1YLQA

Crystal structure of putative nucleotidyltransferase
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
93
structure length
93
Chain Sequence
AGHMKEIKEITKKDVQDAEIYLYGSVVEGDYSIGLSDIDVAIVSDVFEDRNRKLEFFGKITKKFFDSPFEFHILTKKEWKMSKRFIRKYRRLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative nucleotidyltransferase, hypothetical protein AF0614
publication title Crystal structure of Hypothetical protein AF0614, putative nucleotidyltransferase
rcsb
source organism Archaeoglobus fulgidus
molecule tags Transferase
total genus 29
structure length 93
sequence length 93
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01909 NTP_transf_2 Nucleotidyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 1ylqA00
3PMNA 4X0BA 3AQMA 3OVAA 5J0YA 5IIIA 4UB4A 2M2VA 3PMLA 9ICTA 1F5AA 9ICSA 5DDMA 8ICPA 4WC5A 3C66A 5HRGA 4FHYA 4I27A 4UBBA 2BCQA 2ISOA 4RWOA 4X4QA 2P66A 4LVSA 1R8AA 5CP2A 4GXIA 1XSLA 1JMSA 2ZHAA 1R8CA 4PGQA 4QZFA 3V7KA 4WC4A 4QZAA 2DR9A 1YLQA 4KLDA 7ICTA 4Z6FA 1Q79A 1ZQRA 3B0XA 4NLNA 1TVAA 5HRIA 1VJ7A 4AT7A 7ICUA 2DR8A 4PHDA 4JWMA 7ICRA 4IQWA 2DR7A 2ZH7A 4ATBA 5DBBA 8ICCA 5DDYA 3OUYB 5J2HA 5J0QA 5DECA 8ICXA 4RT3A 4AT9B 4R64A 8ICOA 1R89A 4DOAA 3PNCA 3AQNA 4KLUA 4QZGA 3LQCB 9ICKA 4E7XA 7ICIA 3UPQA 8ICHA 3MDCA 9ICQA 4X0AA 4UD4A 4KLLA 4P4MA 3RJEA 4XA5A 3TFSA 1ZQGA 5DBCA 5HHIA 4I2EA 4MFAA 9ICUA 1FA0A 4I2IA 5BPCA 4WC1A 3WFQE 4RWNA 3H39A 4O5KA 4IG8A 1TFWA 2DRAA 5CWRA 7ICHA 5HRDA 4X5VA 4RQ4A 1MQ3A 4K4IA 9ICAA 1HUZA 2PFOA 1HUOA 1PX5A 4O9MA 9ICVA 5DKWA 2VANA 4TUQA 1KEJA 3V72A 5HR9A 3UXPA 4YMNA 4M47A 4FH5A 4RQ7A 1R8BA 4PHPA 4YCXA 1ZQLA 4IQVA 7ICPA 5J2GA 1ZQJA 2ZH5A 7ICSA 5HRBA 4WC6A 4KLJA 4I2CA 7ICKA 1UETA 1XSNA 8ICSA 1KNYA 3AUOA 1RZTA 1BPYA 4NKTA 1ZQBA 4YMOA 4PH5A 4FHPA 3H37A 8ICGA 4NM1A 4IQTA 4TUPA 3JPOA 4F5NA 3ISBA 4GXKA 4WCWA 4TUSA 9ICIA 2PXIA 1MIWA 4MF8A 3JPPA 1ZQHA 3UQ2A 5D49A 2GWSA 4YD2A 1UEUA 5HHHA 5J2CA 4DO9A 3AQKA 2BCRA 4PHAA 4UB3A 3OGUA 4RPXA 1ZQFA 4UD5A 5J0TA 1Q78A 8ICKA 3K75D 3OV7A 3L9DA 4X4OA 4F5QA 2PFPA 1WOTA 1ZQUA 5CR0A 3C18A 2BCSA 4RQ3A 4I2AA 5IINA 1TFYA 3JZ0A 5J0PA 1ZQYA 4RQ6A 3C5GA 3RH5A 4QZIA 2M2TA 2ZH1A 2BE3A 4M9GA 4KLTA 1JQRA 7ICOA 4X4RA 7ICNA 8ICAA 4LZGA 4I2FA 7ICMA 5J0SA 4R66A 5CB1A 2PFQA 1ZQIA 4QZ8A 4KLQA 2DRBA 3HJ1A 2BCUA 5J29A 2NRKA 4NKUA 9ICPA 4DOCA 1JAJA 1ZQQA 1ZQXA 1ZQZA 1ZQAA 5BOMA 1TV9A 3RJKA 3C2LA 3NYBA 5HREA 1NOMA 4KLFA 5J2BA 1OU5A 4F5PA 4P4OA 5DB8A 4MF2A 8ICWA 4FHXA 3MDAA 1NO5A 7ICFA 4NM2A 3MGHA 4NLKA 5CJ7A 3V7LA 3OVSA 4K4GA 8ICFA 4NY8A 4KLMA 8ICVA 3GDXA 4E80A 3WFPA 2ZH2A 4M9LA 3V7JA 4M04A 4X4TA 7ICGA 1BPDA 4X4VA 3UXNA 5D4BA 2ZH3A 4EP7A 4DOBA 3RJHA 4XQ7A 4X4NA 1MIYA 4P4PA 4M9JA 8ICRA 2DR5A 3UQ0A 4R65A 4UBCA 3C2KA 8ICMA 3JPRA 3ISCA 3B0YA 2M2UA 4Z6DA 3RH4A 5IILA 5DB7A 1UEVA 1ZQTA 4NXZA 4UAZA 9ICNA 4KLEA 2ZH6A 9ICCA 4AT7B 1BPEA 9ICGA 3UXOA 4WBZA 4AT8B 4EBKA 3MGIA 3WFSC 5HRHA 4MFFA 4M9HA 3HIYA 3RJJA 4ATBB 4FH3A 4I28A 4M0AA 2O5AA 1ZQVA 4WC2A 8ICUA 2ID1A 8ICZA 9ICOA 4UAWA 4RPYA 9ICRA 4KLIA 5CHGA 4LT6A 5DB6A 5J0WA 4O5EA 9ICWA 4QZDA 5HC9A 5HRKA 5IIOA 3OUYA 4AT9A 1ZJNA 4X4SA 3JPSA 4F5OA 5J0OA 4I29A 4I2HA 3H38A 1ZQDA 3JPTA 9ICFA 4I2DA 1ZQEA 4RQ2A 3WFOA 4UAYA 1VFGA 3AQLA 2PFNA 1BPXA 8ICEA 4WBYA 2ZH4A 7ICLA 5CA7A 4QZBA 8ICQA 4XRHA 5J2JA 4KLGA 5J2FA 4QZ9A 4UB2A 2HHPA 9ICXA 5HRLA 2FMPA 4R63A 2PBEA 2ZH9A 1KDHA 5D46A 3RJGA 4EBJA 2I9GA 1V4AA 4MFCA 1MIVA 4UB5A 5J2KA 4KLHA 4XUSA 4M9NA 3TFRA 4UB1A 9ICMA 3RJIA 5J0UA 3C5FA 1ZQCA 1BPZA 4RWPA 3LK9A 5TZVA 5IIKA 4M5DA 2FMQA 4AT8A 2Q66A 4I2BA 4NLZA 8ICJA 4O5CA 2O1PA 4X4PA 7ICEA 3AU6A 4RT2A 4RQ1A 5J2DA 2BPCA 4Z6CA 