4M9HA

Dna polymerase beta e295k soaked with dttp
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
324
structure length
314
Chain Sequence
LNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINKYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA polymerase beta
publication title The E295K Cancer Variant of Human Polymerase beta Favors the Mismatch Conformational Pathway during Nucleotide Selection.
pubmed doi rcsb
source organism Homo sapiens
total genus 98
structure length 314
sequence length 324
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4m9hA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4m9hA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4m9hA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4m9hA03
5J2AA 3RBEA 4B9MA 4UD5A 1ZQLA 4YR0A 2J6UA 1UEUA 5DKWA 4IRCA 1WCLA 3RJIA 1Z3EB 5D4BA 4TUSA 4ED0A 3WFSC 8ICMA 2AJQA 2B21A 2UVWA 3WFOA 2O1PA 2ASDA 4E80A 1TV9A 1BGXT 3ETLA 4DQIA 1ZQIA 4MF8A 5J2FA 2W9CB 4KMUA 2HVIA 5J2CA 5KFUA 2V4QA 4WC7A 4IRKA 2I9GA 4J9OA 5DB9A 3C2KA 3QEBZ 4C8NA 4ELVA 1JQRA 4UB3A 3MR3A 3RTVA 1RXWA 5TZVA 3ISDA 4WC4A 3TQ1A 1LB2B 4ED1A 4I2JA 2OWOA 4O0IA 5L1LA 9ICFA 1U49A 3RJFA 7ICGA 4XUSA 1QSSA 2A1JA 4PGQA 3Q8QB 4ECYA 4ED3A 3PX0A 8ICBA 2ZH3A 1XSPA 5KTQA 8ICKA 3TI0A 3JPTA 3MGHA 3WFPA 2ISPA 5DBAA 5HRGA 7ICRA 2GWSA 2PFPA 4KLDA 1R89A 4R8UA 8ICAA 4DL6A 3OSNA 1BPXA 3PW4A 4AT9B 1K1SA 3AQLA 1NO5A 4YQWA 7ICMA 4KITB 5HHIA 5KFHA 4ECSA 1TAQA 5IILA 4IQWA 4J9LA 3RB6A 1NJXA 5HR9A 5L1KA 1QLNA 5L1IA 5HNKA 4DF4A 2PI4A 3C21A 4YMMA 5KG1A 4YR2A 4YG2A 3QZ7A 1ZQEA 4AT8B 3BQ2A 2JZBB 5J0SA 1MIWA 3RAQA 1JX4A 3ISCA 4TQRA 3ZD8A 3M9OB 3MGIA 3EPIA 4J9NA 5J0QA 1ZQMA 4ELUA 3M9NB 1ZQJA 3OV7A 4TURA 2P6RA 4F4ZA 3BQ1A 1U4BA 2FMPA 1Y88A 3KHGA 3M8SA 2C28A 1UA0A 4RWQA 4DQQA 1ZQNA 5HHHA 2W8LA 1TVAA 4ED2A 2FMSA 3G6XA 9ICMA 2ZHBA 2BQRA 1ZQCA 4M5DA 9ICJA 5L9XA 3PX4A 1ZQFA 4I2GA 3HWTA 1NJYA 4UAWA 4DLGA 2DR5A 4JV0A 4DL7A 4KLMA 2NRTA 5KT3A 5KG7A 3QEAZ 1X2IA 5EOZA 4FHXA 1ZQPA 5KFZA 5IIKA 3PW2A 4R65A 4MEXA 5KFOA 5DG7A 2DPIA 2IMWP 2BDPA 5J0PA 3G6VA 4IR9A 5F9NA 5J0TA 4O3PA 3JPSA 3Q8MA 1T8EA 4NLKA 4RNNA 2H5XA 2M2UA 3MABA 1F5AA 4QWEA 4WC1A 1ZJMA 3AQNA 3LK9A 5CJ7A 2HHTA 1KFSA 4Z6CA 1PX5A 2RDIA 4PHPA 9ICVA 4RQ1A 1RYSA 4UD4A 1Q78A 8ICLA 3H40A 2M2TA 4JV1A 4QWCA 3GV8B 3HW8A 2LYHA 5KFIA 2XGPA 4J9KA 5KFBA 1KLNA 3TAPA 3TANA 1S9FA 1S0NA 2R8KA 1RPLA 2ZJ8A 2KZZA 9ICAA 1S77D 1VFGA 4J9RA 1ZQVA 4F4XA 4UB2A 1TK0A 2JEFA 4MFCA 3SI8A 2XC9A 3GIKA 2PBEA 1NOMA 3UPSA 5HMLA 7ICOA 4RQ8A 9ICLA 1JXLA 4M6WA 4DQSA 2PFNA 1T7PA 1XSNA 2UVRA 4KLFA 7ICKA 9ICBA 4WC5A 1AROP 1T4GA 3Q8LA 4FBUA 1BPEA 9ICCA 2RFFA 5J29A 2BKEA 4P2HA 4ATBA 7ICHA 4DWIA 2ASLA 1XWLA 5J2IA 1JN3A 3KHRA 4NLNA 3C18A 1CEZA 5DBBA 5KFEA 1LV5A 9ICWA 1MIVA 2BE3A 4QZGA 2IHNA 4QZHA 5KFYA 2ZH4A 3V6HA 4C8OA 4I2FA 1U45A 2BGWA 4DS4A 4KLLA 4M0AA 4M04A 4WC2A 3FDSA 9ICRA 5HRKA 1KFTA 3SZ2A 4RZRA 4RWPA 5DB6A 4XRHA 4RQ4A 1ZETA 5KT7A 2DPJA 2BCQA 7ICFA 1BNOA 4QZCA 4NKUA 2BR0A 5J0OA 3PMNA 5J2JA 2BHNA 4DS5A 2AGQA 1KSPA 1L3SA 4RNMA 5CWRA 7ICTA 4QZ8A 3TARA 1NJWA 1UETA 2KZ3A 4RT3A 4EP7A 3RBDA 3JPPA 4F3OA 1EXNA 2R8JA 3OHBA 3GIMA 3EPGA 3OGUA 2HHVA 4X4OA 4DSJA 4F5NA 3GDXA 1NK8A 4DSIA 3FYHA 4C8LA 4J9MA 3GV5B 4E7XA 2XY6A 9ICNA 4TQSA 4DFKA 4O3NA 5CB1A 2BQ3A 5DG9A 5L1JA 7ICQA 3LWMA 2VANA 3UXOA 4ECRA 1ZQRA 4X4SA 3RJKA 1XO1A 4YP3A 3OVSA 4ED6A 4RWNA 4RQ7A 1ZQYA 5KT6A 4AT9A 1OU5A 2VA3A 4EBJA 1DK2A 4DQRA 2Y1JA 2ZUDA 4UAYA 5HRIA 3C1ZA 5KFNA 4PH5A 4BXOB 5IINA 4MFFA 2XGQA 2NRXA 4BWMA 4F5QA 5IIMA 8ICQA 3JZ0A 4JWMA 4I2CA 3MBYA 3EZ5A 1KDHA 5EWEA 4Q44A 1X9SA 3M9MB 1L3VA 4F2SA 3V7KA 4Q8FA 3UXNA 1MIYA 2MUTA 4PHAA 3PW7A 2C22A 1RXVA 5IIOA 1L3TA 2JEGA 5KG2A 3ZDEA 3BDPA 3RR7A 4KLIA 3TFSA 5J0WA 5J0XA 4QZDA 4JK1A 4TUQA 4KLOA 8ICGA 3H8JA 4MEYA 4FHYA 4EBKA 5F9LA 4FHPA 4RU9A 1SKWA 3NYBA 1B22A 1SL0A 3AQMA 1Z00B 4QZBA 4EYIB 3ZDCA 4O3SA 2FLNA 2W9AA 4DQPA 1IXRA 1SKRA 4Z6DA 5HP4A 3RB4A 3OHAA 4DSLA 5KG0A 1C7YA 4J9SA 3C1YA 3TAQA 2DRAA 4LT6A 3QE9Y 4FH3A 4NM2A 1QTMA 4Q45A 1D8LA 1BVSA 5J2GA 4F2RA 2HW3A 4AT8A 4DOBA 1ZQHA 3SV4A 4R63A 8ICRA 3M8RA 3PW0A 3PY8A 9ICTA 2Q66A 4B9UA 5HRBA 4ECVA 4IRDA 2BCSA 4JWNA 9ICKA 3WFRE 2Q0ZX 5DB7A 3BQTA 2ZTEA 5J0RA 4YMNA 3C2MA 1S0OA 2JEIA 3WFQE 4WC0A 4BDPA 4QWBA 2M2WA 2ZH7A 2BCUA 8ICNA 3GIIA 4FH5A 5KFSA 2ATLA 2HHSA 1Q79A 2R8GA 2ZJAA 1S0VA 1BPZA 2FLPA 5J2BA 3HP6A 4FBTA 2IBKA 3THVA 3HJ1A 1JAJA 8ICXA 1COOA 4RQ3A 3MFHA 3UQ0A 1NK7A 4M9LA 8ICVA 1TK8A 2UVUA 1R8AA 4IQTA 5BPCA 9ICXA 2I1QA 4RUCA 4QZIA 4ELTA 4M9GA 4X0BA 4X4TA 3RAXA 2AQ4A 4DEZA 5J0YA 1DOQA 1N48A 2J6TA 4YMOA 3NGDA 3EYZA 4O9MA 2O5AA 1JXEA 4UB1A 5DQIA 3PR4A 4DO9A 4WBYA 2J6SA 4DL5A 4DFMA 2ZH5A 1XS9D 2ZH9A 4J9PA 4KTQA 1JIHA 4FS2A 2KN7A 2FMQA 7ICJA 2NRZA 3B0YA 3HX0A 3HIYA 4R66A 9ICUA 1ZQZA 3GV7B 3PO4A 5KFRA 5HRDA 4EBDA 9ICSA 4EYHB 1ZQWA 4O3OA 4B9TA 5DDMA 4RQ0A 4O3QA 7ICEA 4DFPA 5J2KA 8ICSA 1UEVA 3L9DA 4QW9A 4HYKA 2PXIA 5J2EA 2ZTDA 2BCVA 4I27A 1YLQA 4LZGA 5CHGA 2F1IA 4O3RA 3PVXA 4I2IA 1NKEA 4P4MA 2BPGA 1V4AA 8ICJA 4I2AA 1TK5A 2KTQA 3JPNA 4DOAA 4YN4A 1N56A 4MFAA 5J0UA 1QSLA 4EZ6A 2C2EA 4KLQA 1TAUA 4RQ6A 7ICLA 4IG8A 4EEYA 3JYYA 5DGBA 5KFWA 4QWAA 1BPDA 2NRVA 5KG3A 3G6YA 5C5JA 4F5OA 3H8WA 4DSFA 1X9MA 2JEJA 4M47A 5HRHA 4FHWA 2R8IA 1HUZA 4QWDA 4WC3A 2RDJA 5KFFA 1U9LA 3H39A 3PV8A 5KFXA 4O5EA 4S3NA 3MR2A 1ZQKA 4PGYA 3UQ2A 5EWFA 1V9PA 1UT5A 4AT7B 5F2VO 8ICTA 3V6JA 4NLZA 3H4BA 3OJSA 2W9CA 5CP2A 1SL2A 4UBCA 1PZNA 3JPRA 3MDCA 1KNYA 1MSWD 1R8CA 3OVBA 1A76A 2NRWA 3OUYB 1NKCA 9ICOA 3RH6A 4E0DA 4M9JA 3E2EA 2ZH1A 3H4DA 3BQ0A 4YFKA 2V9WA 2R8HA 4UBBA 3N97B 3RH5A 7ICNA 3ZD9A 3GILA 4P4OA 1ZQBA 1NK0A 4BXOA 1TKDA 2IHMA 4IR1A 2KFZA 4NKTA 4X4PA 4KLJA 4GXJA 4I2DA 2W9MA 3B0XA 2V4RA 3V6KA 5CR0A 4FS1A 3N4MB 1ZJNA 2ZUCA 2ASJA 4ED8A 4I2BA 4I28A 8ICIA 2F1JA 2C2RA 3RJEA 4KLHA 4PPXA 4XQ7A 5DQHA 3C5GA 1S76D 4BWJA 7ICIA 3HJ4A 2DR7A 1ZQSA 2P6UA 4ATBB 3PMLA 2AQ0A 