C66 A;  2PFO A;  4QZ8 A;  2B56 A;  4RPZ A;  5J2F A;  3JPS A;  2HHP A;  4PHE A;  4ATB A;  4QZE A;  3UXP A;  3MBY A;  4M9H A;  9ICI A;  1ZQW A;  4O67 A;  4OAI Z;  2FMP A;  2ISO A;  8ICV A;  3OV7 A;  4WC1 A;  3UQ0 A;  4MFA A;  1WOT A;  2PXI A;  4P4P A;  5HRG A;  9ICO A;  4KB6 A;  1R8C A;  4XUS A;  1ZQI A;  4JLX A;  5CFT A;  2FMQ A;  8ICB A;  1JN3 A;  2GAF D;  2HN2 A;  5J0R A;  4X0B A;  1JAJ A;  4I2A A;  1MQ2 A;  2M2U A;  4NKT A;  3NVO A;  4X4R A;  3RH5 A;  2BPF A;  4JLZ A;  5JTG A;  4X4S A;  4ATB B;  9ICV A;  3AU6 A;  2ZH2 A;  3RJF A;  8ICC A;  4DOB A;  2ISP A;  2BCV A;  4P4O A;  4E7X A;  3HIY A;  5J0O A;  3H39 A;  4X0A A;  4NLK A;  3NYB A;  3K7D A;  3ERC C;  4MFF A;  3HX0 A;  4KLH A;  8ICS A;  4KLU A;  3TFS A;  4RQ1 A;  4UAW A;  7ICF A;  5CFS A;  5J2G A;  2Q66 A;  3UXN A;  4UBC A;  5J2I A;  3OVS A;  9ICN A;  4MF8 A;  4WC5 A;  5TZV A;  2ZH6 A;  1ZQR A;  4YMO A;  1ZQL A;  9ICK A;  5BPC A;  3JPP A;  4NKU A;  3OGU A;  1MIV A;  1ZQO A;  4XA5 A;  4RQ4 A;  1HUZ A;  4UD4 A;  1ZQN A;  3OVA A;  8ICH A;  3C2L A;  4UAZ A;  4I29 A;  5HRL A;  4NXT A;  5DEC A;  4NXZ A;  4LZD A;  4TUP A;  3EF2 A;  1ZQH A;  4WQK A;  1ZQE A;  4M5D A;  5CR0 A;  4RPY A;  3JCF A;  4GXI A;  3UQ2 A;  5J2K A;  1ZQU A;  3WFP A;  4Z6C A;  4X4U A;  1ZQY A;  4O69 A;  5J2D A;  7ICV A;  4K9B A;  1UEV A;  4R65 A;  4X5V A;  4WBY A;  2ZH8 A;  9ICC A;  4UB3 A;  4KLJ A;  1BPY A;  4KLT A;  2GA9 D;  3OWG A;  3AQM A;  1MIY A;  5HHI A;  4K4G A;  4PGQ A;  4UB5 A;  3JPR A;  4XQ7 A;  5J2H A;  4K96 A;  4OAG A;  8ICT A;  3C2M A;  8ICX A;  4I2C A;  4X4O A;  5DBB A;  4WC4 A;  2IHO A;  4Z6F A;  1XSN A;  5J0W A;  4I2E A;  4M47 A;  4KLO A;  3MGI A;  4QZB A;  1YLQ A;  4KLI A;  9ICU A;  4IQU A;  4EEB A;  2ZH4 A;  4X4T A;  9ICW A;  2ZHA A;  3B0X A;  3RJI A;  4YCX A;  7ICI A;  4KLM A;  3JZ0 A;  3OVB A;  2BCQ A;  4LEW A;  3ER8 C;  4F5O A;  2DVI A;  4M9J A;  1ZQD A;  1JQR A;  4I2I A;  4TUS A;  4R64 A;  4AT9 A;  1ZQF A;  5IIN A;  4O6A A;  4NY8 A;  9ICB A;  4K99 A;  4O5E A;  4N7R A;  3HJ4 A;  3JPT A;  3V7J A;  4DO9 A;  4JWM A;  4KLG A;  5III A;  3NKU A;  5IIL A;  8ICK A;  4X4P A;  4M9N A;  1ZQK A;  3RJG A;  4PGX A;  3RJH A;  