4F5RA 4XQ8A 1ZQWA 2BCVA 3HW8A 4WC3A 4QZEA 4RQ8A 2BPGA 3C2MA 5IIMA 3HWTA 4YMMA 8ICBA 4PHEA 8ICLA 5J0XA 2ZH8A 4RQ0A 4E8FA 9ICLA 4JWNA 3MBYA 4QZHA 5J2AA 3AU2A 2ZHBA 4LZDA 4P2HA 4WC7A 2ISPA 4FO6A 5J2EA 5J0RA 4M2YA 1BPBA 1ZQPA 3RH6A 3JYYA 4I2JA 3JPQA 9ICHA 4PGYA 5IIJA 5DEDA 9ICBA 2IHMA 1ZQMA 7ICJA 5J2IA 4TURA 4KLSA 2FMSA 5DBAA 5BOLA 4GXJA 4KLOA 3JPNA 4QZCA 2DVIA 4PPXA 4K4HA 1JN3A 4YD1A 1XSPA 2RFFA 1ZQOA 3RJFA 3WFRE 2BPFA 2M2WA 4S3NA 1ZQKA 4RPZA 1ZQSA 4RQ5A 1RPLA 4Z6EA 3UPSA 8ICIA 3H3AA 5HRFA 3OVBA 5DB9A 4I2GA 3ISDA 4IQUA 5EOZA 4PGXA 4FHWA 5F2VO 3HX0A 1ZJMA 9ICJA 9ICEA 3HJ4A 4FHVA 4WC0A 2W9MA 4YN4A 1MQ2A 7ICQA 4X4UA 1ZQNA 8ICNA 8ICTA 8ICYA 4RWQA 7ICVA
chains in the Genus database with same CATH superfamily
2FCLA 3PMNA 4X0BA 3AQMA 3OVAA 5J0YA 5IIIA 4UB4A 2M2VA 3PMLA 9ICTA 1F5AA 9ICSA 5DDMA 8ICPA 4WC5A 3C66A 5HRGA 4FHYA 4I27A 4UBBA 2BCQA 2ISOA 4RWOA 4X4QA 4EV6A 2P66A 5CFUA 4LVSA 1R8AA 5CP2A 4GXIA 1XSLA 1JMSA 2ZHAA 1R8CA 4PGQA 4WQKA 4QZFA 3V7KA 4WC4A 4QZAA 2DR9A 1YLQA 4KLDA 4MKPA 7ICTA 4Z6FA 1Q79A 1ZQRA 3B0XA 4NLNA 1TVAA 5HRIA 1VJ7A 4AT7A 7ICUA 4KB6A 2DR8A 4PHDA 3NVOA 4JWMA 7ICRA 4IQWA 2DR7A 3ER8C 2ZH7A 4ATBA 5DBBA 8ICCA 5DDYA 3OUYB 5J2HA 5J0QA 5DECA 8ICXA 4RT3A 4AT9B 4R64A 4K98A 1R89A 8ICOA 4DOAA 3PNCA 3AQNA 4KLUA 4QZGA 3LQCB 9ICKA 4LEWA 4E7XA 7ICIA 3UPQA 5D62A 8ICHA 3MDCA 9ICQA 4X0AA 4UD4A 4KLLA 4P4MA 3RJEA 4XA5A 3TFSA 4K9AA 1ZQGA 4NXXA 5DBCA 5HHIA 4I2EA 4MFAA 9ICUA 1FA0A 4I2IA 5BPCA 3ER9B 4WC1A 3WFQE 4JLZA 4RWNA 3H39A 4O5KA 4IG8A 1TFWA 2DRAA 5CWRA 7ICHA 5HRDA 4X5VA 4RQ4A 1MQ3A 4K4IA 9ICAA 1HUZA 2PFOA 1HUOA 1PX5A 4O9MA 9ICVA 5DKWA 2VANA 4TUQA 4OAFA 1KEJA 3V72A 5HR9A 3UXPA 4YMNA 4M47A 4FH5A 4RQ7A 1R8BA 4PHPA 4YCXA 1ZQLA 4IQVA 7ICPA 5J2GA 2HN1A 1ZQJA 2ZH5A 7ICSA 5HRBA 4WC6A 4KLJA 4I2CA 7ICKA 1UETA 1XSNA 8ICSA 1KNYA 3NKUA 4NXTA 3AUOA 1RZTA 1BPYA 4NKTA 1ZQBA 4YMOA 4PH5A 4FHPA 3H37A 8ICGA 4NM1A 4IQTA 4TUPA 3JPOA 5B3QA 4F5NA 3ISBA 4GXKA 4WCWA 4TUSA 9ICIA 2BBJA 2PXIA 1MIWA 3EF2A 4MF8A 3JPPA 1ZQHA 3UQ2A 5D49A 2GWSA 4YD2A 1UEUA 4K97A 5HHHA 5J2CA 4DO9A 3AQKA 2BCRA 4PHAA 3PHZA 4UB3A 3OGUA 4RPXA 1ZQFA 4UD5A 5J0TA 1Q78A 5CHEA 8ICKA 3K75D 3OV7A 3L9DA 4X4OA 4F5QA 2PFPA 1WOTA 1ZQUA 4EEBA 5CR0A 3C18A 2BCSA 4RQ3A 4I2AA 5IINA 1TFYA 3JZ0A 5J0PA 1ZQYA 4WH5A 4RQ6A 3C5GA 3RH5A 4N7RA 4QZIA 2M2TA 2BE3A 2ZH1A 4M9GA 4KLTA 2GAFD 4O67A 7ICOA 1JQRA 4X4RA 2EWRA 7ICNA 8ICAA 5B3PA 4LZGA 4I2FA 7ICMA 5J0SA 4R66A 4OAHA 5CB1A 2PFQA 1ZQIA 4QZ8A 4KLQA 3MCRA 3HJ1A 2DRBA 2BCUA 5J29A 4OAGA 2NRKA 2GA9D 4NKUA 9ICPA 4DOCA 1JAJA 1ZQQA 1ZQXA 1ZQZA 1ZQAA 5BOMA 1TV9A 3RJKA 3C2LA 3NYBA 5HREA 1NOMA 4KLFA 5J2BA 1OU5A 4F5PA 4P4OA 5DB8A 4MF2A 8ICWA 4FHXA 4WOYA 3MDAA 1NO5A 7ICFA 4NM2A 3MGHA 4NLKA 4JLXA 5CJ7A 3V7LA 3OVSA 4K4GA 8ICFA 4NY8A 4KLMA 8ICVA 4O6AA 4NXVA 3GDXA 4E80A 3WFPA 2ZH2A 4OAIZ 3V7JA 5CFSA 4M04A 4M9LA 4X4TA 7ICGA 4FO1A 1BPDA 4X4VA 3UXNA 4O69A 5D4BA 2ZH3A 4EP7A 4DOBA 3RJHA 4XQ7A 4X4NA 1MIYA 4P4PA 4M9JA 8ICRA 2DR5A 3UQ0A 4R65A 4O68A 4UBCA 3C2KA 8ICMA 3JPRA 3ISCA 4EGWA 3B0YA 2M2UA 4Z6DA 3RH4A 2HN2A 5IILA 5DB7A 1UEVA 1ZQTA 4NXZA 4UAZA 4K96A 9ICNA 4KLEA 2ZH6A 9ICCA 4AT7B 1BPEA 9ICGA 3UXOA 4WBZA 4AT8B 4EBKA 3MGIA 3JCFA 3WFSC 5HRHA 4MFFA 4M9HA 3HIYA 3RJJA 4ATBB 4FH3A 4I28A 4M0AA 2O5AA 1ZQVA 4WC2A 8ICUA 2ID1A 8ICZA 9ICOA 4UAWA 4RPYA 9ICRA 4KLIA 5CHGA 4LT6A 5DB6A 5J0WA 4O5EA 9ICWA 4QZDA 5HC9A 5HRKA 5IIOA 3OUYA 4AT9A 1ZJNA 4LEVA 4X4SA 3JPSA 4F5OA 4NXWA 5J0OA 4I29A 4I2HA 3H38A 1ZQDA 4XJEA 3JPTA 9ICFA 4I2DA 2B51A 1ZQEA 4RQ2A 3WFOA 4UAYA 1VFGA 3AQLA 2PFNA 1BPXA 8ICEA 4WBYA 2ZH4A 7ICLA 5CFTA 5CA7A 4QZBA 8ICQA 4KM5A 4XRHA 5J2JA 