3V7JA 2W9BB 4F50A 1WCNA 3MDAA 1DGSA 9ICQA 4DSEA 4Z6FA 4DL4A 3RB0A 1Z00A 3C2LA 4B9VA 4I29A 2DR9A 5DB8A 3QZ8A 4DF8A 3GIJA 3T5KA 4K4IA 9ICGA 4NY8A 4YVZA 2WTFA 4GXIA 2M9NA 2BPCA 5KFLA 5JUMA 5BOLA 4M2YA 2JZBA 1IM4A 5DG8A 4R64A 4ECTA 3RH4A 4RPYA 1X9WA 5KFGA 4RQ2A 4ECXA 4JV2A 4KLTA 3EWAA 3ISBA 3K4GA 1XC9A 3KHHA 5KT5A 8ICEA 7ICVA 1TFWA 1DK3A 3SV3A 3LWLA 2BCRA 4RPXA 5KFVA 4P4PA 3Q8PB 2AU0A 2AGOA 2BPFA 4WBZA 4X4UA 1H38A 4X4NA 1NK6A 1JMSA 4YD1A 2XCAA 4ECZA 1S97A 4DOCA 5BOMA 4EBCA 3T5HA 2ZUBA 3PNCA 4Q43A 4Z6EA 2C2DA 2IA6A 3RRGA 4MF2A 3T5JA 2NRKA 2F1HA 5IIJA 3H8SA 1HUOA 1HJPA 4JUZA 4BGDA 4F8RA 2ZHAA 5KFQA 3MR5A 5HMMA 9ICHA 8ICOA 1U48A 3OVAA 4UQGA 1S10A 2P66A 4B9NA 5HRFA 2BQUA 5HREA 2ALZA 3LQCB 4XA5A 4IQUA 3BJYA 3GQCA 2Y1IA 3Q8KA 4KLGA 4PHEA 1ZQGA 2HVHA 3IM1A 1R8BA 5DECA 3JPOA 3ZDDA 1KEJA 2PFOA 1ZQUA 3H7IA 3PR5B 4FHVA 5KG5A 3OSPA 4YXMA 1ZYQA 3C23A 1MQ2A 2DVIA 1S0MA 2AGPA 4Q8EA 4I2HA 4X4QA 4YXJA 3ORYA 1ZQAA 2UVVA 7ICSA 3AU2A 1B43A 5J2HA 1MQ3A 3H38A 4RNOA 4WCWA 5KG4A 1TFYA 3OJUA 3V72A 4EBEA 3AQKA 2A1JB 5DBCA 3SYZA 4O5KA 2MUTB 3EW9A 3T5LA 2M2VA 2HHXA 9ICEA 2HHWA 2FLLA 4C8MA 1NK5A 4M9HA 1RYRA 4X4RA 3HT3A 2PI5A 4UB5A 1A77A 3PO5A 4WC6A 4R8UB 2HHPA 3LDAA 4DL3A 3H37A 3KHLA 4F4KA 1L3UA 4QZ9A 4KN7A 4QZAA 4ZH4A 3C5FA 1NKBA 1U47A 4RT2A 4KN4A 1NK9A 2ISOA 4QZEA 3NTUA 3Q8SB 4QW8A 5IIIA 4F93B 1XSLA 5DLFA 2VA8A 4X5VA 3MFIA 3C66A 3UXPA 1UT8A 4CCHA 1L5UA 4M9NA 1SZPA 8ICYA 3RR8A 1MC8A 1VJ7A 3UPQA 3ZDBA 4ECQA 4LZDA 3JPQA 1UA1A 2PFQA 8ICPA 4KLUA 4F4WA 4NM1A 5KFCA 4RUAA 8ICZA 1BPBA 4F4YA 4GC6A 4UB4A 5DQGA 4K4HA 2DR8A 5KT2A 5D46A 3K75D 4GC7A 3KTQA 3RJJA 2XCPA 4F92B 3PX6A 4AT7A 4PGXA 3AUOA 2DFLA 4GXKA 4GLXA 4FO6A 1SL1A 2FPMA 5KFPA 4PHDA 1ZQDA 1D8YA 4B9SA 1BNPA 4QZFA 4ECUA 4F91B 5KFJA 1RZTA 3HPOA 5J2DA 3RJHA 4KLSA 2KZMA 4KLEA 1WOTA 3OUYA 4RPZA 4ED7A 4B9LA 1KTQA 4UAZA 2FPKA 2ZTCA 1QSYA 2KP7A 3GFKB 3IHQB 5CA7A 2XY7A 4NXZA 4RWOA 4RQ5A 5KFDA 5DEDA 3V7LA 1ZQXA 1KFDA 2W8KA 4F5RA 1ZQQA 1XU4A 2ID1A 1BPYA 1D9DA 4E8FA 5DLGA 4I2EA 3T3FA 2ZJ5A 4DSKA 2ZH2A 2HHUA 1SKSA 1NZPA 5HC9A 4IQVA 7ICPA 5KFAA 4ECWA 3PW5A 4J9QA 2FPLA 1NJZA 4EZ9A 1D9FA 4LVSA 2VA2A 5KFTA 9ICPA 4G3IA 8ICUA 9ICIA 2ZH6A 2W9BA 2KFNA 4YR3A 4DFJA 3RRHA 2HHQA 2XO7A 1ZQTA 5HRLA 4DL2A 4X4VA 5KFMA 4X0AA 3RJGA 1FA0A 1CUKA 5DGAA 2DRBA 4TUPA 3ZDAA 4O5CA 3H3AA 2MAXA 5DDYA 5KT4A 4F5PA 5KG6A 2ZH8A 1KRPA 4M6WB 4YCXA 3TFRA 4XQ8A 4K4GA 4DLEA 4NLGA 1K1QA 3AU6A 5KFKA 4C8KA 3MR6A 7ICUA 2XY5A 1ZQOA 3RB3A 1T3NA 4YD2A 1NK4A 3Q8RB 5D49A 8ICHA 8ICWA 5EWGA 1TFRA 8ICFA 8ICCA
chains in the Genus database with same CATH superfamily
3RBEA 4UD5A 1ZQLA 5AKEA 4AYBF 5AKGA 5DKWA 1WCLA 3DDHA 2B21A 2UVWA 3WFOA 2G5IB 2G07A 4CF3A 2W9CB 4KMUA 1RYUA 5J2CA 5KFUA 1X6JA 2BBHA 3NUQA 3EUB2 3KKAC 4ELVA 4UB3A 3ISDA 5L1LA 4NLCA 1QSSA 5ALXA 4PGQA 1Z4NA 5L1MA 1XSPA 3TI0A 5D61A 2ISPA 2GA9D 3OSNA 4AT9B 1K1SA 4YQWA 5HHIA 4ECSA 2I5HA 5L1KA 1QLNA 3WK7A 2PI4A 5F3XB 4YMMA 4YG2A 5J0SA 4ACOA 3ZD8A 3EPIA 1ZQMA 5J0QA 4F4ZA 1U4BA 2FMPA 4RWQA 4DQQA 1PK1B 5HHHA 1TVAA 2FMSA 2ZHBA 1ZQFA 3L3FX 2DR5A 3NS1A 5AM0A 2ZIUA 4DLGA 4JV0A 4KLMA 5JU5A 2CXYA 3QEAZ 2WF8A 4FHXA 2WF7A 4JLXA 3PW2A 2BDPA 3G6VA 5J0TA 3Q8MA 1RQNA 3UMGA 2BBJA 3KBBA 4QWEA 2KSOB 4UD4A 2ZIVA 5CFTA 1F44A 1PVQA 2XGPA 2KNJA 4FZLA 2R8KA 2KIWA 2KZZA 9ICAA 1VFGA 4UB2A 3GIKA 4FZNA 2L5YA 7ICOA 2QKQA 7ICKA 1T7PA 4KLFA 2YX8A 9ICBA 1AROP 9ICCA 1Z1VA 7ICHA 2ASLA 5J2IA 1CEZA 5DBBA 1LV5A 9ICWA 2BE3A 1XNSA 4QZGA 3H8MA 4I2FA 4EEBA 4BJQA 4DS4A 4KLLA 4OJ5A 3GZFA 3HKZF 1T94A 1KFTA 3SZ2A 5DB6A 1ZETA 2DPJA 5KT7A 2BCQA 7ICFA 2Z7JA 5J2JA 1L3SA 5CWRA 5AKIA 3WKEA 4X4OA 4DSIA 1TE2A 2ZXHA 4J9MA 2H3ZA 9ICNA 4TQSA 5ALNA 3SAFA 4ECRA 4X4SA 4RQMA 2F76X 4WQLA 4RWNA 5KT6A 2VA3A 1DK2A 4OJ6A 2ZUDA 4PH5A 4MFFA 4F5QA 4I2CA 4AT8A 3EZ5A 4F2SA 5EWEA 4P0PA 3FC4A 2MUTA 4PHAA 3TADA 1L3TA 3ZDEA 3NASA 2B0CA 3TFSA 1KBUA 4KLOA 4TUQA 3HILA 4MEYA 2MU2A 1SL0A 4QZBA 4EYIB 2FLNA 4Z6DA 2YB4A 5HP4A 4J9SA 3TAQA 4LT6A 3QE9Y 4NM2A 2ES6A 1D8LA 4K9BA 2HW3A 1ZQHA 4NXWA 4R63A 3PW0A 2Q66A 2BCSA 4JWNA 1QH9A 2Q0ZX 2ZTEA 4O6AA 2JH7A 2BCUA 2W11A 1ZD2P 1Q79A 1S0VA 3L4PA 1A0PA 3MFHA 1NK7A 1TK8A 2UVUA 1FIQA 2AXTU 4RUCA 2JRZA 1XO0A 4DEZA 5J0YA 1DOQA 1N48A 2J6TA 2HBLA 1HIWA 1N60A 4WQKA 4DFMA 4ZOHC 1XS9D 4FS2A 3VCBA 4R66A 9ICUA 3PO4A 5AM3A 4Y2YA 4EYHB 1ZQWA 4O3OA 5DDMA 7ICEA 8ICSA 5ALWA 4HYKA 2BCVA 3NVOA 2ZTDA 5AI0A 5CHGA 2F1IA 2PMZF 1SV4A 4P4MA 1TK5A 1QCKA 2KMDA 4DOAA 4YN4A 1N56A 4MFAA 4OAIZ 3WK5A 4IG8A 4QWAA 3G6YA 2K4PA 4DSFA 5C5JA 2KG5A 5HRHA 1Q3VA 4WC3A 4WH5A 4O5EA 4S3NA 5JTGA 1V9PA 1UT5A 5F2VO 2W9CA 2HOQA 4UBCA 3JPRA 5AKJA 3OVBA 2E8PA 2NRWA 1NKCA 3WK8A 3BQ0A 1B4FA 2G08A 3J81j 5AI9A 4I2DA 3V6KA 1FEZA 4FS1A 1ZJNA 4NKUA 2WF9A 2C2RA 3RJEA 4XQ7A 4PPXA 5DQHA 1S76D 3IP4B 2W43A 4CDGA 3IRUA 9ICQA 4LEZA 4J03A 1V38A 4K99A 4I29A 2DR9A 9ICGA 4NY8A 4GXIA 5BOLA 1ZD4A 3NRZA 2EWRA 4ECTA 4RPYA 4ECXA 3ISBA 3K4GA 1XC9A 3KHHA 1D8BA 3LWLA 2F2AB 2BCRA 1PK1A 2XCAA 4EBCA 2Y9UA 3F53A 2KHQA 2F1HA 3H8SA 5HR6A 1HJPA 4BGDA 4F8RA 1YZ7A 5AM5A 1RG6A 5HMMA 8ICOA 5ALSA 2P66A 4B9NA 5HRFA 1N5WA 2Y1IA 5DECA 3IM1A 2KSOA 3JPOA 1ZQUA 2OEHA 2DVIA 2LBOA 1S0MA 4Q8EA 4X4QA 4YXJA 3AU2A 5CHEA 1B43A 2DKZA 5J2HA 3H38A 4WCWA 1ZQ1C 3V72A 3EW9A 3T5LA 2HHWA 2FLLA 3KZXA 4M9HA 4JB3A 4UB5A 2HHPA 4DL3A 3H37A 3KHLA 4F4KA 4O67A 1L3UA 1SWWA 4KN7A 4QZAA 4UAUA 1A6SA 3I1YA 2ISOA 4QW8A 5IIIA 4Y2QA 1SZPA 1DRGA 4PZOA 4LZDA 5ALRA 1UA1A 1TAMA 2K8BB 4F4WA 4RUAA 4NM1A 4KLUA 8ICZA 4GC6A 2YQEA 3RJJA 1V97A 3PX6A 4GXKA 4FO6A 1SL1A 2F8LA 5KFPA 2ZIUB 1D8YA 1WWUA 5GTHU 5J2DA 3RJHA 2KZMA 2FCLA 3OUYA 5AI6A 2FPKA 4Y2JA 1K5OA 4C4RA 5KFDA 3V7LA 4F5RA 1ZQQA 3NWIA 4I2EA 2ZIVB 1SKSA 4UASA 1T3QA 1C20A 4ECWA 3WKDA 4EZ9A 4LVSA 8ICUA 2D3DA 2W9BA 2MA1A 3RRHA 2HHQA 5CEHA 4X4VA 4X0AA 3L5KA 2VKQA 2DRBA 3EF2A 2E1EA 3H3AA 2GH1A 2WHEA 5DDYA 4XQ8A 2LKYA 3WKCA 1V85A 1SWVA 3RB3A 1T3NA 4YD2A 1NK4A 8ICWA 2K60A 3N7PD 3RJIA 