2DRB A;  2IUB A;  2BCS A;  1ZQG A;  4XRH A;  1GPJ A;  2RFF A;  2PBE A;  4GXK A;  4X4V A;  3WFS C;  1TVA A;  4UBB A;  4WC6 A;  3RH6 A;  4TUR A;  3LK9 A;  8ICJ A;  4Z6E A;  5DB7 A;  4F5P A;  4RQ8 A;  4NLN A;  3TFR A;  4AT9 B;  2ID1 A;  2ZH7 A;  7ICM A;  1ZQJ A;  4I2G A;  4O9M A;  2BCR A;  4KLS A;  4GXJ A;  4RWP A;  4FO6 A;  4QZA A;  2ZHB A;  4LEY A;  9ICA A;  4AT8 A;  3PHZ A;  4NM2 A;  3ISD A;  4E8F A;  2M2V A;  4WQL A;  5CA7 A;  4YN4 A;  3HJ1 A;  4EBK A;  4RWO A;  4I28 A;  4WC3 A;  3RJJ A;  3C2K A;  2BPG A;  5HRB A;  4QZG A;  2ZH1 A;  7ICE A;  4QZF A;  4UAY A;  3LQC B;  5J2J A;  4P2H A;  4OAF A;  9ICE A;  8ICY A;  1ZQV A;  4UB2 A;  2PFQ A;  4RPX A;  1TFW A;  3AQN A;  4I2F A;  1JMS A;  4AT8 B;  8ICR A;  3UXO A;  4NXX A;  3MGH A;  5EOZ A;  7ICJ A;  5J29 A;  3UPS A;  4RT3 A;  4KLE A;  4X4Q A;  4NXU A;  1MQ3 A;  4K4H A;  8ICU A;  9ICQ A;  4K4I A;  3C5G A;  1KNY A;  4QZH A;  3H37 A;  4JWN A;  1R8B A;  2ZH5 A;  1ZQP A;  5HRH A;  5DBA A;  2B51 A;  1BPB A;  5DKW A;  5J0Y A;  5D46 A;  9ICX A;  8ICW A;  3V7L A;  9ICS A;  1VFG A;  4PH5 A;  4KLQ A;  2BCU A;  4WC7 A;  4RQ7 A;  5BOM A;  1RPL A;  4PHA A;  3AUO A;  1BPE A;  3MDC A;  4NM1 A;  5J2A A;  5CP2 A;  4UB1 A;  7ICP A;  1ZQA A;  4KLF A;  2PFN A;  4M04 A;  4EGW A;  2O1P A;  5D63 A;  1XSP A;  5HC9 A;  5CWR A;  4OAH A;  4R63 A;  1F5A A;  4IQT A;  1BPX A;  2GWS A;  4F5R A;  4I27 A;  4XQ8 A;  3V7K A;  8ICO A;  2EWR A;  5DB9 A;  4EV6 A;  3MCR A;  4FHP A;  4NXV A;  4WC2 A;  4QZD A;  4O68 A;  4AT7 A;  4M2Y A;  1ZQM A;  3WFO A;  5HRF A;  1Q78 A;  4YD2 A;  1ZQZ A;  9ICF A;  4FH3 A;  4PGY A;  5B3P A;  1NOM A;  4LEZ A;  5DDM A;  4RWN A;  5CFU A;  4MFC A;  5CHE A;  2I9G A;  4RQ5 A;  3GDX A;  5F2V O;  7ICT A;  4WBZ A;  8ICE A;  1ZQT A;  4QZI A;  1UET A;  4F5Q A;  4XJE A;  1TFY A;  4LT6 A;  1ZQB A;  4AT7 B;  5BOL A;  3RJE A;  9ICL A;  5IIJ A;  5J2E A;  5CHG A;  4EED A;  4O5C A;  2BPC A;  4HX0 A;  9ICJ A;  4IG8 A;  5D61 A;  4DOC A;  1R89 A;  4LVS A;  4Z6D A;  4O5K A;  7ICG A;  4WC0 A;  2B4V A;  2PFP A;  5D62 A;  1KDH A;  2M2T A;  3PMN A;  3C18 A;  4MKP A;  7ICH A;  4RT2 A;  1VJ7 A;  4FH5 A;  4F5N A;  1ZQS A;  8ICM A;  8ICZ A;  