4KLGA 5J2FA 4QZ9A 4UB2A 2HHPA 9ICXA 5HRLA 2FMPA 4R63A 2PBEA 2ZH9A 1KDHA 5D46A 3RJGA 4EBJA 2I9GA 1V4AA 4MFCA 1MIVA 4UB5A 5J2KA 4KLHA 4XUSA 4M9NA 3TFRA 4UB1A 9ICMA 3RJIA 5J0UA 3C5FA 1ZQCA 1BPZA 4RWPA 3LK9A 5TZVA 5IIKA 4M5DA 2FMQA 4AT8A 2Q66A 2IUBA 4WQLA 4LEZA 4I2BA 4NLZA 8ICJA 2IHOA 4O5CA 1GPJA 2O1PA 4X4PA 7ICEA 3AU6A 4RT2A 4RQ1A 5J2DA 2BPCA 4Z6CA 4F5RA 4XQ8A 5D63A 1ZQWA 2BCVA 3K7DA 3HW8A 4WC3A 4QZEA 4RQ8A 2BPGA 3C2MA 5IIMA 3HWTA 4YMMA 4K9BA 8ICBA 4PHEA 2BBHA 5JTGA 8ICLA 5J0XA 2ZH8A 4RQ0A 4E8FA 9ICLA 4JWNA 4LEYA 3MBYA 4QZHA 4HX0A 5J2AA 4I0UA 3AU2A 2ZHBA 4LZDA 4P2HA 4WC7A 2ISPA 4FO6A 5J2EA 5J0RA 4M2YA 1BPBA 1ZQPA 3ERCC 3RH6A 3JYYA 4I2JA 3JPQA 9ICHA 4PGYA 5IIJA 5DEDA 9ICBA 4K99A 2IHMA 1ZQMA 7ICJA 2B4VA 4TURA 5J2IA 4KLSA 3OWGA 5DBAA 2FMSA 5BOLA 4GXJA 4KLOA 3JPNA 4QZCA 2DVIA 4PPXA 4K4HA 1JN3A 4YD1A 1XSPA 2RFFA 1ZQOA 3RJFA 2B56A 3WFRE 2BPFA 2M2WA 4EEDA 4S3NA 4RPZA 1ZQKA 1ZQSA 4RQ5A 1RPLA 4Z6EA 3UPSA 8ICIA 3CK6A 3H3AA 5HRFA 3OVBA 4K8VA 5DB9A 4I2GA 3ISDA 4IQUA 5EOZA 3NWIA 4PGXA 4FHWA 5F2VO 3HX0A 1ZJMA 9ICJA 9ICEA 3HJ4A 4FHVA 4WC0A 2W9MA 4YN4A 1MQ2A 7ICQA 4X4UA 1ZQNA 8ICNA 4NXUA 5D61A 8ICTA 8ICYA 4RWQA 7ICVA
chains in the Genus database with same CATH topology
3PMNA 4X0BA 3AQMA 3OVAA 5J0YA 5IIIA 4UB4A 2M2VA 3PMLA 9ICTA 1F5AA 9ICSA 5DDMA 8ICPA 4WC5A 3C66A 5HRGA 4FHYA 4I27A 4UBBA 2BCQA 2ISOA 4RWOA 4X4QA 2P66A 4LVSA 1R8AA 5CP2A 4GXIA 1XSLA 1JMSA 2ZHAA 1R8CA 4PGQA 4QZFA 3V7KA 4WC4A 4QZAA 2DR9A 1YLQA 4KLDA 7ICTA 4Z6FA 1Q79A 1ZQRA 3B0XA 4NLNA 1TVAA 5HRIA 1VJ7A 4AT7A 7ICUA 2DR8A 4PHDA 4JWMA 7ICRA 4IQWA 2DR7A 2ZH7A 4ATBA 5DBBA 8ICCA 5DDYA 3OUYB 5J2HA 5J0QA 5DECA 8ICXA 4RT3A 4AT9B 4R64A 8ICOA 1R89A 4DOAA 3PNCA 3AQNA 4KLUA 4QZGA 3LQCB 9ICKA 4E7XA 7ICIA 3UPQA 8ICHA 3MDCA 9ICQA 4X0AA 4UD4A 4KLLA 4P4MA 3RJEA 4XA5A 3TFSA 1ZQGA 5DBCA 5HHIA 4I2EA 4MFAA 9ICUA 1FA0A 4I2IA 5BPCA 4WC1A 3WFQE 4RWNA 3H39A 4O5KA 4IG8A 1TFWA 2DRAA 5CWRA 7ICHA 5HRDA 4X5VA 4RQ4A 1MQ3A 4K4IA 9ICAA 1HUZA 2PFOA 1HUOA 1PX5A 4O9MA 9ICVA 5DKWA 2VANA 4TUQA 1KEJA 3V72A 5HR9A 3UXPA 4YMNA 4M47A 4FH5A 4RQ7A 1R8BA 4PHPA 4YCXA 1ZQLA 4IQVA 7ICPA 5J2GA 1ZQJA 2ZH5A 7ICSA 5HRBA 4WC6A 4KLJA 4I2CA 7ICKA 1UETA 1XSNA 8ICSA 1KNYA 3AUOA 1RZTA 1BPYA 4NKTA 1ZQBA 4YMOA 4PH5A 4FHPA 3H37A 8ICGA 4NM1A 4IQTA 4TUPA 3JPOA 4F5NA 3ISBA 4GXKA 4WCWA 4TUSA 9ICIA 2PXIA 1MIWA 4MF8A 3JPPA 1ZQHA 3UQ2A 5D49A 2GWSA 4YD2A 1UEUA 5HHHA 5J2CA 4DO9A 3AQKA 2BCRA 4PHAA 4UB3A 3OGUA 4RPXA 1ZQFA 4UD5A 5J0TA 1Q78A 8ICKA 3K75D 3OV7A 3L9DA 4X4OA 4F5QA 2PFPA 1WOTA 1ZQUA 5CR0A 3C18A 2BCSA 4RQ3A 4I2AA 5IINA 1TFYA 3JZ0A 5J0PA 1ZQYA 4RQ6A 3C5GA 3RH5A 4QZIA 2M2TA 2ZH1A 2BE3A 4M9GA 4KLTA 1JQRA 7ICOA 4X4RA 7ICNA 8ICAA 4LZGA 4I2FA 7ICMA 5J0SA 4R66A 5CB1A 2PFQA 1ZQIA 4QZ8A 4KLQA 2DRBA 3HJ1A 2BCUA 5J29A 2NRKA 4NKUA 9ICPA 4DOCA 1JAJA 1ZQQA 1ZQXA 1ZQZA 1ZQAA 5BOMA 1TV9A 3RJKA 3C2LA 3NYBA 5HREA 1NOMA 4KLFA 5J2BA 1OU5A 4F5PA 4P4OA 5DB8A 4MF2A 8ICWA 4FHXA 3MDAA 1NO5A 7ICFA 4NM2A 3MGHA 4NLKA 5CJ7A 3V7LA 3OVSA 4K4GA 8ICFA 4NY8A 4KLMA 8ICVA 3GDXA 4E80A 3WFPA 2ZH2A 4M9LA 3V7JA 4M04A 4X4TA 7ICGA 1BPDA 4X4VA 3UXNA 5D4BA 2ZH3A 4EP7A 4DOBA 3RJHA 4XQ7A 4X4NA 1MIYA 4P4PA 4M9JA 8ICRA 2DR5A 3UQ0A 4R65A 4UBCA 3C2KA 8ICMA 3JPRA 3ISCA 3B0YA 2M2UA 4Z6DA 3RH4A 5IILA 5DB7A 1UEVA 1ZQTA 4NXZA 4UAZA 9ICNA 4KLEA 2ZH6A 9ICCA 4AT7B 1BPEA 9ICGA 3UXOA 4WBZA 4AT8B 4EBKA 3MGIA 3WFSC 5HRHA 4MFFA 4M9HA 3HIYA 3RJJA 4ATBB 4FH3A 4I28A 4M0AA 2O5AA 1ZQVA 4WC2A 8ICUA 2ID1A 8ICZA 9ICOA 4UAWA 4RPYA 9ICRA 4KLIA 5CHGA 4LT6A 5DB6A 5J0WA 4O5EA 9ICWA 4QZDA 5HC9A 5HRKA 5IIOA 3OUYA 4AT9A 1ZJNA 4X4SA 3JPSA 4F5OA 5J0OA 4I29A 4I2HA 3H38A 