3MGVA 1ZD3A 3WFSC 2AJQA 4OJOA 1ZXIA 2I6XA 4NXTA 3CW2C 4WOYA 4FO1A 4LEWA 2O6KA 3D2SA 4IRKA 4J9OA 1Q8KA 3QEBZ 3K7DA 2F44A 5TZVA 4WC4A 1Z1BA 2OWOA 7ICGA 3DV9A 3ER9B 4C4TA 3Q8QB 3PX0A 8ICBA 1L8LA 3IN5A 2W04A 3KD3A 1NZBA 2PFPA 2D8CA 4R8UA 8ICAA 1BPXA 1NO5A 5IILA 2EZYA 4J9LA 5L1IA 3C21A 4USAA 4AT8B 2FJ6A 5KL8B 2XICA 3MGIA 4ELUA 1S5LU 4CGZA 4TURA 3A0BU 3M8SA 2WAQC 1ZQNA 2W8LA 5AKYA 4US9A 4M5DA 4I2GA 2EANA 3HWTA 5KG7A 1X2IA 5EOZA 2DPIA 5KFOA 5J0PA 3IDWA 1T8EA 4NLKA 4O3MA 4RNNA 1F5AA 2M2UA 4WC1A 5ALEA 5CJ7A 3F2DA 2DGZA 4OAGA 4PHPA 9ICVA 1L7OA 4JV1A 2LYHA 4UAVA 5ALMA 3TANA 4P0QB 1S9FA 2W7PA 1L7NA 1L8OA 2JEFA 1TK0A 3SI8A 4DQSA 2PFNA 4WC5A 1PVPA 1BPEA 5J29A 2BKEA 4P2HA 4DWIA 2YMMA 3C18A 2KIVA 2IHNA 3MCRA 5KFYA 5B3QA 1O03A 4M04A 5ALGA 2LHTA 2BZFA 4WC2A 3FDSA 3AM9A 3JCFA 3ETRA 4RZRA 1KW4A 2WFAA 4DFDA 2BR0A 5J0OA 4DS5A 2AGQA 3PSIA 7ICTA 1F0MA 3RBDA 1EXNA 3OHBA 4PZNA 3EPGA 3OGUA 2H3VA 4F5NA 1NK8A 2YMLA 4O3NA 3K1ZA 3UXOA 3U26A 4NL9C 3OVSA 4ED6A 4RQ7A 4EBJA 3H0LB 2G5HB 4UAYA 3C1ZA 1SXDA 5KFNA 2XGQA 5AM4A 1O08A 4KLDA 2FDRA 4Q44A 5ALZA 1L3VA 4Q8FA 3V7KA 3I28A 2JEGA 4E0DA 3BDPA 3RR7A 2ZH9A 4Y2PA 2B56A 4JK1A 4EBKA 3F2CA 5KNIA 5AK6A 1SKWA 3NYBA 5ALIA 2W3RA 3ZDCA 5A0LA 4DQPA 2W9AA 1SKRA 2ZG6A 3C1YA 1BVSA 4F2RA 3WK4A 5AI8A 3PY8A 1DXSA 3QU7A 4IRDA 3WFRE 3BQTA 1S0OA 5J0RA 3C2MA 4WC0A 2KICA 4QWBA 2M2WA 1PK3A 2OHFA 2ZJAA 2W54A 4MHVA 3HP6A 1UCVA 3THVA 1PUZA 5AM2A 8ICVA 1R8AA 9ICXA 2I1QA 2WF6A 4QZIA 3WK9A 2O5AA 4UB1A 3PR4A 3DEEA 3VC8A 4DL5A 2ZH5A 4J9PA 2FMQA 7ICJA 2NRZA 1SV0C 3HIYA 1ZQZA 5FP0A 1GO3F 3D2QA 4O69A 3NVZA 4CF4A 1KN5A 5J2EA 4NV0A 4I27A 4LZGA 1CRXA 3PVXA 4I2IA 1NKEA 1V4AA 2KOBA 8ICJA 2XIDA 1ZRMA 3JPNA 2KJ9A 4KLQA 2C2EA 4EEYA 1N62A 1BPDA 5KG3A 2IOFK 4M47A 3H8WA 2R8IA 2RDJA 5KFFA 1U9LA 2EH9A 2EZZA 3PV8A 4PGYA 4NWIA 5EWFA 3KKAA 4NLZA 4UB8U 3OJSA 1SL2A 3OUYB 2ZH1A 3H4DA 4YFKA 2V9WA 3QU4A 2IHMA 4IR1A 4XJEA 4KLJA 3N4MB 2ZH3A 2ZUCA 2Q4TA 4BWJA 7ICIA 3HJ4A 4I0UA 2DR7A 4ATBB 3V7JA 2W9BB 3MDAA 1DGSA 4DSEA 4Z6FA 4EELA 5H2FU 3RB0A 5CFUA 3ICXA 3C2LA 5ALJA 4DF8A 3GIJA 4JMUA 4OJPA 3WU2U 2NV3A 4R64A 3RH4A 5KFGA 4RQ2A 3EWAA 5KT5A 1DK3A 3SV3A 5EE1A 4RPXA 5KFVA 2G0AA 2BPFA 3BS7A 2KE7A 4X4UA 2W03A 4X4NA 1NK6A 1S97A 1LKYA 3T5HA 2ZUBA 4Z6EA 2NRKA 4OO1J 4JUZA 2ZHAA 5KFQA 3MR5A 5AIAA 4UQGA 1S10A 2BQUA 3LQCB 3GQCA 4PHEA 3ONNA 1KEJA 2PFOA 3H7IA 1Z19A 5G5HA 4YXMA 3KFUF 1MQ2A 2NYVA 1ZQAA 2UVVA 1N61A 1MQ3A 4OD0A 5KG4A 4P0QA 1TFYA 3OJUA 3SYZA 3PSPA 3BQ7A 3AQFA 2W55A 2HHXA 9ICEA 3K1RB 4WC6A 4R8UB 3LDAA 1N5XA 4EGWA 3C5FA 4RT2A 2NO5A 4HAIA 3AL0B 4F93B 2EDUA 1XSLA 3MFIA 3C66A 3UXPA 1UT8A 4M9NA 1MC8A 2P35A 4ECQA 3JPQA 2PFQA 3F5AA 5KFCA 1L7PA 4K4HA 2DR8A 5ALLA 4GC7A 5D46A 3KTQA 4F92B 1YZ6A 4PHDA 1ZQDA 4B9SA 1MA7A 3UMCA 1HEKA 1VDVA 4NXXA 1PVRA 4B9LA 4UAZA 3GFKB 4RWOA 2GLEA 4RQ5A 4F72A 2W8KA 1WYGA 2ID1A 1D9DA 4DSKA 1NZPA 2HHUA 4UW9A 4IQVA 3PW5A 9ICPA 5KFTA 9ICIA 2HSZA 2KFNA 2ZH6A 2WB1C 4DFJA 1X66A 4RQNA 1ZQTA 5HRLA 3PSFA 5KFMA 2YB1A 3ZDAA 3S6JA 4F5PA 5KG6A 3TFRA 2RRDA 2JMGA 4NLGA 1K1QA 4C8KA 2K8AA 5KFKA 4FFDA 1M6YA 2OXOA 5D49A 2HBKA 5EWGA 1TFRA 4O3RA 8ICFA 8ICCA 5J2AA 1KL9A 2QB0A 4IRCA 5D4BA 4TUSA 4ED0A 2RP5A 2ASDA 5T14A 3ETLA 4DQIA 2OM6A 1COKA 5D62A 1ZQIA 4MF8A 5J2FA 2KV2A 2DL0A 5AKKA 2RHFA 3CRXA 4QIWC 2V4QA 3H0RB 4WC7A 2I9GA 5AKHA 5DB9A 3C2KA 4C8NA 1JQRA 1RXWA 3F2BA 2YN4A 3TQ1A 4PL1A 4ED1A 4I2JA 3RJFA 5EE3A 4XUSA 2A1JA 4ED3A 3ALRA 8ICKA 5KTQA 3RFAA 3JPTA 3MGHA 3WFPA 3O0FA 3TKAA 4NXUA 2ZXIA 3E58A 7ICRA 5HRGA 2GWSA 4DL6A 3PW4A 5ALPA 5KFHA 4EX6A 2JH1A 5HNKA 3M6ZA 5KG1A 4YR2A 4CE6A 1ZQEA 3BQ2A 1MIWA 3RAQA 5ALTA 5DEDA 3ISCA 4TQRA 3M9OB 3M9NB 1ZQJA 2W3SA 3SR6A 4G9BA 1Y88A 2C28A 5B66U 4ED2A 1ZQCA 9ICJA 5L9XA 3PX4A 2G06A 4UAWA 2MSNA 5KT3A 2EQYA 1CI4A 2IMWP 4MEXA 4R65A 3QU5A 1Q3UA 4UARA 5F9NA 1ZJMA 3NVVA 4Z6CA 4RQ1A 1RYSA 3IG5A 3FM9A 3GV8B 4J9KA 1KLNA 3TAPA 1S0NA 4C7ZA 1RPLA 2M0NA 1S77D 4J9RA 2E8NA 4F4XA 2PBEA 3UPSA 1NOMA 1L6NA 5HMLA 4RQ8A 2HBMA 5CRXA 3Q8LA 4FBUA 2B6GA 4ATBA 1XWLA 4NLNA 5KFEA 1RDFA 3V6HA 4DCCA 1U45A 4HX0A 4M0AA 2BDUA 4EEDA 4RQ4A 2KJ8A 4K97A 3AMZA 2BHNA 2JGAA 1KSPA 2AHOB 5E79U 2DKXA 3TARA 1UETA 4GFJA 1X40A 2KZ3A 4RT3A 4EP7A 3QYPA 3JPPA 2KEYA 4F3OA 3GIMA 2HHVA 4DSJA 3GDXA 1SGGA 1QQ6A 4C8LA 4BX9C 2XY6A 5CB1A 3LWMA 2VANA 1ZQRA 3RJKA 1XO1A 2K4EA 4YP3A 5KL1B 1ZQYA 1OU5A 2IOHA 2K8CB 1J2MA 4BUGA 4DQRA 2LI6A 2Y0SF 2Y1JA 5HRIA 2NRXA 4BWMA 4KX5A 5IIMA 3JZ0A 3D2NA 1X9SA 3QNMA 2ZIWB 2OH2A 1B22A 3PW7A 5IIOA 5KG2A 4KLIA 5J0WA 4FHYA 4FHPA 3B9JA 4O3SA 1IXRA 5KG0A 2H3QA 2QARA 2DRAA 4FH3A 1QTMA 3D6JA 2WAQF 4LJXA 4DOBA 2ESEA 4UATA 8ICRA 2DBYA 3M8RA 5G5GA 1QQ5A 4QJFB 1KKXA 3QUCA 4JLZA 4YMNA 1LKYB 8ICNA 3GIIA 4FH5A 5KFSA 2FLPA 3I76A 4FBTA 5ALDA 8ICXA 1COOA 4M9LA 1NNLA 5BPCA 4M9GA 4ELTA 4GIBA 2K4HA 4X4TA 2AQ4A 4YMOA 3NGDA 3EYZA 1N2XA 4KB6A 5DQIA 5ALFA 4DO9A 2J6SA 4KTQA 5K4LA 1UQVA 1J97A 3B0YA 3HX0A 3CNHA 2KD1A 5HRDA 2YMPA 9ICSA 4B9TA 4RQ0A 5J2KA 4Y2UA 3L9DA 3AN1A 2D6FC 5ALVA 3T79A 2HOFA 1SZHA 2KTQA 1DGJA 5J0UA 1QSLA 4RQ6A 3PHZA 3JYYA 4MKPA 2EAMA 3HJEA 4KMOB 2JEJA 2B51A 4A8EA 4FHWA 1HUZA 2HN1A 3QU9A 5KFXA 1ZQKA 5EE9A 3LVVA 5AK5A 8ICTA 3V6JA 3MDCA 3WKBA 2PKEA 1R8CA 1WWVA 4K9AA 1A76A 3IV6A 9ICOA 3RH6A 2F3NA 5ALUA 2R8HA 3N97B 3RH5A 7ICNA 2LYBA 1ZQBA 1NK0A 4BXOA 2KK0A 2ZIXB 1TKDA 2KFZA 4X4PA 2E8MA 5CFSA 2ASJA 4I2BA 4I28A 4OAHA 3N28A 1SXEA 4EEKA 1ZQSA 4Y2SA 4K96A 1P7DA 1WCNA 4DL4A 1Z00A 3QZ8A 2ODGA 2WTFA 2EAPA 5KFLA 5JUMA 4M2YA 1IM4A 5DG8A 4KLTA 4JV2A 8ICEA 1TFWA 7ICVA 4AYBC 3N7SC 3BS5A 4P4PA 2AU0A 3KZIU 2AGOA 4IL6U 7ICMA 2HMXA 1J2NA 3PNCA 3OVAA 2QB0B 4OCZA 4F71A 1HUOA 3SAHA 2EAOA 4IQUA 3BJYA 4KLGA 1ZQGA 4FHVA 2IHOA 2JV3A 3QXGA 5KG5A 1ZYQA 3GU3A 4I2HA 2A1AA 3ORYA 7ICSA 3CK6A 3UMBA 2RLTA 2A1JB 2VJ5A 5DBCA 2FI1A 2M2VA 4N7RA 4FE3A 1NK5A 5GTIU 1A77A 3SENA 3TADC 1URJA 4ZH4A 1NKBA 2EZXA 2KKPA 4KN4A 4QZEA 3CYMA 4CF5A 2OYYA 5DLFA 2VA8A 4X5VA 1JI7A 