7ICL A;  4I2B A;  4YMN A;  4LZG A;  2HN1 A;  2DR9 A;  2P66 A;  8ICG A;  5J0X A;  4K97 A;  4QZC A;  5J0Q A;  1TV9 A;  4K9A A;  2O5A A;  1FA0 A;  1UEU A;  1KEJ A;  1V4A A;  5J2B A;  1OU5 A;  9ICH A;  5IIM A;  4R66 A;  2BBJ A;  4PHD A;  7ICO A;  2DR7 A;  3B0Y A;  7ICU A;  8ICL A;  5DDY A;  8ICQ A;  7ICN A;  3JPN A;  8ICP A;  3V72 A;  2BBH A;  4NLZ A;  3HWT A;  4TUQ A;  1ZQQ A;  3H38 A;  4QZ9 A;  9ICT A;  1HUO A;  2NRK A;  5HRK A;  3K75 D;  2DR5 A;  1NO5 A;  2M2W A;  5DBC A;  4IQW A;  4WH5 A;  2BE3 A;  8ICF A;  8ICN A;  3WFQ E;  1Q79 A;  4FHV A;  3H3A A;  4PHP A;  4KLD A;  4I2D A;  4P4M A;  4NXW A;  1ZJM A;  4K8V A;  5DED A;  3WFR E;  2W9M A;  4I2J A;  7ICR A;  2VAN A;  9ICG A;  2ZH3 A;  1BPD A;  5HRI A;  4RQ2 A;  3ISB A;  2FMS A;  3L9D A;  5J0U A;  4MF2 A;  4M0A A;  1ZQC A;  3NWI A;  2DR8 A;  5CB1 A;  3JPO A;  2DRA A;  3AQL A;  4YMM A;  4EP7 A;  3JPQ A;  5D4B A;  1ZJN A;  4IQV A;  5B3Q A;  4RWQ A;  3AU2 A;  1BPZ A;  7ICS A;  4I2H A;  1ZQX A;  5J0P A;  5HRE A;  4M9G A;  5DB8 A;  3ISC A;  3JYY A;  2IHM A;  9ICR A;  4UB4 A;  4WCW A;  4S3N A;  2ZH9 A;  3PNC A;  5HR9 A;  4FHW A;  3OUY A;  5CJ7 A;  5D49 A; 
#chains in the Genus database with same CATH homology
 4X4N A;  4UD5 A;  3RH4 A;  1RZT A;  3HW8 A;  7ICK A;  3AQK A;  1MIW A;  3C5F A;  7ICQ A;  4EBJ A;  4PPX A;  4RQ6 A;  5J0S A;  8ICI A;  4FHX A;  4M9L A;  3UPQ A;  1PX5 A;  5IIO A;  5IIK A;  3RJK A;  8ICA A;  4FHY A;  9ICM A;  4RQ0 A;  9ICP A;  4RQ3 A;  1XSL A;  5DB6 A;  3OUY B;  4KLL A;  1R8A A;  5HHH A;  4YD1 A;  3PML A;  5J0T A;  5J2C A;  3MDA A;  4E80 A;  5HRD A;  4DOA A;  3C66 A;  2PFO A;  4QZ8 A;  4RPZ A;  5J2F A;  3JPS A;  2HHP A;  4PHE A;  4ATB A;  4QZE A;  3UXP A;  3MBY A;  4M9H A;  9ICI A;  1ZQW A;  2FMP A;  2ISO A;  8ICV A;  3OV7 A;  4WC1 A;  3UQ0 A;  4MFA A;  1WOT A;  2PXI A;  4P4P A;  5HRG A;  9ICO A;  1ZQI A;  1R8C A;  4XUS A;  2FMQ A;  8ICB A;  1JN3 A;  5J0R A;  4X0B A;  1JAJ A;  4I2A A;  1MQ2 A;  2M2U A;  4NKT A;  3RH5 A;  4X4R A;  2BPF A;  4X4S A;  4ATB B;  9ICV A;  3AU6 A;  2ZH2 A;  3RJF A;  8ICC A;  4DOB A;  2ISP A;  2BCV A;  4P4O A;  4E7X A;  3HIY A;  5J0O A;  3H39 A;  4X0A A;  4NLK A;  