1ZQDA 3JPTA 9ICFA 4I2DA 1ZQEA 4RQ2A 3WFOA 4UAYA 1VFGA 3AQLA 2PFNA 1BPXA 8ICEA 4WBYA 2ZH4A 7ICLA 5CA7A 4QZBA 8ICQA 4XRHA 5J2JA 4KLGA 5J2FA 4QZ9A 4UB2A 2HHPA 9ICXA 5HRLA 2FMPA 4R63A 2PBEA 2ZH9A 1KDHA 5D46A 3RJGA 4EBJA 2I9GA 1V4AA 4MFCA 1MIVA 4UB5A 5J2KA 4KLHA 4XUSA 4M9NA 3TFRA 4UB1A 9ICMA 3RJIA 5J0UA 3C5FA 1ZQCA 1BPZA 4RWPA 3LK9A 5TZVA 5IIKA 4M5DA 2FMQA 4AT8A 2Q66A 4I2BA 4NLZA 8ICJA 4O5CA 2O1PA 4X4PA 7ICEA 3AU6A 4RT2A 4RQ1A 5J2DA 2BPCA 4Z6CA 4F5RA 4XQ8A 1ZQWA 2BCVA 3HW8A 4WC3A 4QZEA 4RQ8A 2BPGA 3C2MA 5IIMA 3HWTA 4YMMA 8ICBA 4PHEA 8ICLA 5J0XA 2ZH8A 4RQ0A 4E8FA 9ICLA 4JWNA 3MBYA 4QZHA 5J2AA 3AU2A 2ZHBA 4LZDA 4P2HA 4WC7A 2ISPA 4FO6A 5J2EA 5J0RA 4M2YA 1BPBA 1ZQPA 3RH6A 3JYYA 4I2JA 3JPQA 9ICHA 4PGYA 5IIJA 5DEDA 9ICBA 2IHMA 1ZQMA 7ICJA 5J2IA 4TURA 4KLSA 2FMSA 5DBAA 5BOLA 4GXJA 4KLOA 3JPNA 4QZCA 2DVIA 4PPXA 4K4HA 1JN3A 4YD1A 1XSPA 2RFFA 1ZQOA 3RJFA 3WFRE 2BPFA 2M2WA 4S3NA 1ZQKA 4RPZA 1ZQSA 4RQ5A 1RPLA 4Z6EA 3UPSA 8ICIA 3H3AA 5HRFA 3OVBA 5DB9A 4I2GA 3ISDA 4IQUA 5EOZA 4PGXA 4FHWA 5F2VO 3HX0A 1ZJMA 9ICJA 9ICEA 3HJ4A 4FHVA 4WC0A 2W9MA 4YN4A 1MQ2A 7ICQA 4X4UA 1ZQNA 8ICNA 8ICTA 8ICYA 4RWQA 7ICVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PMN A;  4X0B A;  3AQM A;  3OVA A;  5J0Y A;  5III A;  4UB4 A;  2M2V A;  3PML A;  9ICT A;  1F5A A;  9ICS A;  5DDM A;  8ICP A;  4WC5 A;  3C66 A;  5HRG A;  4FHY A;  4I27 A;  4UBB A;  2BCQ A;  2ISO A;  4RWO A;  4X4Q A;  2P66 A;  4LVS A;  1R8A A;  5CP2 A;  4GXI A;  1XSL A;  1JMS A;  2ZHA A;  1R8C A;  4PGQ A;  4QZF A;  3V7K A;  4WC4 A;  4QZA A;  2DR9 A;  1YLQ A;  4KLD A;  7ICT A;  4Z6F A;  1Q79 A;  1ZQR A;  3B0X A;  4NLN A;  1TVA A;  5HRI A;  1VJ7 A;  4AT7 A;  7ICU A;  2DR8 A;  4PHD A;  4JWM A;  7ICR A;  4IQW A;  2DR7 A;  2ZH7 A;  4ATB A;  5DBB A;  8ICC A;  5DDY A;  3OUY B;  5J2H A;  5J0Q A;  5DEC A;  8ICX A;  4RT3 A;  4AT9 B;  4R64 A;  8ICO A;  1R89 A;  4DOA A;  3PNC A;  3AQN A;  4KLU A;  4QZG A;  3LQC B;  9ICK A;  4E7X A;  7ICI A;  3UPQ A;  8ICH A;  3MDC A;  9ICQ A;  4X0A A;  4UD4 A;  4KLL A;  4P4M A;  3RJE A;  4XA5 A;  3TFS A;  1ZQG A;  5DBC A;  5HHI A;  4I2E A;  4MFA A;  9ICU A;  1FA0 A;  4I2I A;  5BPC A;  4WC1 A;  3WFQ E;  4RWN A;  3H39 A;  4O5K A;  4IG8 A;  1TFW A;  2DRA A;  5CWR A;  7ICH A;  5HRD A;  4X5V A;  4RQ4 A;  1MQ3 A;  4K4I A;  9ICA A;  1HUZ A;  2PFO A;  1HUO A;  1PX5 A;  4O9M A;  9ICV A;  5DKW A;  2VAN A;  4TUQ A;  1KEJ A;  3V72 A;  5HR9 A;  3UXP A;  4YMN A;  4M47 A;  4FH5 A;  4RQ7 A;  1R8B A;  4PHP A;  4YCX A;  1ZQL A;  4IQV A;  7ICP A;  5J2G A;  1ZQJ A;  2ZH5 A;  7ICS A;  5HRB A;  4WC6 A;  4KLJ A;  4I2C A;  7ICK A;  1UET A;  1XSN A;  8ICS A;  1KNY A;  3AUO A;  1RZT A;  1BPY A;  4NKT A;  1ZQB A;  4YMO A;  4PH5 A;  4FHP A;  3H37 A;  8ICG A;  4NM1 A;  4IQT A;  4TUP A;  3JPO A;  4F5N A;  3ISB A;  4GXK A;  4WCW A;  4TUS A;  9ICI A;  2PXI A;  1MIW A;  4MF8 A;  3JPP A;  1ZQH A;  3UQ2 A;  5D49 A;  2GWS A;  4YD2 A;  1UEU A;  5HHH A;  5J2C A;  4DO9 A;  3AQK A;  2BCR A;  4PHA A;  4UB3 A;  3OGU A;  4RPX A;  1ZQF A;  4UD5 A;  5J0T A;  1Q78 A;  8ICK A;  3K75 D;  3OV7 A;  3L9D A;  4X4O A;  4F5Q A;  2PFP A;  1WOT A;  1ZQU A;  5CR0 A;  3C18 A;  2BCS A;  4RQ3 A;  4I2A A;  5IIN A;  1TFY A;  3JZ0 A;  5J0P A;  1ZQY A;  4RQ6 A;  3C5G A;  3RH5 A;  4QZI A;  2M2T A;  2ZH1 A;  2BE3 A;  4M9G A;  4KLT A;  1JQR A;  7ICO A;  4X4R A;  7ICN A;  8ICA A;  4LZG A;  4I2F A;  7ICM A;  5J0S A;  4R66 A;  5CB1 A;  2PFQ A;  1ZQI A;  4QZ8 A;  4KLQ A;  2DRB A;  3HJ1 A;  2BCU A;  5J29 A;  2NRK A;  4NKU A;  9ICP A;  4DOC A;  1JAJ A;  1ZQQ A;  1ZQX A;  1ZQZ A;  1ZQA A;  