5ALYA 1ED1A 5HR7A 4CCHA 1L5UA 3RR8A 5ALKA 3ED5A 1BPBA 4F4YA 4UB4A 3ZI4A 3K75D 2JHDA 2XCPA 3IG8A 4AT7A 3AUOA 1FFVA 2RFFA 4KM5A 2FPMA 2GO7A 3FAHA 4ECUA 1JALA 4F91B 5KFJA 3OPXA 1RZTA 2NO4A 4KLSA 3CP8A 4RPZA 4C4SA 1KTQA 2XVTA 1QSYA 5CA7A 1KFDA 1ZQXA 4E8FA 1BPYA 4NL9A 5DLGA 3SD7A 1OXJA 7ICPA 2F77X 5JTIA 4G3IA 4YR3A 3LVWA 1GPJA 5AI5A 3RJGA 1FA0A 5DGAA 4C0ZA 2VIXA 2LM1A 4TUPA 2MAXA 2ZH8A 4CRXA 1KRPA 1ZD5A 5AKZA 2XI9A 4K4GA 2ZIWA 3AU6A 1ZQOA 3SAGA 1X6IA 8ICHA 3HKZC 2E5SA 3M1YA 4B9MA 2CPRA 4YR0A 2J6UA 1UEUA 1Z3EB 8ICMA 2O1PA 4E80A 1TV9A 1BGXT 3SMVA 3BZCA 1FFUA 2HVIA 2KHVA 1MN8A 4NLBA 3MR3A 3RTVA 2DUYA 1LB2B 1IV8A 2HI0A 4O0IA 3NRWA 4Y2TA 9ICFA 1U49A 1ZOLA 4ECYA 2H3FA 5DBAA 2QLTA 1R89A 1SV0A 3AQLA 3A0HU 1SB3C 4KITB 4IQWA 1TAQA 1NJXA 3RB6A 4IS7A 4DF4A 3QZ7A 2JZBB 1JX4A 4J9NA 3OV7A 2P6RA 2IUBA 2OCEA 3BQ1A 2HBJA 3KHGA 4Y2RA 1UA0A 3G6XA 2BQRA 2QARB 4CNQA 1NJYA 4DL7A 1AQ6A 2N1RA 2NRTA 4PL2A 1ZQPA 5KFZA 5IIKA 3QX7A 5DG7A 4IR9A 1FO4A 4O3PA 3JPSA 5HR9A 4FZMA 2H5XA 3MABA 1OUQA 3AQNA 5KAFU 3LK9A 2HHTA 1LVHA 2GOLA 1KFSA 1PX5A 2RDIA 3MC1A 1Q78A 8ICLA 3H40A 2M2TA 4QWCA 3HW8A 5KFIA 3NVYA 5KFBA 2ZJ8A 2W7OA 1ZQVA 4MFCA 2XC9A 4Y2VA 2ZIXA 2WB1F 9ICLA 1JXLA 4M6WA 1XSNA 2UVRA 1T4GA 1N63A 1Z4OA 3R9KA 3RF9A 1JN3A 3KHRA 1MIVA 2PMZC 4QZHA 2ZH4A 4C8OA 2BGWA 3AQEA 1JRPA 1NI3A 2JXJA 3SEIA 9ICRA 5HRKA 4RWPA 4XRHA 1BNOA 4QZCA 3AEVA 4C80A 3PMNA 4RNMA 4QZ8A 1NJWA 3QU2A 2R8JA 4EV6A 3E0FA 1WG8A 4QIWF 2YY6A 3FYHA 4O68A 2VJ4A 3NVWA 3GV5B 4E7XA 4DFKA 2BQ3A 2E1FA 5DG9A 5L1JA 7ICQA 4ICAA 5AK4A 4AT9A 2HN2A 2KJ5A 5IINA 2CRXA 4BXOB 5B5EU 8ICQA 4JWMA 3MBYA 1KDHA 4B6JA 1MIYA 5AIBA 3M9MB 3UXNA 2C22A 1RXVA 8ICGA 2LPEA 5J0XA 4QZDA 3H8JA 2E3TA 5F9LA 4RU9A 1RQLA 3AQMA 1Z00B 1L7MA 3RB4A 3OHAA 4DSLA 1C7YA 3PSTA 4LEVA 3C28A 4Q45A 4LEYA 5J2GA 4C7YA 4PJ0U 3SV4A 3LYSA 9ICTA 4B9UA 5HRBA 4ECVA 4Y2XA 3BS5B 9ICKA 5DB7A 3WFQE 2JEIA 4BDPA 2ZH7A 2R18A 3N7RC 2ATLA 2HHSA 2R8GA 1BPZA 5J2BA 5JRTA 2IBKA 3HJ1A 3PZPA 1JAJA 4RQ3A 3UQ0A 3TACB 4IQTA 2KVSA 4X0BA 3RAXA 4O9MA 1ZRNA 1JXEA 4WBYA 3NKUA 1JIHA 2KN7A 1YT3A 2KKVA 2Y9TA 3GV7B 4NJ8A 5KFRA 4EBDA 4O3QA 4DFPA 1UEVA 4EX7A 4QW9A 2PXIA 1YLQA 2CN1A 1S8OA 2GAFD 2BPGA 4I2AA 2WF5A 2RQ5A 5ALHA 2HDOA 1TAUA 4EZ6A 7ICLA 5DGBA 1X9XA 5KFWA 2NRVA 4KX3A 4WJ3B 4F5OA 1X9MA 3M6KA 4QWDA 3H39A 1IIPA 3MR2A 2DWQA 3UQ2A 4AT7B 1F5SA 5AHXA 3H4BA 5CP2A 1PZNA 1KNYA 1KQQA 1MSWD 1ECWA 5C0YA 4NXVA 3E2EA 4M9JA 1UHUA 4UBBA 4US8A 3ZD9A 3GILA 4P4OA 1X42A 4IC9A 4NKTA 4GXJA 2W9MA 3B0XA 2V4RA 1JUDA 3H0MB 5CR0A 8ICIA 4U6PA 4ED8A 5AK3A 2F1JA 4KLHA 3C5GA 2P6UA 3PMLA 2AQ0A 4F50A 2F8KA 5KAIU 4B9VA 5DB8A 3QUTA 4K4IA 3T5KA 2AH5A 4YVZA 3BZKA 2M9NA 2BPCA 2JZBA 1X9WA 5D63A 2H3IA 3ER8C 2G09A 1RM6C 1WUDA 2MRLA 3Q8PB 1VJ5A 4WBZA 1H38A 2A3VA 5J8YC 1JMSA 4YD1A 4ECZA 4DOCA 4QNLA 5BOMA 4MF2A 9ICMA 4Q43A 2IA6A 2C2DA 3RRGA 3T5JA 1Q46A 5IIJA 1SIJA 3WKAA 3SQIA 3OTQA 1QQ7A 2DQNB 2K4IA 9ICHA 2KVCA 2JR5A 1U48A 1OW5A 4AP9A 5HREA 2ALZA 4XA5A 3Q8KA 2Y0SC 1R8BA 2HVHA 3ZDDA 1JROA 3HRDD 3QUQA 3PR5B 3OSPA 3C23A 2DF4B 2AGPA 5TISU 4K8VA 4RNOA 3AQKA 4EBEA 4P0PB 3ERCC 4O5KA 2MUTB 5AM1A 5AICA 4C8MA 1RYRA 4X4RA 3HT3A 2PI5A 3PO5A 2LYAA 5B3PA 4QZ9A 1U47A 1NK9A 3NTUA 3Q8SB 2YTUA 2HOIA 8ICYA 1VJ7A 3UPQA 3ZDBA 5EE0A 3OWGA 8ICPA 1IG6A 4OAFA 5DQGA 3M7DA 4K98A 5KT2A 1B0XA 4UB6U 5AKXA 4PGXA 2DFLA 4OJLA 4GLXA 2QB1A 1BNPA 4QZFA 3HPOA 1WOTA 3UM9A 5ALQA 4KLEA 4ED7A 2KP7A 2ZTCA 3WK6A 3IHQB 2E8OA 2XY7A 4NXZA 2K89A 1VLBA 1XU4A 3KOOA 3T3FA 2ZJ5A 2ZH2A 5HC9A 2IOFA 5KFAA 3QUBA 4U7CA 4J9QA 2FPLA 1NJZA 1D9FA 2VA2A 5ALOA 2A19A 4EENA 2XO7A 5AI4A 4DL2A 1CUKA 4O5CA 2HCFA 5KT4A 4M6WB 4YCXA 4DLEA 5J8YA 1UPHA 2B4VA 2LM4A 3MR6A 7ICUA 2FE9A 2XY5A 2YMQA 5AKLA 3C29A 3Q8RB 2LMRA 3F5EA
chains in the Genus database with same CATH topology
5J2AA 3RBEA 4B9MA 4UD5A 1ZQLA 4YR0A 2J6UA 1UEUA 5DKWA 4IRCA 1WCLA 3RJIA 1Z3EB 5D4BA 4TUSA 4ED0A 3WFSC 8ICMA 2AJQA 2B21A 2UVWA 3WFOA 2O1PA 2ASDA 4E80A 1TV9A 1BGXT 3ETLA 4DQIA 1ZQIA 4MF8A 5J2FA 2W9CB 4KMUA 2HVIA 5J2CA 5KFUA 2V4QA 4WC7A 4IRKA 2I9GA 4J9OA 5DB9A 3C2KA 3QEBZ 4C8NA 4ELVA 1JQRA 4UB3A 3MR3A 3RTVA 1RXWA 5TZVA 3ISDA 4WC4A 3TQ1A 1LB2B 4ED1A 4I2JA 2OWOA 4O0IA 5L1LA 9ICFA 1U49A 3RJFA 7ICGA 4XUSA 1QSSA 2A1JA 4PGQA 3Q8QB 4ECYA 4ED3A 3PX0A 8ICBA 2ZH3A 1XSPA 5KTQA 8ICKA 3TI0A 3JPTA 3MGHA 3WFPA 2ISPA 5DBAA 5HRGA 7ICRA 2GWSA 2PFPA 4KLDA 1R89A 4R8UA 8ICAA 4DL6A 3OSNA 1BPXA 3PW4A 4AT9B 1K1SA 3AQLA 1NO5A 4YQWA 7ICMA 4KITB 5HHIA 5KFHA 4ECSA 1TAQA 5IILA 4IQWA 4J9LA 3RB6A 1NJXA 5HR9A 5L1KA 1QLNA 5L1IA 5HNKA 4DF4A 2PI4A 3C21A 4YMMA 5KG1A 4YR2A 4YG2A 3QZ7A 1ZQEA 4AT8B 3BQ2A 2JZBB 5J0SA 1MIWA 3RAQA 1JX4A 3ISCA 4TQRA 3ZD8A 3M9OB 3MGIA 3EPIA 4J9NA 5J0QA 1ZQMA 4ELUA 3M9NB 1ZQJA 3OV7A 4TURA 2P6RA 4F4ZA 3BQ1A 1U4BA 2FMPA 1Y88A 3KHGA 3M8SA 2C28A 1UA0A 4RWQA 4DQQA 1ZQNA 5HHHA 2W8LA 1TVAA 4ED2A 2FMSA 3G6XA 9ICMA 2ZHBA 2BQRA 1ZQCA 4M5DA 9ICJA 5L9XA 3PX4A 1ZQFA 4I2GA 3HWTA 1NJYA 4UAWA 4DLGA 2DR5A 4JV0A 4DL7A 4KLMA 2NRTA 5KT3A 5KG7A 3QEAZ 1X2IA 5EOZA 4FHXA 1ZQPA 5KFZA 5IIKA 3PW2A 4R65A 4MEXA 5KFOA 5DG7A 2DPIA 2IMWP 2BDPA 5J0PA 3G6VA 4IR9A 5F9NA 5J0TA 4O3PA 3JPSA 3Q8MA 1T8EA 4NLKA 4RNNA 2H5XA 2M2UA 3MABA 1F5AA 4QWEA 4WC1A 1ZJMA 3AQNA 3LK9A 5CJ7A 2HHTA 1KFSA 4Z6CA 1PX5A 2RDIA 4PHPA 9ICVA 4RQ1A 1RYSA 4UD4A 1Q78A 8ICLA 3H40A 2M2TA 4JV1A 4QWCA 3GV8B 3HW8A 2LYHA 5KFIA 2XGPA 4J9KA 5KFBA 1KLNA 3TAPA 3TANA 1S9FA 1S0NA 2R8KA 1RPLA 2ZJ8A 2KZZA 9ICAA 1S77D 1VFGA 4J9RA 1ZQVA 4F4XA 4UB2A 1TK0A 2JEFA 4MFCA 3SI8A 2XC9A 3GIKA 2PBEA 1NOMA 3UPSA 5HMLA 7ICOA 4RQ8A 9ICLA 1JXLA 4M6WA 4DQSA 2PFNA 1T7PA 1XSNA 2UVRA 4KLFA 7ICKA 9ICBA 4WC5A 1AROP 1T4GA 3Q8LA 4FBUA 1BPEA 9ICCA 2RFFA 5J29A 2BKEA 4P2HA 4ATBA 7ICHA 4DWIA 2ASLA 1XWLA 5J2IA 1JN3A 3KHRA 4NLNA 3C18A 1CEZA 5DBBA 5KFEA 1LV5A 9ICWA 1MIVA 2BE3A 4QZGA 2IHNA 4QZHA 5KFYA 2ZH4A 3V6HA 4C8OA 4I2FA 1U45A 2BGWA 4DS4A 4KLLA 4M0AA 4M04A 4WC2A 3FDSA 9ICRA 5HRKA 1KFTA 3SZ2A 