3NYB A;  4MFF A;  3HX0 A;  4KLH A;  8ICS A;  4KLU A;  3TFS A;  4RQ1 A;  4UAW A;  7ICF A;  5J2G A;  2Q66 A;  3UXN A;  4UBC A;  5J2I A;  3OVS A;  9ICN A;  4MF8 A;  4WC5 A;  5TZV A;  2ZH6 A;  1ZQR A;  4YMO A;  1ZQL A;  9ICK A;  5BPC A;  3JPP A;  4NKU A;  3OGU A;  1MIV A;  1ZQO A;  4XA5 A;  4RQ4 A;  1HUZ A;  4UD4 A;  1ZQN A;  3OVA A;  8ICH A;  3C2L A;  4UAZ A;  4I29 A;  5HRL A;  5DEC A;  4NXZ A;  4LZD A;  4TUP A;  1ZQH A;  1ZQE A;  4M5D A;  5CR0 A;  4RPY A;  4GXI A;  3UQ2 A;  5J2K A;  1ZQU A;  3WFP A;  4Z6C A;  4X4U A;  1ZQY A;  5J2D A;  7ICV A;  1UEV A;  4R65 A;  4X5V A;  4WBY A;  2ZH8 A;  9ICC A;  4UB3 A;  4KLJ A;  1BPY A;  4KLT A;  3AQM A;  1MIY A;  5HHI A;  4K4G A;  4PGQ A;  4UB5 A;  3JPR A;  4XQ7 A;  5J2H A;  8ICT A;  3C2M A;  8ICX A;  4I2C A;  4X4O A;  5DBB A;  4WC4 A;  4Z6F A;  1XSN A;  5J0W A;  4I2E A;  4M47 A;  4KLO A;  3MGI A;  4QZB A;  1YLQ A;  4KLI A;  9ICU A;  4IQU A;  2ZH4 A;  4X4T A;  9ICW A;  2ZHA A;  3B0X A;  3RJI A;  4YCX A;  7ICI A;  4KLM A;  3JZ0 A;  3OVB A;  2BCQ A;  4F5O A;  2DVI A;  4M9J A;  1ZQD A;  1JQR A;  4I2I A;  4TUS A;  4R64 A;  4AT9 A;  1ZQF A;  5IIN A;  4NY8 A;  9ICB A;  4O5E A;  3HJ4 A;  3JPT A;  3V7J A;  4DO9 A;  4JWM A;  4KLG A;  5III A;  5IIL A;  8ICK A;  4X4P A;  4M9N A;  1ZQK A;  3RJG A;  4PGX A;  3RJH A;  2DRB A;  2BCS A;  1ZQG A;  4XRH A;  2RFF A;  2PBE A;  4GXK A;  4X4V A;  3WFS C;  1TVA A;  4UBB A;  4WC6 A;  3RH6 A;  4TUR A;  3LK9 A;  8ICJ A;  4Z6E A;  5DB7 A;  4F5P A;  4RQ8 A;  4NLN A;  3TFR A;  4AT9 B;  2ZH7 A;  2ID1 A;  7ICM A;  1ZQJ A;  4I2G A;  4O9M A;  2BCR A;  4KLS A;  4GXJ A;  4RWP A;  4FO6 A;  4QZA A;  2ZHB A;  9ICA A;  4AT8 A;  4NM2 A;  3ISD A;  4E8F A;  2M2V A;  5CA7 A;  4YN4 A;  3HJ1 A;  4EBK A;  4RWO A;  4I28 A;  4WC3 A;  3RJJ A;  3C2K A;  2BPG A;  5HRB A;  4QZG A;  2ZH1 A;  7ICE A;  4QZF A;  4UAY A;  3LQC B;  5J2J A;  4P2H A;  9ICE A;  8ICY A;  1ZQV A;  4UB2 A;  2PFQ A;  4RPX A;  1TFW A;  3AQN A;  4I2F A;  1JMS A;  4AT8 B;  8ICR A;  3UXO A;  3MGH A;  5EOZ A;  7ICJ A;  5J29 A;  3UPS A;  4RT3 A;  4KLE A;  4X4Q A;  1MQ3 A;  4K4H A;  8ICU A;  9ICQ A;  4K4I A;  3C5G A;  1KNY A;  4QZH A;  3H37 A;  4JWN A;  