5BOM A;  1TV9 A;  3RJK A;  3C2L A;  3NYB A;  5HRE A;  1NOM A;  4KLF A;  5J2B A;  1OU5 A;  4F5P A;  4P4O A;  5DB8 A;  4MF2 A;  8ICW A;  4FHX A;  3MDA A;  1NO5 A;  7ICF A;  4NM2 A;  3MGH A;  4NLK A;  5CJ7 A;  3V7L A;  3OVS A;  4K4G A;  8ICF A;  4NY8 A;  4KLM A;  8ICV A;  3GDX A;  4E80 A;  3WFP A;  2ZH2 A;  4M9L A;  3V7J A;  4M04 A;  4X4T A;  7ICG A;  1BPD A;  4X4V A;  3UXN A;  5D4B A;  2ZH3 A;  4EP7 A;  4DOB A;  3RJH A;  4XQ7 A;  4X4N A;  1MIY A;  4P4P A;  4M9J A;  8ICR A;  2DR5 A;  3UQ0 A;  4R65 A;  4UBC A;  3C2K A;  8ICM A;  3JPR A;  3ISC A;  3B0Y A;  2M2U A;  4Z6D A;  3RH4 A;  5IIL A;  5DB7 A;  1UEV A;  1ZQT A;  4NXZ A;  4UAZ A;  9ICN A;  4KLE A;  2ZH6 A;  9ICC A;  4AT7 B;  1BPE A;  9ICG A;  3UXO A;  4WBZ A;  4AT8 B;  4EBK A;  3MGI A;  3WFS C;  5HRH A;  4MFF A;  4M9H A;  3HIY A;  3RJJ A;  4ATB B;  4FH3 A;  4I28 A;  4M0A A;  2O5A A;  1ZQV A;  4WC2 A;  8ICU A;  2ID1 A;  8ICZ A;  9ICO A;  4UAW A;  4RPY A;  9ICR A;  4KLI A;  5CHG A;  4LT6 A;  5DB6 A;  5J0W A;  4O5E A;  9ICW A;  4QZD A;  5HC9 A;  5HRK A;  5IIO A;  3OUY A;  4AT9 A;  1ZJN A;  4X4S A;  3JPS A;  4F5O A;  5J0O A;  4I29 A;  4I2H A;  3H38 A;  1ZQD A;  3JPT A;  9ICF A;  4I2D A;  1ZQE A;  4RQ2 A;  3WFO A;  4UAY A;  1VFG A;  3AQL A;  2PFN A;  1BPX A;  8ICE A;  4WBY A;  2ZH4 A;  7ICL A;  5CA7 A;  4QZB A;  8ICQ A;  4XRH A;  5J2J A;  4KLG A;  5J2F A;  4QZ9 A;  4UB2 A;  2HHP A;  9ICX A;  5HRL A;  2FMP A;  4R63 A;  2PBE A;  2ZH9 A;  1KDH A;  5D46 A;  3RJG A;  4EBJ A;  2I9G A;  1V4A A;  4MFC A;  1MIV A;  4UB5 A;  5J2K A;  4KLH A;  4XUS A;  4M9N A;  3TFR A;  4UB1 A;  9ICM A;  3RJI A;  5J0U A;  3C5F A;  1ZQC A;  1BPZ A;  4RWP A;  3LK9 A;  5TZV A;  5IIK A;  4M5D A;  2FMQ A;  4AT8 A;  2Q66 A;  4I2B A;  4NLZ A;  8ICJ A;  4O5C A;  2O1P A;  4X4P A;  7ICE A;  3AU6 A;  4RT2 A;  4RQ1 A;  5J2D A;  2BPC A;  4Z6C A;  4F5R A;  4XQ8 A;  1ZQW A;  2BCV A;  3HW8 A;  4WC3 A;  4QZE A;  4RQ8 A;  2BPG A;  3C2M A;  5IIM A;  3HWT A;  4YMM A;  8ICB A;  4PHE A;  8ICL A;  5J0X A;  2ZH8 A;  4RQ0 A;  4E8F A;  9ICL A;  4JWN A;  3MBY A;  4QZH A;  5J2A A;  3AU2 A;  2ZHB A;  4LZD A;  4P2H A;  4WC7 A;  2ISP A;  4FO6 A;  5J2E A;  5J0R A;  4M2Y A;  1BPB A;  1ZQP A;  3RH6 A;  3JYY A;  4I2J A;  3JPQ A;  9ICH A;  4PGY A;  5IIJ A;  5DED A;  9ICB A;  2IHM A;  1ZQM A;  7ICJ A;  5J2I A;  4TUR A;  4KLS A;  2FMS A;  5DBA A;  5BOL A;  4GXJ A;  4KLO A;  3JPN A;  4QZC A;  2DVI A;  4PPX A;  4K4H A;  1JN3 A;  4YD1 A;  1XSP A;  2RFF A;  1ZQO A;  3RJF A;  3WFR E;  2BPF A;  2M2W A;  4S3N A;  1ZQK A;  4RPZ A;  1ZQS A;  4RQ5 A;  1RPL A;  4Z6E A;  3UPS A;  8ICI A;  3H3A A;  5HRF A;  3OVB A;  5DB9 A;  4I2G A;  3ISD A;  4IQU A;  5EOZ A;  4PGX A;  4FHW A;  5F2V O;  3HX0 A;  1ZJM A;  9ICJ A;  9ICE A;  3HJ4 A;  4FHV A;  4WC0 A;  2W9M A;  4YN4 A;  1MQ2 A;  7ICQ A;  4X4U A;  1ZQN A;  8ICN A;  8ICT A;  8ICY A;  4RWQ A;  7ICV A; 
#chains in the Genus database with same CATH topology
 2FCL A;  3PMN A;  4X0B A;  3AQM A;  3OVA A;  5J0Y A;  5III A;  4UB4 A;  2M2V A;  3PML A;  9ICT A;  1F5A A;  9ICS A;  5DDM A;  8ICP A;  4WC5 A;  3C66 A;  5HRG A;  4FHY A;  4I27 A;  4UBB A;  2BCQ A;  2ISO A;  4RWO A;  4X4Q A;  4EV6 A;  2P66 A;  5CFU A;  4LVS A;  1R8A A;  5CP2 A;  4GXI A;  1XSL A;  1JMS A;  2ZHA A;  1R8C A;  4PGQ A;  4WQK A;  4QZF A;  3V7K A;  4WC4 A;  4QZA A;  2DR9 A;  1YLQ A;  4KLD A;  4MKP A;  7ICT A;  4Z6F A;  1Q79 A;  1ZQR A;  3B0X A;  4NLN A;  1TVA A;  5HRI A;  1VJ7 A;  4AT7 A;  7ICU A;  4KB6 A;  2DR8 A;  4PHD A;  3NVO A;  4JWM A;  7ICR A;  4IQW A;  2DR7 A;  3ER8 C;  2ZH7 A;  4ATB A;  