4RZRA 4RWPA 5DB6A 4XRHA 4RQ4A 1ZETA 5KT7A 2DPJA 2BCQA 7ICFA 1BNOA 4QZCA 4NKUA 2BR0A 5J0OA 3PMNA 5J2JA 2BHNA 4DS5A 2AGQA 1KSPA 1L3SA 4RNMA 5CWRA 7ICTA 4QZ8A 3TARA 1NJWA 1UETA 2KZ3A 4RT3A 4EP7A 3RBDA 3JPPA 4F3OA 1EXNA 2R8JA 3OHBA 3GIMA 3EPGA 3OGUA 2HHVA 4X4OA 4DSJA 4F5NA 3GDXA 1NK8A 4DSIA 3FYHA 4C8LA 4J9MA 3GV5B 4E7XA 2XY6A 9ICNA 4TQSA 4DFKA 4O3NA 5CB1A 2BQ3A 5DG9A 5L1JA 7ICQA 3LWMA 2VANA 3UXOA 4ECRA 1ZQRA 4X4SA 3RJKA 1XO1A 4YP3A 3OVSA 4ED6A 4RWNA 4RQ7A 1ZQYA 5KT6A 4AT9A 1OU5A 2VA3A 4EBJA 1DK2A 4DQRA 2Y1JA 2ZUDA 4UAYA 5HRIA 3C1ZA 5KFNA 4PH5A 4BXOB 5IINA 4MFFA 2XGQA 2NRXA 4BWMA 4F5QA 5IIMA 8ICQA 3JZ0A 4JWMA 4I2CA 3MBYA 3EZ5A 1KDHA 5EWEA 4Q44A 1X9SA 3M9MB 1L3VA 4F2SA 3V7KA 4Q8FA 3UXNA 1MIYA 2MUTA 4PHAA 3PW7A 2C22A 1RXVA 5IIOA 1L3TA 2JEGA 5KG2A 3ZDEA 3BDPA 3RR7A 4KLIA 3TFSA 5J0WA 5J0XA 4QZDA 4JK1A 4TUQA 4KLOA 8ICGA 3H8JA 4MEYA 4FHYA 4EBKA 5F9LA 4FHPA 4RU9A 1SKWA 3NYBA 1B22A 1SL0A 3AQMA 1Z00B 4QZBA 4EYIB 3ZDCA 4O3SA 2FLNA 2W9AA 4DQPA 1IXRA 1SKRA 4Z6DA 5HP4A 3RB4A 3OHAA 4DSLA 5KG0A 1C7YA 4J9SA 3C1YA 3TAQA 2DRAA 4LT6A 3QE9Y 4FH3A 4NM2A 1QTMA 4Q45A 1D8LA 1BVSA 5J2GA 4F2RA 2HW3A 4AT8A 4DOBA 1ZQHA 3SV4A 4R63A 8ICRA 3M8RA 3PW0A 3PY8A 9ICTA 2Q66A 4B9UA 5HRBA 4ECVA 4IRDA 2BCSA 4JWNA 9ICKA 3WFRE 2Q0ZX 5DB7A 3BQTA 2ZTEA 5J0RA 4YMNA 3C2MA 1S0OA 2JEIA 3WFQE 4WC0A 4BDPA 4QWBA 2M2WA 2ZH7A 2BCUA 8ICNA 3GIIA 4FH5A 5KFSA 2ATLA 2HHSA 1Q79A 2R8GA 2ZJAA 1S0VA 1BPZA 2FLPA 5J2BA 3HP6A 4FBTA 2IBKA 3THVA 3HJ1A 1JAJA 8ICXA 1COOA 4RQ3A 3MFHA 3UQ0A 1NK7A 4M9LA 8ICVA 1TK8A 2UVUA 1R8AA 4IQTA 5BPCA 9ICXA 2I1QA 4RUCA 4QZIA 4ELTA 4M9GA 4X0BA 4X4TA 3RAXA 2AQ4A 4DEZA 5J0YA 1DOQA 1N48A 2J6TA 4YMOA 3NGDA 3EYZA 4O9MA 2O5AA 1JXEA 4UB1A 5DQIA 3PR4A 4DO9A 4WBYA 2J6SA 4DL5A 4DFMA 2ZH5A 1XS9D 2ZH9A 4J9PA 4KTQA 1JIHA 4FS2A 2KN7A 2FMQA 7ICJA 2NRZA 3B0YA 3HX0A 3HIYA 4R66A 9ICUA 1ZQZA 3GV7B 3PO4A 5KFRA 5HRDA 4EBDA 9ICSA 4EYHB 1ZQWA 4O3OA 4B9TA 5DDMA 4RQ0A 4O3QA 7ICEA 4DFPA 5J2KA 8ICSA 1UEVA 3L9DA 4QW9A 4HYKA 2PXIA 5J2EA 2ZTDA 2BCVA 4I27A 1YLQA 4LZGA 5CHGA 2F1IA 4O3RA 3PVXA 4I2IA 1NKEA 4P4MA 2BPGA 1V4AA 8ICJA 4I2AA 1TK5A 2KTQA 3JPNA 4DOAA 4YN4A 1N56A 4MFAA 5J0UA 1QSLA 4EZ6A 2C2EA 4KLQA 1TAUA 4RQ6A 7ICLA 4IG8A 4EEYA 3JYYA 5DGBA 5KFWA 4QWAA 1BPDA 2NRVA 5KG3A 3G6YA 5C5JA 4F5OA 3H8WA 4DSFA 1X9MA 2JEJA 4M47A 5HRHA 4FHWA 2R8IA 1HUZA 4QWDA 4WC3A 2RDJA 5KFFA 1U9LA 3H39A 3PV8A 5KFXA 4O5EA 4S3NA 3MR2A 1ZQKA 4PGYA 3UQ2A 5EWFA 1V9PA 1UT5A 4AT7B 5F2VO 8ICTA 3V6JA 4NLZA 3H4BA 3OJSA 2W9CA 5CP2A 1SL2A 4UBCA 1PZNA 3JPRA 3MDCA 1KNYA 1MSWD 1R8CA 3OVBA 1A76A 2NRWA 3OUYB 1NKCA 9ICOA 3RH6A 4E0DA 4M9JA 3E2EA 2ZH1A 3H4DA 3BQ0A 4YFKA 2V9WA 2R8HA 4UBBA 3N97B 3RH5A 7ICNA 3ZD9A 3GILA 4P4OA 1ZQBA 1NK0A 4BXOA 1TKDA 2IHMA 4IR1A 2KFZA 4NKTA 4X4PA 4KLJA 4GXJA 4I2DA 2W9MA 3B0XA 2V4RA 3V6KA 5CR0A 4FS1A 3N4MB 1ZJNA 2ZUCA 2ASJA 4ED8A 4I2BA 4I28A 8ICIA 2F1JA 2C2RA 3RJEA 4KLHA 4PPXA 4XQ7A 5DQHA 3C5GA 1S76D 4BWJA 7ICIA 3HJ4A 2DR7A 1ZQSA 2P6UA 4ATBB 3PMLA 2AQ0A 3V7JA 2W9BB 4F50A 1WCNA 3MDAA 1DGSA 9ICQA 4DSEA 4Z6FA 4DL4A 3RB0A 1Z00A 3C2LA 4B9VA 4I29A 2DR9A 5DB8A 3QZ8A 4DF8A 3GIJA 3T5KA 4K4IA 9ICGA 4NY8A 4YVZA 2WTFA 4GXIA 2M9NA 2BPCA 5KFLA 5JUMA 5BOLA 4M2YA 2JZBA 1IM4A 5DG8A 4R64A 4ECTA 3RH4A 4RPYA 1X9WA 5KFGA 4RQ2A 4ECXA 4JV2A 4KLTA 3EWAA 3ISBA 3K4GA 1XC9A 3KHHA 5KT5A 8ICEA 7ICVA 1TFWA 1DK3A 3SV3A 3LWLA 2BCRA 4RPXA 5KFVA 4P4PA 3Q8PB 2AU0A 2AGOA 2BPFA 4WBZA 4X4UA 1H38A 4X4NA 1NK6A 1JMSA 4YD1A 2XCAA 4ECZA 1S97A 4DOCA 5BOMA 4EBCA 3T5HA 2ZUBA 3PNCA 4Q43A 4Z6EA 2C2DA 2IA6A 3RRGA 4MF2A 3T5JA 2NRKA 2F1HA 5IIJA 3H8SA 1HUOA 1HJPA 4JUZA 4BGDA 4F8RA 2ZHAA 5KFQA 3MR5A 5HMMA 9ICHA 8ICOA 1U48A 3OVAA 4UQGA 1S10A 2P66A 4B9NA 5HRFA 2BQUA 5HREA 2ALZA 3LQCB 4XA5A 4IQUA 3BJYA 3GQCA 2Y1IA 3Q8KA 4KLGA 4PHEA 1ZQGA 2HVHA 3IM1A 1R8BA 5DECA 3JPOA 3ZDDA 1KEJA 2PFOA 1ZQUA 3H7IA 3PR5B 4FHVA 5KG5A 3OSPA 4YXMA 1ZYQA 3C23A 1MQ2A 2DVIA 1S0MA 2AGPA 4Q8EA 4I2HA 4X4QA 4YXJA 3ORYA 1ZQAA 2UVVA 7ICSA 3AU2A 1B43A 5J2HA 1MQ3A 3H38A 4RNOA 4WCWA 5KG4A 1TFYA 3OJUA 3V72A 4EBEA 3AQKA 2A1JB 5DBCA 3SYZA 4O5KA 2MUTB 3EW9A 3T5LA 2M2VA 2HHXA 9ICEA 2HHWA 2FLLA 4C8MA 1NK5A 4M9HA 1RYRA 4X4RA 3HT3A 2PI5A 4UB5A 1A77A 3PO5A 4WC6A 4R8UB 2HHPA 3LDAA 4DL3A 3H37A 3KHLA 4F4KA 1L3UA 4QZ9A 4KN7A 4QZAA 4ZH4A 3C5FA 1NKBA 1U47A 4RT2A 4KN4A 1NK9A 2ISOA 4QZEA 3NTUA 3Q8SB 4QW8A 5IIIA 4F93B 1XSLA 5DLFA 2VA8A 4X5VA 3MFIA 3C66A 3UXPA 1UT8A 4CCHA 1L5UA 4M9NA 1SZPA 8ICYA 3RR8A 1MC8A 1VJ7A 3UPQA 3ZDBA 4ECQA 4LZDA 3JPQA 1UA1A 2PFQA 8ICPA 4KLUA 4F4WA 4NM1A 5KFCA 4RUAA 8ICZA 1BPBA 4F4YA 4GC6A 4UB4A 5DQGA 4K4HA 2DR8A 5KT2A 5D46A 3K75D 4GC7A 3KTQA 3RJJA 2XCPA 4F92B 3PX6A 4AT7A 4PGXA 3AUOA 2DFLA 4GXKA 4GLXA 4FO6A 1SL1A 2FPMA 5KFPA 4PHDA 1ZQDA 1D8YA 4B9SA 1BNPA 4QZFA 4ECUA 4F91B 5KFJA 1RZTA 3HPOA 5J2DA 3RJHA 4KLSA 2KZMA 4KLEA 1WOTA 3OUYA 4RPZA 4ED7A 4B9LA 1KTQA 4UAZA 2FPKA 2ZTCA 1QSYA 2KP7A 3GFKB 3IHQB 5CA7A 2XY7A 4NXZA 4RWOA 4RQ5A 5KFDA 5DEDA 3V7LA 1ZQXA 1KFDA 2W8KA 4F5RA 1ZQQA 1XU4A 2ID1A 1BPYA 1D9DA 4E8FA 5DLGA 4I2EA 3T3FA 2ZJ5A 4DSKA 2ZH2A 2HHUA 1SKSA 1NZPA 5HC9A 4IQVA 7ICPA 5KFAA 4ECWA 3PW5A 4J9QA 2FPLA 1NJZA 4EZ9A 1D9FA 4LVSA 2VA2A 5KFTA 9ICPA 4G3IA 8ICUA 9ICIA 2ZH6A 2W9BA 2KFNA 4YR3A 4DFJA 3RRHA 2HHQA 2XO7A 1ZQTA 5HRLA 4DL2A 4X4VA 5KFMA 4X0AA 3RJGA 1FA0A 1CUKA 5DGAA 2DRBA 4TUPA 3ZDAA 4O5CA 3H3AA 2MAXA 5DDYA 5KT4A 4F5PA 5KG6A 2ZH8A 1KRPA 4M6WB 4YCXA 3TFRA 4XQ8A 4K4GA 4DLEA 4NLGA 1K1QA 3AU6A 5KFKA 4C8KA 3MR6A 7ICUA 2XY5A 1ZQOA 3RB3A 1T3NA 4YD2A 1NK4A 3Q8RB 5D49A 8ICHA 8ICWA 5EWGA 1TFRA 8ICFA 8ICCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J2A A;  3RBE A;  4B9M A;  4UD5 A;  1ZQL A;  4YR0 A;  2J6U A;  1UEU A;  5DKW A;  4IRC A;  1WCL A;  3RJI A;  1Z3E B;  5D4B A;  4TUS A;  4ED0 A;  3WFS C;  8ICM A;  2AJQ A;  2B21 A;  2UVW A;  3WFO A;  2O1P A;  2ASD A;  4E80 A;  1TV9 A;  1BGX T;  3ETL A;  4DQI A;  1ZQI A;  4MF8 A;  5J2F A;  2W9C