1R8B A;  2ZH5 A;  1ZQP A;  5HRH A;  5DBA A;  5DKW A;  1BPB A;  5J0Y A;  5D46 A;  9ICX A;  8ICW A;  3V7L A;  9ICS A;  1VFG A;  4PH5 A;  4KLQ A;  2BCU A;  4WC7 A;  4RQ7 A;  5BOM A;  1RPL A;  4PHA A;  3AUO A;  3MDC A;  1BPE A;  4NM1 A;  5J2A A;  5CP2 A;  4UB1 A;  7ICP A;  1ZQA A;  4KLF A;  2PFN A;  4M04 A;  2O1P A;  1XSP A;  5HC9 A;  5CWR A;  4R63 A;  1F5A A;  4IQT A;  1BPX A;  2GWS A;  4F5R A;  4I27 A;  4XQ8 A;  3V7K A;  8ICO A;  5DB9 A;  4FHP A;  4WC2 A;  4QZD A;  4AT7 A;  4M2Y A;  1ZQM A;  3WFO A;  5HRF A;  1Q78 A;  4YD2 A;  1ZQZ A;  9ICF A;  4FH3 A;  4PGY A;  1NOM A;  5DDM A;  4RWN A;  4MFC A;  2I9G A;  4RQ5 A;  3GDX A;  5F2V O;  7ICT A;  4WBZ A;  8ICE A;  1ZQT A;  4QZI A;  1UET A;  4F5Q A;  1TFY A;  4LT6 A;  1ZQB A;  4AT7 B;  5BOL A;  3RJE A;  9ICL A;  5IIJ A;  5J2E A;  5CHG A;  4O5C A;  2BPC A;  9ICJ A;  4IG8 A;  4DOC A;  1R89 A;  4LVS A;  4Z6D A;  4O5K A;  7ICG A;  4WC0 A;  2PFP A;  1KDH A;  2M2T A;  3PMN A;  3C18 A;  7ICH A;  4RT2 A;  1VJ7 A;  4FH5 A;  4F5N A;  1ZQS A;  8ICM A;  8ICZ A;  7ICL A;  4I2B A;  4YMN A;  4LZG A;  2DR9 A;  2P66 A;  8ICG A;  5J0X A;  4QZC A;  5J0Q A;  1TV9 A;  2O5A A;  1FA0 A;  1UEU A;  1KEJ A;  1V4A A;  5J2B A;  1OU5 A;  9ICH A;  5IIM A;  4R66 A;  4PHD A;  7ICO A;  2DR7 A;  3B0Y A;  7ICU A;  8ICL A;  5DDY A;  8ICQ A;  7ICN A;  3JPN A;  8ICP A;  3V72 A;  4NLZ A;  3HWT A;  4TUQ A;  1ZQQ A;  3H38 A;  4QZ9 A;  9ICT A;  1HUO A;  2NRK A;  5HRK A;  3K75 D;  2DR5 A;  1NO5 A;  2M2W A;  5DBC A;  4IQW A;  2BE3 A;  8ICF A;  8ICN A;  3WFQ E;  1Q79 A;  4FHV A;  3H3A A;  4PHP A;  4KLD A;  4I2D A;  4P4M A;  1ZJM A;  5DED A;  3WFR E;  2W9M A;  4I2J A;  7ICR A;  2VAN A;  9ICG A;  2ZH3 A;  1BPD A;  5HRI A;  4RQ2 A;  3ISB A;  2FMS A;  3L9D A;  5J0U A;  4MF2 A;  4M0A A;  1ZQC A;  2DR8 A;  5CB1 A;  3JPO A;  2DRA A;  3AQL A;  4YMM A;  4EP7 A;  3JPQ A;  5D4B A;  1ZJN A;  4IQV A;  4RWQ A;  3AU2 A;  1BPZ A;  7ICS A;  4I2H A;  1ZQX A;  5J0P A;  5HRE A;  4M9G A;  5DB8 A;  3ISC A;  3JYY A;  2IHM A;  9ICR A;  4UB4 A;  4WCW A;  4S3N A;  2ZH9 A;  3PNC A;  5HR9 A;  4FHW A;  3OUY A;  5CJ7 A;  5D49 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...