5DBB A;  8ICC A;  5DDY A;  3OUY B;  5J2H A;  5J0Q A;  5DEC A;  8ICX A;  4RT3 A;  4AT9 B;  4R64 A;  4K98 A;  1R89 A;  8ICO A;  4DOA A;  3PNC A;  3AQN A;  4KLU A;  4QZG A;  3LQC B;  9ICK A;  4LEW A;  4E7X A;  7ICI A;  3UPQ A;  5D62 A;  8ICH A;  3MDC A;  9ICQ A;  4X0A A;  4UD4 A;  4KLL A;  4P4M A;  3RJE A;  4XA5 A;  3TFS A;  4K9A A;  1ZQG A;  4NXX A;  5DBC A;  5HHI A;  4I2E A;  4MFA A;  9ICU A;  1FA0 A;  4I2I A;  5BPC A;  3ER9 B;  4WC1 A;  3WFQ E;  4JLZ A;  4RWN A;  3H39 A;  4O5K A;  4IG8 A;  1TFW A;  2DRA A;  5CWR A;  7ICH A;  5HRD A;  4X5V A;  4RQ4 A;  1MQ3 A;  4K4I A;  9ICA A;  1HUZ A;  2PFO A;  1HUO A;  1PX5 A;  4O9M A;  9ICV A;  5DKW A;  2VAN A;  4TUQ A;  4OAF A;  1KEJ A;  3V72 A;  5HR9 A;  3UXP A;  4YMN A;  4M47 A;  4FH5 A;  4RQ7 A;  1R8B A;  4PHP A;  4YCX A;  1ZQL A;  4IQV A;  7ICP A;  5J2G A;  2HN1 A;  1ZQJ A;  2ZH5 A;  7ICS A;  5HRB A;  4WC6 A;  4KLJ A;  4I2C A;  7ICK A;  1UET A;  1XSN A;  8ICS A;  1KNY A;  3NKU A;  4NXT A;  3AUO A;  1RZT A;  1BPY A;  4NKT A;  1ZQB A;  4YMO A;  4PH5 A;  4FHP A;  3H37 A;  8ICG A;  4NM1 A;  4IQT A;  4TUP A;  3JPO A;  5B3Q A;  4F5N A;  3ISB A;  4GXK A;  4WCW A;  4TUS A;  9ICI A;  2BBJ A;  2PXI A;  1MIW A;  3EF2 A;  4MF8 A;  3JPP A;  1ZQH A;  3UQ2 A;  5D49 A;  2GWS A;  4YD2 A;  1UEU A;  4K97 A;  5HHH A;  5J2C A;  4DO9 A;  3AQK A;  2BCR A;  4PHA A;  3PHZ A;  4UB3 A;  3OGU A;  4RPX A;  1ZQF A;  4UD5 A;  5J0T A;  1Q78 A;  5CHE A;  8ICK A;  3K75 D;  3OV7 A;  3L9D A;  4X4O A;  4F5Q A;  2PFP A;  1WOT A;  1ZQU A;  4EEB A;  5CR0 A;  3C18 A;  2BCS A;  4RQ3 A;  4I2A A;  5IIN A;  1TFY A;  3JZ0 A;  5J0P A;  1ZQY A;  4WH5 A;  4RQ6 A;  3C5G A;  3RH5 A;  4N7R A;  4QZI A;  2M2T A;  2BE3 A;  2ZH1 A;  4M9G A;  4KLT A;  2GAF D;  4O67 A;  7ICO A;  1JQR A;  4X4R A;  2EWR A;  7ICN A;  8ICA A;  5B3P A;  4LZG A;  4I2F A;  7ICM A;  5J0S A;  4R66 A;  4OAH A;  5CB1 A;  2PFQ A;  1ZQI A;  4QZ8 A;  4KLQ A;  3MCR A;  3HJ1 A;  2DRB A;  2BCU A;  5J29 A;  4OAG A;  2NRK A;  2GA9 D;  4NKU A;  9ICP A;  4DOC A;  1JAJ A;  1ZQQ A;  1ZQX A;  1ZQZ A;  1ZQA A;  5BOM A;  1TV9 A;  3RJK A;  3C2L A;  3NYB A;  5HRE A;  1NOM A;  4KLF A;  5J2B A;  1OU5 A;  4F5P A;  4P4O A;  5DB8 A;  4MF2 A;  8ICW A;  4FHX A;  4WOY A;  3MDA A;  1NO5 A;  7ICF A;  4NM2 A;  3MGH A;  4NLK A;  4JLX A;  5CJ7 A;  3V7L A;  3OVS A;  4K4G A;  8ICF A;  4NY8 A;  4KLM A;  8ICV A;  4O6A A;  4NXV A;  3GDX A;  4E80 A;  3WFP A;  2ZH2 A;  4OAI Z;  3V7J A;  5CFS A;  4M04 A;  4M9L A;  4X4T A;  7ICG A;  4FO1 A;  1BPD A;  4X4V A;  3UXN A;  4O69 A;  5D4B A;  2ZH3 A;  4EP7 A;  4DOB A;  3RJH A;  4XQ7 A;  4X4N A;  1MIY A;  4P4P A;  4M9J A;  8ICR A;  2DR5 A;  3UQ0 A;  4R65 A;  4O68 A;  4UBC A;  3C2K A;  8ICM A;  3JPR A;  3ISC A;  4EGW A;  3B0Y A;  2M2U A;  4Z6D A;  3RH4 A;  2HN2 A;  5IIL A;  5DB7 A;  1UEV A;  1ZQT A;  4NXZ A;  4UAZ A;  4K96 A;  9ICN A;  4KLE A;  2ZH6 A;  9ICC A;  4AT7 B;  1BPE A;  9ICG A;  3UXO A;  4WBZ A;  4AT8 B;  4EBK A;  3MGI A;  3JCF A;  3WFS C;  5HRH A;  4MFF A;  4M9H A;  3HIY A;  3RJJ A;  4ATB B;  4FH3 A;  4I28 A;  4M0A A;  2O5A A;  1ZQV A;  4WC2 A;  8ICU A;  2ID1 A;  8ICZ A;  9ICO A;  4UAW A;  4RPY A;  9ICR A;  4KLI A;  5CHG A;  4LT6 A;  5DB6 A;  5J0W A;  4O5E A;  9ICW A;  4QZD A;  5HC9 A;  5HRK A;  5IIO A;  3OUY A;  4AT9 A;  1ZJN A;  4LEV A;  4X4S A;  3JPS A;  4F5O A;  4NXW A;  5J0O A;  4I29 A;  4I2H A;  3H38 A;  1ZQD A;  4XJE A;  3JPT A;  9ICF A;  4I2D A;  2B51 A;  1ZQE A;  4RQ2 A;  3WFO A;  4UAY A;  1VFG A;  3AQL A;  2PFN A;  1BPX A;  8ICE A;  4WBY A;  2ZH4 A;  7ICL A;  5CFT A;  5CA7 A;  4QZB A;  