B;  4KMU A;  2HVI A;  5J2C A;  5KFU A;  2V4Q A;  4WC7 A;  4IRK A;  2I9G A;  4J9O A;  5DB9 A;  3C2K A;  3QEB Z;  4C8N A;  4ELV A;  1JQR A;  4UB3 A;  3MR3 A;  3RTV A;  1RXW A;  5TZV A;  3ISD A;  4WC4 A;  3TQ1 A;  1LB2 B;  4ED1 A;  4I2J A;  2OWO A;  4O0I A;  5L1L A;  9ICF A;  1U49 A;  3RJF A;  7ICG A;  4XUS A;  1QSS A;  2A1J A;  4PGQ A;  3Q8Q B;  4ECY A;  4ED3 A;  3PX0 A;  8ICB A;  2ZH3 A;  1XSP A;  5KTQ A;  8ICK A;  3TI0 A;  3JPT A;  3MGH A;  3WFP A;  2ISP A;  5DBA A;  5HRG A;  7ICR A;  2GWS A;  2PFP A;  4KLD A;  1R89 A;  4R8U A;  8ICA A;  4DL6 A;  3OSN A;  1BPX A;  3PW4 A;  4AT9 B;  1K1S A;  3AQL A;  1NO5 A;  4YQW A;  7ICM A;  4KIT B;  5HHI A;  5KFH A;  4ECS A;  1TAQ A;  5IIL A;  4IQW A;  4J9L A;  3RB6 A;  1NJX A;  5HR9 A;  5L1K A;  1QLN A;  5L1I A;  5HNK A;  4DF4 A;  2PI4 A;  3C21 A;  4YMM A;  5KG1 A;  4YR2 A;  4YG2 A;  3QZ7 A;  1ZQE A;  4AT8 B;  3BQ2 A;  2JZB B;  5J0S A;  1MIW A;  3RAQ A;  1JX4 A;  3ISC A;  4TQR A;  3ZD8 A;  3M9O B;  3MGI A;  3EPI A;  4J9N A;  5J0Q A;  1ZQM A;  4ELU A;  3M9N B;  1ZQJ A;  3OV7 A;  4TUR A;  2P6R A;  4F4Z A;  3BQ1 A;  1U4B A;  2FMP A;  1Y88 A;  3KHG A;  3M8S A;  2C28 A;  1UA0 A;  4RWQ A;  4DQQ A;  1ZQN A;  5HHH A;  2W8L A;  1TVA A;  4ED2 A;  2FMS A;  3G6X A;  9ICM A;  2ZHB A;  2BQR A;  1ZQC A;  4M5D A;  9ICJ A;  5L9X A;  3PX4 A;  1ZQF A;  4I2G A;  3HWT A;  1NJY A;  4UAW A;  4DLG A;  2DR5 A;  4JV0 A;  4DL7 A;  4KLM A;  2NRT A;  5KT3 A;  5KG7 A;  3QEA Z;  1X2I A;  5EOZ A;  4FHX A;  1ZQP A;  5KFZ A;  5IIK A;  3PW2 A;  4R65 A;  4MEX A;  5KFO A;  5DG7 A;  2DPI A;  2IMW P;  2BDP A;  5J0P A;  3G6V A;  4IR9 A;  5F9N A;  5J0T A;  4O3P A;  3JPS A;  3Q8M A;  1T8E A;  4NLK A;  4RNN A;  2H5X A;  2M2U A;  3MAB A;  1F5A A;  4QWE A;  4WC1 A;  1ZJM A;  3AQN A;  3LK9 A;  5CJ7 A;  2HHT A;  1KFS A;  4Z6C A;  1PX5 A;  2RDI A;  4PHP A;  9ICV A;  4RQ1 A;  1RYS A;  4UD4 A;  1Q78 A;  8ICL A;  3H40 A;  2M2T A;  4JV1 A;  4QWC A;  3GV8 B;  3HW8 A;  2LYH A;  5KFI A;  2XGP A;  4J9K A;  5KFB A;  1KLN A;  3TAP A;  3TAN A;  1S9F A;  1S0N A;  2R8K A;  1RPL A;  2ZJ8 A;  2KZZ A;  9ICA A;  1S77 D;  1VFG A;  4J9R A;  1ZQV A;  4F4X A;  4UB2 A;  1TK0 A;  2JEF A;  4MFC A;  3SI8 A;  2XC9 A;  3GIK A;  2PBE A;  1NOM A;  3UPS A;  5HML A;  7ICO A;  4RQ8 A;  9ICL A;  1JXL A;  4M6W A;  4DQS A;  2PFN A;  1T7P A;  1XSN A;  2UVR A;  4KLF A;  7ICK A;  9ICB A;  4WC5 A;  1ARO P;  1T4G A;  3Q8L A;  4FBU A;  1BPE A;  9ICC A;  2RFF A;  5J29 A;  2BKE A;  4P2H A;  4ATB A;  7ICH A;  4DWI A;  2ASL A;  1XWL A;  5J2I A;  1JN3 A;  3KHR A;  4NLN A;  3C18 A;  1CEZ A;  5DBB A;  5KFE A;  1LV5 A;  9ICW A;  1MIV A;  2BE3 A;  4QZG A;  2IHN A;  4QZH A;  5KFY A;  2ZH4 A;  3V6H A;  4C8O A;  4I2F A;  1U45 A;  2BGW A;  4DS4 A;  4KLL A;  4M0A A;  4M04 A;  4WC2 A;  3FDS A;  9ICR A;  5HRK A;  1KFT A;  3SZ2 A;  4RZR A;  4RWP A;  5DB6 A;  4XRH A;  4RQ4 A;  1ZET A;  5KT7 A;  2DPJ A;  2BCQ A;  7ICF A;  1BNO A;  4QZC A;  4NKU A;  2BR0 A;  5J0O A;  3PMN A;  5J2J A;  2BHN A;  4DS5 A;  2AGQ A;  1KSP A;  1L3S A;  4RNM A;  5CWR A;  7ICT A;  4QZ8 A;  3TAR A;  1NJW A;  1UET A;  2KZ3 A;  4RT3 A;  4EP7 A;  3RBD A;  3JPP A;  4F3O A;  1EXN A;  2R8J A;  3OHB A;  3GIM A;  3EPG A;  3OGU A;  2HHV A;  4X4O A;  4DSJ A;  4F5N A;  3GDX A;  1NK8 A;  4DSI A;  3FYH A;  4C8L A;  4J9M A;  3GV5 B;  4E7X A;  2XY6 A;  9ICN A;  4TQS A;  4DFK A;  4O3N A;  5CB1 A;  2BQ3 A;  5DG9 A;  5L1J A;  7ICQ A;  3LWM A;  2VAN A;  3UXO A;  4ECR A;  1ZQR A;  4X4S A;  3RJK A;  1XO1 A;  4YP3 A;  3OVS A;  4ED6 A;  4RWN A;  4RQ7 A;  1ZQY A;  5KT6 A;  4AT9 A;  1OU5 A;  2VA3 A;  4EBJ A;  1DK2 A;  4DQR A;  2Y1J A;  2ZUD A;  4UAY A;  5HRI A;  3C1Z A;  5KFN A;  4PH5 A;  4BXO B;  5IIN A;  4MFF A;  2XGQ A;  2NRX A;  4BWM A;  4F5Q A;  5IIM A;  8ICQ A;  3JZ0 A;  4JWM A;  4I2C A;  3MBY A;  3EZ5 A;  1KDH A;  5EWE A;  4Q44 A;  1X9S A;  3M9M B;  1L3V A;  4F2S A;  3V7K A;  4Q8F A;  3UXN A;  1MIY A;  2MUT A;  4PHA A;  3PW7 A;  2C22 A;  1RXV A;  5IIO A;  1L3T A;  2JEG A;  5KG2 A;  3ZDE A;  3BDP A;  3RR7 A;  4KLI A;  3TFS A;  5J0W A;  5J0X A;  4QZD A;  4JK1 A;  4TUQ A;  4KLO A;  8ICG A;  3H8J A;  4MEY A;  4FHY A;  4EBK A;  5F9L A;  4FHP A;  4RU9 A;  1SKW A;  3NYB A;  1B22 A;  1SL0 A;  3AQM A;  1Z00 B;  4QZB A;  4EYI B;  3ZDC A;  4O3S A;  2FLN A;  2W9A A;  4DQP A;  1IXR A;  1SKR A;  4Z6D A;  5HP4 A;  3RB4 A;  3OHA A;  4DSL A;  5KG0 A;  1C7Y A;  4J9S A;  3C1Y A;  3TAQ A;  2DRA A;  4LT6 A;  3QE9 Y;  4FH3 A;  4NM2 A;  1QTM A;  4Q45 A;  1D8L A;  1BVS A;  5J2G A;  4F2R A;  2HW3 A;  4AT8 A;  4DOB A;  1ZQH A;  3SV4 A;  4R63 A;  8ICR A;  3M8R A;  3PW0 A;  3PY8 A;  9ICT A;  2Q66 A;  4B9U A;  5HRB A;  4ECV A;  4IRD A;  2BCS A;  4JWN A;  9ICK A;  3WFR E;  2Q0Z X;  5DB7 A;  3BQT A;  2ZTE A;  5J0R A;  4YMN A;  3C2M A;  1S0O A;  2JEI A;  3WFQ E;  4WC0 A;  4BDP A;  4QWB A;  2M2W A;  2ZH7 A;  2BCU A;  8ICN A;  3GII A;  4FH5 A;  5KFS A;  2ATL A;  2HHS A;  1Q79 A;  2R8G A;  2ZJA A;  1S0V A;  1BPZ A;  2FLP A;  5J2B A;  3HP6 A;  4FBT A;  2IBK A;  3THV A;  3HJ1 A;  1JAJ A;  8ICX A;  1COO A;  4RQ3 A;  3MFH A;  3UQ0 A;  1NK7 A;  4M9L A;  8ICV A;  1TK8 A;  2UVU A;  1R8A A;  4IQT A;  5BPC A;  9ICX A;  2I1Q A;  4RUC A;  4QZI A;  4ELT A;  4M9G A;  4X0B A;  4X4T A;  3RAX A;  2AQ4 A;  4DEZ A;  5J0Y A;  1DOQ A;  1N48 A;  2J6T A;  4YMO A;  3NGD A;  3EYZ A;  4O9M A;  2O5A A;  1JXE A;  4UB1 A;  5DQI A;  3PR4 A;  4DO9 A;  4WBY A;  2J6S A;  4DL5 A;  4DFM A;  2ZH5 A;  1XS9 D;  2ZH9 A;  4J9P A;  4KTQ A;  1JIH A;  4FS2 A;  2KN7 A;  2FMQ A;  7ICJ A;  2NRZ A;  3B0Y A;  3HX0 A;  3HIY A;  4R66 A;  9ICU A;  1ZQZ A;  3GV7 B;  3PO4 A;  5KFR A;  5HRD A;  4EBD A;  9ICS A;  4EYH B;  1ZQW A;  4O3O A;  4B9T A;  5DDM A;  4RQ0 A;  4O3Q A;  7ICE A;  4DFP A;  5J2K A;  8ICS A;  1UEV A;  3L9D A;  4QW9 A;  4HYK A;  2PXI A;  5J2E A;  2ZTD