8ICQ A;  4KM5 A;  4XRH A;  5J2J A;  4KLG A;  5J2F A;  4QZ9 A;  4UB2 A;  2HHP A;  9ICX A;  5HRL A;  2FMP A;  4R63 A;  2PBE A;  2ZH9 A;  1KDH A;  5D46 A;  3RJG A;  4EBJ A;  2I9G A;  1V4A A;  4MFC A;  1MIV A;  4UB5 A;  5J2K A;  4KLH A;  4XUS A;  4M9N A;  3TFR A;  4UB1 A;  9ICM A;  3RJI A;  5J0U A;  3C5F A;  1ZQC A;  1BPZ A;  4RWP A;  3LK9 A;  5TZV A;  5IIK A;  4M5D A;  2FMQ A;  4AT8 A;  2Q66 A;  2IUB A;  4WQL A;  4LEZ A;  4I2B A;  4NLZ A;  8ICJ A;  2IHO A;  4O5C A;  1GPJ A;  2O1P A;  4X4P A;  7ICE A;  3AU6 A;  4RT2 A;  4RQ1 A;  5J2D A;  2BPC A;  4Z6C A;  4F5R A;  4XQ8 A;  5D63 A;  1ZQW A;  2BCV A;  3K7D A;  3HW8 A;  4WC3 A;  4QZE A;  4RQ8 A;  2BPG A;  3C2M A;  5IIM A;  3HWT A;  4YMM A;  4K9B A;  8ICB A;  4PHE A;  2BBH A;  5JTG A;  8ICL A;  5J0X A;  2ZH8 A;  4RQ0 A;  4E8F A;  9ICL A;  4JWN A;  4LEY A;  3MBY A;  4QZH A;  4HX0 A;  5J2A A;  4I0U A;  3AU2 A;  2ZHB A;  4LZD A;  4P2H A;  4WC7 A;  2ISP A;  4FO6 A;  5J2E A;  5J0R A;  4M2Y A;  1BPB A;  1ZQP A;  3ERC C;  3RH6 A;  3JYY A;  4I2J A;  3JPQ A;  9ICH A;  4PGY A;  5IIJ A;  5DED A;  9ICB A;  4K99 A;  2IHM A;  1ZQM A;  7ICJ A;  2B4V A;  4TUR A;  5J2I A;  4KLS A;  3OWG A;  5DBA A;  2FMS A;  5BOL A;  4GXJ A;  4KLO A;  3JPN A;  4QZC A;  2DVI A;  4PPX A;  4K4H A;  1JN3 A;  4YD1 A;  1XSP A;  2RFF A;  1ZQO A;  3RJF A;  2B56 A;  3WFR E;  2BPF A;  2M2W A;  4EED A;  4S3N A;  4RPZ A;  1ZQK A;  1ZQS A;  4RQ5 A;  1RPL A;  4Z6E A;  3UPS A;  8ICI A;  3CK6 A;  3H3A A;  5HRF A;  3OVB A;  4K8V A;  5DB9 A;  4I2G A;  3ISD A;  4IQU A;  5EOZ A;  3NWI A;  4PGX A;  4FHW A;  5F2V O;  3HX0 A;  1ZJM A;  9ICJ A;  9ICE A;  3HJ4 A;  4FHV A;  4WC0 A;  2W9M A;  4YN4 A;  1MQ2 A;  7ICQ A;  4X4U A;  1ZQN A;  8ICN A;  4NXU A;  5D61 A;  8ICT A;  8ICY A;  4RWQ A;  7ICV A; 
#chains in the Genus database with same CATH homology
 3PMN A;  4X0B A;  3AQM A;  3OVA A;  5J0Y A;  5III A;  4UB4 A;  2M2V A;  3PML A;  9ICT A;  1F5A A;  9ICS A;  5DDM A;  8ICP A;  4WC5 A;  3C66 A;  5HRG A;  4FHY A;  4I27 A;  4UBB A;  2BCQ A;  2ISO A;  4RWO A;  4X4Q A;  2P66 A;  4LVS A;  1R8A A;  5CP2 A;  4GXI A;  1XSL A;  1JMS A;  2ZHA A;  1R8C A;  4PGQ A;  4QZF A;  3V7K A;  4WC4 A;  4QZA A;  2DR9 A;  1YLQ A;  4KLD A;  7ICT A;  4Z6F A;  1Q79 A;  1ZQR A;  3B0X A;  4NLN A;  1TVA A;  5HRI A;  1VJ7 A;  4AT7 A;  7ICU A;  2DR8 A;  4PHD A;  4JWM A;  7ICR A;  4IQW A;  2DR7 A;  2ZH7 A;  4ATB A;  5DBB A;  8ICC A;  5DDY A;  3OUY B;  5J2H A;  5J0Q A;  5DEC A;  8ICX A;  4RT3 A;  4AT9 B;  4R64 A;  8ICO A;  1R89 A;  4DOA A;  3PNC A;  3AQN A;  4KLU A;  4QZG A;  3LQC B;  9ICK A;  4E7X A;  7ICI A;  3UPQ A;  8ICH A;  3MDC A;  9ICQ A;  4X0A A;  4UD4 A;  4KLL A;  4P4M A;  3RJE A;  4XA5 A;  3TFS A;  1ZQG A;  5DBC A;  5HHI A;  4I2E A;  4MFA A;  9ICU A;  1FA0 A;  4I2I A;  5BPC A;  4WC1 A;  3WFQ E;  4RWN A;  3H39 A;  4O5K A;  4IG8 A;  1TFW A;  2DRA A;  5CWR A;  7ICH A;  5HRD A;  4X5V A;  4RQ4 A;  1MQ3 A;  4K4I A;  9ICA A;  1HUZ A;  2PFO A;  1HUO A;  1PX5 A;  4O9M A;  9ICV A;  5DKW A;  2VAN A;  4TUQ A;  1KEJ A;  3V72 A;  5HR9 A;  3UXP A;  4YMN A;  4M47 A;  4FH5 A;  4RQ7 A;  1R8B A;  4PHP A;  4YCX A;  1ZQL A;  4IQV A;  7ICP A;  5J2G A;  1ZQJ A;  2ZH5 A;  7ICS A;  5HRB A;  4WC6 A;  4KLJ A;  4I2C A;  7ICK A;  1UET A;  1XSN A;  8ICS A;  1KNY A;  3AUO A;  1RZT A;  1BPY A;  4NKT A;  1ZQB A;  4YMO A;  4PH5 A;  4FHP A;  3H37 A;  8ICG A;  4NM1 A;  4IQT A;  4TUP A;  3JPO A;  4F5N A;  3ISB A;  4GXK A;  4WCW A;  4TUS A;  9ICI A;  2PXI A;  1MIW A;  4MF8 A;  3JPP A;  1ZQH A;  3UQ2 A;  5D49 A;  2GWS A;  4YD2 A;  1UEU A;  5HHH A;  5J2C A;  4DO9 A;  3AQK A;  2BCR A;  4PHA A;  4UB3 A;  3OGU A;  4RPX A;  1ZQF A;  4UD5 A;  5J0T A;  1Q78 A;  8ICK A;  3K75 D;  3OV7 A;  3L9D A;  4X4O A;  4F5Q A;  2PFP A;  1WOT A;  1ZQU A;  5CR0 A;  3C18 A;  2BCS A;  4RQ3 A;  4I2A A;  5IIN A;  1TFY A;  3JZ0 A;  5J0P A;  1ZQY A;  4RQ6 A;  3C5G A;  3RH5 A;  4QZI A;  2M2T A;  2ZH1 A;  2BE3 A;  4M9G A;  4KLT A;  1JQR A;  7ICO A;  4X4R A;  7ICN A;  8ICA A;  4LZG A;  4I2F A;  7ICM A;  5J0S A;  4R66 A;  5CB1 A;  2PFQ A;  1ZQI A;  4QZ8 A;  4KLQ A;  2DRB A;  3HJ1 A;  2BCU A;  5J29 A;  2NRK A;  4NKU A;  9ICP A;  4DOC A;  1JAJ A;  1ZQQ A;  1ZQX A;  1ZQZ A;  1ZQA A;  5BOM A;  1TV9 A;  3RJK A;  3C2L A;  3NYB A;  5HRE A;  1NOM A;  4KLF A;  5J2B A;  1OU5 A;  4F5P A;  4P4O A;  5DB8 A;  4MF2 A;  8ICW A;  4FHX A;  3MDA A;  1NO5 A;  7ICF A;  4NM2 A;  3MGH A;  4NLK A;  5CJ7 A;  3V7L A;  3OVS A;  4K4G A;  8ICF A;  4NY8 A;  4KLM A;  8ICV A;  3GDX A;  4E80 A;  3WFP A;  2ZH2 A;  4M9L A;  3V7J A;  4M04 A;  4X4T A;  7ICG A;  1BPD A;  4X4V A;  3UXN A;  5D4B A;  2ZH3 A;  4EP7 A;  4DOB A;  3RJH A;  4XQ7 A;  4X4N A;  1MIY A;  4P4P A;  4M9J A;  8ICR A;  2DR5 A;  3UQ0 A;  4R65 A;  4UBC A;  3C2K A;  8ICM A;  3JPR A;  3ISC A;  3B0Y A;  2M2U A;  4Z6D A;  3RH4 A;  5IIL A;  5DB7 A;  1UEV A;  1ZQT A;  4NXZ A;  4UAZ A;  9ICN A;  4KLE A;  2ZH6 A;  9ICC A;  4AT7 B;  1BPE A;  9ICG A;  3UXO A;  4WBZ A;  4AT8 B;  4EBK A;  3MGI A;  3WFS C;  5HRH A;  4MFF A;  4M9H A;  3HIY A;  3RJJ A;  4ATB B;  4FH3 A;  4I28 A;  4M0A A;  2O5A A;  1ZQV A;  4WC2 A;  8ICU A;  2ID1 A;  8ICZ A;  9ICO A;  4UAW A;  4RPY A;  9ICR A;  4KLI A;  5CHG A;  4LT6 A;  5DB6 A;  5J0W A;  4O5E A;  9ICW A;  4QZD A;  5HC9 A;  5HRK A;  5IIO A;  3OUY A;  4AT9 A;  1ZJN A;  4X4S A;  3JPS A;  4F5O A;  5J0O A;  4I29 A;  4I2H A;  3H38 A;  1ZQD A;  3JPT A;  9ICF A;  4I2D A;  1ZQE A;  4RQ2 A;  3WFO A;  4UAY A;  1VFG A;  3AQL A;  2PFN A;  1BPX A;  8ICE A;  4WBY A;  2ZH4 A;  7ICL A;  5CA7 A;  4QZB A;  8ICQ A;  4XRH A;  5J2J A;  4KLG A;  5J2F A;  4QZ9 A;  4UB2 A;  2HHP A;  9ICX A;  5HRL A;  2FMP A;  4R63 A;  2PBE A;  2ZH9 A;  1KDH A;  5D46 A;  3RJG A;  4EBJ A;  2I9G A;  1V4A A;  4MFC A;  1MIV A;  4UB5 A;  5J2K A;  4KLH A;  4XUS A;  4M9N A;  3TFR A;  4UB1 A;  9ICM A;  3RJI A;  5J0U A;  3C5F A;  1ZQC A;  1BPZ A;  4RWP A;  3LK9 A;  5TZV A;  5IIK A;  4M5D A;  2FMQ A;  4AT8 A;  2Q66 A;  4I2B A;  4NLZ A;  8ICJ A;  4O5C A;  2O1P A;  4X4P A;  7ICE A;  3AU6 A;  4RT2 A;  4RQ1 A;  5J2D A;  2BPC A;  4Z6C A;  4F5R A;  4XQ8 A;  1ZQW A;  2BCV A;  3HW8 A;  4WC3 A;  4QZE A;  4RQ8 A;  2BPG A;  3C2M A;  5IIM A;  3HWT A;  4YMM A;  8ICB A;  4PHE A;  8ICL A;  5J0X A;  2ZH8 A;  4RQ0 A;  4E8F A;  9ICL A;  4JWN A;  3MBY A;  4QZH A;  5J2A A;  3AU2 A;  2ZHB A;  4LZD A;  4P2H A;  4WC7 A;  2ISP A;  4FO6 A;  5J2E A;  5J0R A;  4M2Y A;  1BPB A;  1ZQP A;  3RH6 A;  3JYY A;  4I2J A;  3JPQ A;  9ICH A;  4PGY A;  5IIJ A;  5DED A;  9ICB A;  2IHM A;  1ZQM A;  7ICJ A;  5J2I A;  4TUR A;  4KLS A;  2FMS A;  5DBA A;  5BOL A;  4GXJ A;  4KLO A;  3JPN A;  4QZC A;  2DVI A;  4PPX A;  4K4H A;  1JN3 A;  4YD1 A;  1XSP A;  2RFF A;  1ZQO A;  3RJF A;  3WFR E;  2BPF A;  2M2W A;  4S3N A;  1ZQK A;  4RPZ A;  1ZQS A;  4RQ5 A;  1RPL A;  4Z6E A;  3UPS A;  8ICI A;  3H3A A;  5HRF A;  3OVB A;  5DB9 A;  4I2G A;  3ISD A;  4IQU A;  5EOZ A;  4PGX A;  4FHW A;  5F2V O;  3HX0 A;  1ZJM A;  9ICJ A;  9ICE A;  3HJ4 A;  4FHV A;  4WC0 A;  2W9M A;  4YN4 A;  1MQ2 A;  7ICQ A;  4X4U A;  1ZQN A;  8ICN A;  8ICT A;  8ICY A;  4RWQ A;  7ICV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...