A;  2BCV A;  4I27 A;  1YLQ A;  4LZG A;  5CHG A;  2F1I A;  4O3R A;  3PVX A;  4I2I A;  1NKE A;  4P4M A;  2BPG A;  1V4A A;  8ICJ A;  4I2A A;  1TK5 A;  2KTQ A;  3JPN A;  4DOA A;  4YN4 A;  1N56 A;  4MFA A;  5J0U A;  1QSL A;  4EZ6 A;  2C2E A;  4KLQ A;  1TAU A;  4RQ6 A;  7ICL A;  4IG8 A;  4EEY A;  3JYY A;  5DGB A;  5KFW A;  4QWA A;  1BPD A;  2NRV A;  5KG3 A;  3G6Y A;  5C5J A;  4F5O A;  3H8W A;  4DSF A;  1X9M A;  2JEJ A;  4M47 A;  5HRH A;  4FHW A;  2R8I A;  1HUZ A;  4QWD A;  4WC3 A;  2RDJ A;  5KFF A;  1U9L A;  3H39 A;  3PV8 A;  5KFX A;  4O5E A;  4S3N A;  3MR2 A;  1ZQK A;  4PGY A;  3UQ2 A;  5EWF A;  1V9P A;  1UT5 A;  4AT7 B;  5F2V O;  8ICT A;  3V6J A;  4NLZ A;  3H4B A;  3OJS A;  2W9C A;  5CP2 A;  1SL2 A;  4UBC A;  1PZN A;  3JPR A;  3MDC A;  1KNY A;  1MSW D;  1R8C A;  3OVB A;  1A76 A;  2NRW A;  3OUY B;  1NKC A;  9ICO A;  3RH6 A;  4E0D A;  4M9J A;  3E2E A;  2ZH1 A;  3H4D A;  3BQ0 A;  4YFK A;  2V9W A;  2R8H A;  4UBB A;  3N97 B;  3RH5 A;  7ICN A;  3ZD9 A;  3GIL A;  4P4O A;  1ZQB A;  1NK0 A;  4BXO A;  1TKD A;  2IHM A;  4IR1 A;  2KFZ A;  4NKT A;  4X4P A;  4KLJ A;  4GXJ A;  4I2D A;  2W9M A;  3B0X A;  2V4R A;  3V6K A;  5CR0 A;  4FS1 A;  3N4M B;  1ZJN A;  2ZUC A;  2ASJ A;  4ED8 A;  4I2B A;  4I28 A;  8ICI A;  2F1J A;  2C2R A;  3RJE A;  4KLH A;  4PPX A;  4XQ7 A;  5DQH A;  3C5G A;  1S76 D;  4BWJ A;  7ICI A;  3HJ4 A;  2DR7 A;  1ZQS A;  2P6U A;  4ATB B;  3PML A;  2AQ0 A;  3V7J A;  2W9B B;  4F50 A;  1WCN A;  3MDA A;  1DGS A;  9ICQ A;  4DSE A;  4Z6F A;  4DL4 A;  3RB0 A;  1Z00 A;  3C2L A;  4B9V A;  4I29 A;  2DR9 A;  5DB8 A;  3QZ8 A;  4DF8 A;  3GIJ A;  3T5K A;  4K4I A;  9ICG A;  4NY8 A;  4YVZ A;  2WTF A;  4GXI A;  2M9N A;  2BPC A;  5KFL A;  5JUM A;  5BOL A;  4M2Y A;  2JZB A;  1IM4 A;  5DG8 A;  4R64 A;  4ECT A;  3RH4 A;  4RPY A;  1X9W A;  5KFG A;  4RQ2 A;  4ECX A;  4JV2 A;  4KLT A;  3EWA A;  3ISB A;  3K4G A;  1XC9 A;  3KHH A;  5KT5 A;  8ICE A;  7ICV A;  1TFW A;  1DK3 A;  3SV3 A;  3LWL A;  2BCR A;  4RPX A;  5KFV A;  4P4P A;  3Q8P B;  2AU0 A;  2AGO A;  2BPF A;  4WBZ A;  4X4U A;  1H38 A;  4X4N A;  1NK6 A;  1JMS A;  4YD1 A;  2XCA A;  4ECZ A;  1S97 A;  4DOC A;  5BOM A;  4EBC A;  3T5H A;  2ZUB A;  3PNC A;  4Q43 A;  4Z6E A;  2C2D A;  2IA6 A;  3RRG A;  4MF2 A;  3T5J A;  2NRK A;  2F1H A;  5IIJ A;  3H8S A;  1HUO A;  1HJP A;  4JUZ A;  4BGD A;  4F8R A;  2ZHA A;  5KFQ A;  3MR5 A;  5HMM A;  9ICH A;  8ICO A;  1U48 A;  3OVA A;  4UQG A;  1S10 A;  2P66 A;  4B9N A;  5HRF A;  2BQU A;  5HRE A;  2ALZ A;  3LQC B;  4XA5 A;  4IQU A;  3BJY A;  3GQC A;  2Y1I A;  3Q8K A;  4KLG A;  4PHE A;  1ZQG A;  2HVH A;  3IM1 A;  1R8B A;  5DEC A;  3JPO A;  3ZDD A;  1KEJ A;  2PFO A;  1ZQU A;  3H7I A;  3PR5 B;  4FHV A;  5KG5 A;  3OSP A;  4YXM A;  1ZYQ A;  3C23 A;  1MQ2 A;  2DVI A;  1S0M A;  2AGP A;  4Q8E A;  4I2H A;  4X4Q A;  4YXJ A;  3ORY A;  1ZQA A;  2UVV A;  7ICS A;  3AU2 A;  1B43 A;  5J2H A;  1MQ3 A;  3H38 A;  4RNO A;  4WCW A;  5KG4 A;  1TFY A;  3OJU A;  3V72 A;  4EBE A;  3AQK A;  2A1J B;  5DBC A;  3SYZ A;  4O5K A;  2MUT B;  3EW9 A;  3T5L A;  2M2V A;  2HHX A;  9ICE A;  2HHW A;  2FLL A;  4C8M A;  1NK5 A;  4M9H A;  1RYR A;  4X4R A;  3HT3 A;  2PI5 A;  4UB5 A;  1A77 A;  3PO5 A;  4WC6 A;  4R8U B;  2HHP A;  3LDA A;  4DL3 A;  3H37 A;  3KHL A;  4F4K A;  1L3U A;  4QZ9 A;  4KN7 A;  4QZA A;  4ZH4 A;  3C5F A;  1NKB A;  1U47 A;  4RT2 A;  4KN4 A;  1NK9 A;  2ISO A;  4QZE A;  3NTU A;  3Q8S B;  4QW8 A;  5III A;  4F93 B;  1XSL A;  5DLF A;  2VA8 A;  4X5V A;  3MFI A;  3C66 A;  3UXP A;  1UT8 A;  4CCH A;  1L5U A;  4M9N A;  1SZP A;  8ICY A;  3RR8 A;  1MC8 A;  1VJ7 A;  3UPQ A;  3ZDB A;  4ECQ A;  4LZD A;  3JPQ A;  1UA1 A;  2PFQ A;  8ICP A;  4KLU A;  4F4W A;  4NM1 A;  5KFC A;  4RUA A;  8ICZ A;  1BPB A;  4F4Y A;  4GC6 A;  4UB4 A;  5DQG A;  4K4H A;  2DR8 A;  5KT2 A;  5D46 A;  3K75 D;  4GC7 A;  3KTQ A;  3RJJ A;  2XCP A;  4F92 B;  3PX6 A;  4AT7 A;  4PGX A;  3AUO A;  2DFL A;  4GXK A;  4GLX A;  4FO6 A;  1SL1 A;  2FPM A;  5KFP A;  4PHD A;  1ZQD A;  1D8Y A;  4B9S A;  1BNP A;  4QZF A;  4ECU A;  4F91 B;  5KFJ A;  1RZT A;  3HPO A;  5J2D A;  3RJH A;  4KLS A;  2KZM A;  4KLE A;  1WOT A;  3OUY A;  4RPZ A;  4ED7 A;  4B9L A;  1KTQ A;  4UAZ A;  2FPK A;  2ZTC A;  1QSY A;  2KP7 A;  3GFK B;  3IHQ B;  5CA7 A;  2XY7 A;  4NXZ A;  4RWO A;  4RQ5 A;  5KFD A;  5DED A;  3V7L A;  1ZQX A;  1KFD A;  2W8K A;  4F5R A;  1ZQQ A;  1XU4 A;  2ID1 A;  1BPY A;  1D9D A;  4E8F A;  5DLG A;  4I2E A;  3T3F A;  2ZJ5 A;  4DSK A;  2ZH2 A;  2HHU A;  1SKS A;  1NZP A;  5HC9 A;  4IQV A;  7ICP A;  5KFA A;  4ECW A;  3PW5 A;  4J9Q A;  2FPL A;  1NJZ A;  4EZ9 A;  1D9F A;  4LVS A;  2VA2 A;  5KFT A;  9ICP A;  4G3I A;  8ICU A;  9ICI A;  2ZH6 A;  2W9B A;  2KFN A;  4YR3 A;  4DFJ A;  3RRH A;  2HHQ A;  2XO7 A;  1ZQT A;  5HRL A;  4DL2 A;  4X4V A;  5KFM A;  4X0A A;  3RJG A;  1FA0 A;  1CUK A;  5DGA A;  2DRB A;  4TUP A;  3ZDA A;  4O5C A;  3H3A A;  2MAX A;  5DDY A;  5KT4 A;  4F5P A;  5KG6 A;  2ZH8 A;  1KRP A;  4M6W B;  4YCX A;  3TFR A;  4XQ8 A;  4K4G A;  4DLE A;  4NLG A;  1K1Q A;  3AU6 A;  5KFK A;  4C8K A;  3MR6 A;  7ICU A;  2XY5 A;  1ZQO A;  3RB3 A;  1T3N A;  4YD2 A;  1NK4 A;  3Q8R B;  5D49 A;  8ICH A;  8ICW A;  5EWG A;  1TFR A;  8ICF A;  8ICC A; 
#chains in the Genus database with same CATH topology
 3RBE A;  4UD5 A;  1ZQL A;  5AKE A;  4AYB F;  5AKG A;  5DKW A;  1WCL A;  3DDH A;  2B21 A;  2UVW A;  3WFO A;  2G5I B;  2G07 A;  4CF3 A;  2W9C B;  4KMU A;  1RYU A;  5J2C A;  5KFU A;  1X6J A;  2BBH A;  3NUQ A;  3EUB 2;  3KKA C;  4ELV A;  4UB3 A;  3ISD A;  5L1L A;  4NLC A;  1QSS A;  5ALX A;  4PGQ A;  1Z4N A;  5L1M A;  1XSP A;  3TI0 A;  5D61 A;  2ISP A;  2GA9 D;  3OSN A;  4AT9 B;  1K1S A;  4YQW A;  5HHI A;  4ECS A;  2I5H A;  5L1K A;  1QLN A;  3WK7 A;  2PI4 A;  5F3X B;  4YMM A;  4YG2 A;  5J0S A;  4ACO A;  3ZD8 A;  3EPI A;  1ZQM A;  5J0Q A;  4F4Z A;  1U4B A;  2FMP A;  4RWQ A;  4DQQ A;  1PK1 B;  5HHH A;  1TVA A;  2FMS A;  2ZHB A;  1ZQF A;  3L3F X;  2DR5 A;  3NS1 A;  5AM0 A;  2ZIU A;  4DLG A;  4JV0 A;  4KLM A;  5JU5 A;  2CXY A;  3QEA Z;  2WF8 A;  4FHX A;  2WF7 A;  4JLX A;  3PW2 A;  2BDP A;  3G6V A;  5J0T A;  3Q8M A;  1RQN A;  3UMG A;  2BBJ A;  3KBB A;  4QWE A;  2KSO B;  4UD4 A;  2ZIV A;  5CFT A;  1F44 A;  1PVQ A;  2XGP A;  2KNJ A;  4FZL A;  2R8K A;  2KIW A;  2KZZ A;  9ICA A;  1VFG A;  4UB2 A;  3GIK A;  4FZN A;  2L5Y A;  7ICO A;  2QKQ A;  7ICK A;  1T7P A;  4KLF A;  2YX8 A;  9ICB A;  1ARO P;  9ICC A;  1Z1V A;  7ICH A;  2ASL A;  5J2I A;  1CEZ A;  5DBB A;  1LV5 A;  9ICW A;  2BE3 A;  1XNS A;  4QZG A;  3H8M A;  4I2F A;  4EEB A;  4BJQ A;  4DS4 A;  4KLL A;  4OJ5 A;  3GZF A;  3HKZ F;  1T94 A;  1KFT A;  3SZ2 A;  5DB6 A;  1ZET A;  2DPJ A;  5KT7 A;  2BCQ A;  7ICF A;  2Z7J A;  5J2J A;  1L3S A;  5CWR A;  5AKI A;  3WKE A;  4X4O A;  4DSI A;  1TE2 A;  2ZXH A;  4J9M A;  2H3Z A;  9ICN A;  4TQS A;  5ALN A;  3SAF A;  4ECR A;  4X4S A;  4RQM A;  2F76 X;  4WQL A;  4RWN A;  5KT6 A;  2VA3 A;  1DK2 A;  4OJ6 A;  2ZUD A;  4PH5 A;  4MFF A;  4F5Q A;  4I2C A;  4AT8 A;  3EZ5 A;  4F2S A;  5EWE A;  4P0P A;  3FC4 A;  2MUT A;  4PHA A;  3TAD A;  1L3T A;  3ZDE A;  3NAS A;  2B0C A;  3TFS A;  1KBU A;  4KLO A;  4TUQ A;  3HIL A;  4MEY A;  2MU2 A;  1SL0 A;  4QZB A;  4EYI B;  2FLN A;  4Z6D A;  2YB4 A;  5HP4 A;  4J9S A;  3TAQ A;  4LT6 A;  3QE9 Y;  4NM2 A;  2ES6 A;  1D8L A;  4K9B A;  2HW3 A;  1ZQH A;  4NXW A;  4R63 A;  3PW0 A;  2Q66 A;  2BCS A;  4JWN A;  1QH9 A;  2Q0Z X;  2ZTE A;  4O6A A;  2JH7 A;  2BCU A;  2W11 A;  1ZD2 P;  1Q79 A;  1S0V A;  3L4P A;  1A0P A;  3MFH A;  1NK7 A;  1TK8 A;  2UVU A;  1FIQ A;  2AXT U;  4RUC A;  2JRZ A;  1XO0 A;  4DEZ A;  5J0Y A;  1DOQ A;  1N48 A;  2J6T A;  2HBL A;  1HIW A;  1N60 A;  4WQK A;  4DFM A;  4ZOH C;  1XS9 D;  4FS2 A;  3VCB A;  4R66 A;  9ICU A;  3PO4 A;  5AM3 A;  4Y2Y A;  4EYH B;  1ZQW A;  4O3O A;  5DDM A;  7ICE A;  8ICS A;  5ALW A;  4HYK A;  2BCV A;  3NVO A;  2ZTD A;  5AI0 A;  5CHG A;  2F1I A;  2PMZ F;  1SV4 A;  4P4M A;  1TK5 A;  1QCK A;  2KMD A;  4DOA A;  4YN4 A;  1N56 A;  4MFA A;  4OAI Z;  3WK5 A;  4IG8 A;  4QWA A;  3G6Y A;  2K4P A;  4DSF A;  5C5J A;  2KG5 A;  5HRH A;  1Q3V A;  4WC3 A;  4WH5 A;  4O5E A;  4S3N A;  5JTG A;  1V9P A;  1UT5 A;  5F2V O;  2W9C A;  2HOQ A;  4UBC A;  3JPR A;  5AKJ A;  3OVB A;  2E8P A;  2NRW A;  1NKC A;  3WK8 A;  3BQ0 A;  1B4F A;  2G08 A;  3J81 j;  5AI9 A;  4I2D A;  3V6K A;  1FEZ A;  4FS1 A;  1ZJN A;  4NKU A;  2WF9 A;  2C2R A;  3RJE A;  4XQ7 A;  4PPX A;  5DQH A;  1S76 D;  3IP4 B;  2W43 A;  4CDG A;  3IRU A;  9ICQ A;  4LEZ A;  4J03 A;  1V38 A;  4K99 A;  4I29 A;  2DR9 A;  9ICG A;  4NY8 A;  4GXI A;  5BOL A;  1ZD4 A;  3NRZ A;  2EWR A;  4ECT A;  4RPY A;  4ECX A;  3ISB A;  3K4G A;  1XC9 A;  3KHH A;  1D8B A;  3LWL A;  2F2A B;  2BCR A;  1PK1 A;  2XCA A;  4EBC A;  2Y9U A;  3F53 A;  2KHQ A;  2F1H A;  3H8S A;  5HR6 A;  1HJP A;  4BGD A;  4F8R A;  1YZ7 A;  5AM5 A;  1RG6 A;  5HMM A;  8ICO A;  5ALS A;  2P66 A;  4B9N A;  5HRF A;  1N5W A;  2Y1I A;  5DEC A;  3IM1 A;  2KSO A;  3JPO A;  1ZQU A;  2OEH A;  2DVI A;  2LBO A;  1S0M A;  4Q8E A;  4X4Q A;  4YXJ A;  3AU2 A;  5CHE A;  1B43 A;  2DKZ A;  5J2H A;  3H38 A;  4WCW A;  1ZQ1 C;  3V72 A;  3EW9 A;  3T5L A;  2HHW A;  2FLL A;  3KZX A;  4M9H A;  4JB3 A;  4UB5 A;  2HHP A;  4DL3 A;  3H37 A;  3KHL A;  4F4K A;  4O67 A;  1L3U A;  1SWW A;  4KN7 A;  4QZA A;  4UAU A;  1A6S A;  3I1Y A;  2ISO A;  4QW8 A;  5III A;  4Y2Q A;  1SZP A;  1DRG A;  4PZO A;  4LZD A;  5ALR A;  1UA1 A;  1TAM A;  2K8B B;  4F4W A;  4RUA A;  4NM1 A;  4KLU A;  8ICZ A;  4GC6 A;  2YQE A;  3RJJ A;  1V97 A;  3PX6 A;  4GXK A;  4FO6 A;  1SL1 A;  2F8L A;  5KFP A;  2ZIU B;  1D8Y A;  1WWU A;  5GTH U;  5J2D A;  3RJH A;  2KZM A;  2FCL A;  3OUY A;  5AI6 A;  2FPK A;  4Y2J A;  1K5O A;  4C4R A;  5KFD A;  3V7L A;  4F5R A;  1ZQQ A;  3NWI A;  4I2E A;  2ZIV B;  1SKS A;  4UAS A;  1T3Q A;  1C20 A;  4ECW A;  3WKD A;  4EZ9 A;  4LVS A;  8ICU A;  2D3D A;  2W9B A;  2MA1 A;  3RRH A;  2HHQ A;  5CEH A;  4X4V A;  4X0A A;  3L5K A;  2VKQ A;  2DRB A;  3EF2 A;  2E1E A;  3H3A A;  2GH1 A;  2WHE A;  5DDY A;  4XQ8 A;  2LKY A;  3WKC A;  1V85 A;  1SWV A;  3RB3 A;  1T3N A;  4YD2 A;  1NK4 A;  8ICW A;  2K60 A;  3N7P D;  3RJI A;  3MGV A;  1ZD3 A;  3WFS C;  2AJQ A;  4OJO A;  1ZXI A;  2I6X A;  4NXT A;  3CW2 C;  4WOY A;  4FO1 A;  4LEW A;  2O6K A;  3D2S A;  4IRK A;  4J9O A;  1Q8K A;  3QEB Z;  3K7D A;  2F44 A;  5TZV A;  4WC4 A;  1Z1B A;  2OWO A;  7ICG A;  3DV9 A;  3ER9 B;  4C4T A;  3Q8Q B;  3PX0 A;  8ICB A;  1L8L A;  3IN5 A;  2W04 A;  3KD3 A;  1NZB A;  2PFP A;  2D8C A;  4R8U A;  8ICA A;  1BPX A;  1NO5 A;  5IIL A;  2EZY A;  4J9L A;  5L1I A;  3C21 A;  4USA A;  4AT8 B;  2FJ6 A;  5KL8 B;  2XIC A;  3MGI A;  4ELU A;  1S5L U;  4CGZ A;  4TUR A;  3A0B U;  3M8S A;  2WAQ C;  1ZQN A;  2W8L A;  5AKY A;  4US9 A;  4M5D A;  4I2G A;  2EAN A;  3HWT A;  5KG7 A;  1X2I A;  5EOZ A;  2DPI A;  5KFO A;  5J0P A;  3IDW A;  1T8E A;  4NLK A;  4O3M A;  4RNN A;  1F5A A;  2M2U A;  4WC1 A;  5ALE A;  5CJ7 A;  3F2D A;  2DGZ A;  4OAG A;  4PHP A;  9ICV A;  1L7O A;  4JV1 A;  2LYH A;  4UAV A;  5ALM A;  3TAN A;  4P0Q B;  1S9F A;  2W7P A;  1L7N A;  1L8O A;  2JEF A;  1TK0 A;  3SI8 A;  4DQS A;  2PFN A;  4WC5 A;  1PVP A;  1BPE A;  5J29 A;  2BKE A;  4P2H A;  4DWI A;  2YMM A;  3C18 A;  2KIV A;  2IHN A;  3MCR A;  5KFY A;  5B3Q A;  1O03 A;  4M04 A;  5ALG A;  2LHT A;  2BZF A;  4WC2 A;  3FDS A;  3AM9 A;  3JCF A;  3ETR A;  4RZR A;  1KW4 A;  2WFA A;  4DFD A;  2BR0 A;  5J0O A;  4DS5 A;  2AGQ A;  3PSI A;  7ICT A;  1F0M A;  3RBD A;  1EXN A;  3OHB A;  4PZN A;  3EPG A;  3OGU A;  2H3V A;  4F5N A;  1NK8 A;  2YML A;  4O3N A;  3K1Z A;  3UXO A;  3U26 A;  4NL9 C;  3OVS A;  4ED6 A;  4RQ7 A;  4EBJ A;  3H0L B;  2G5H B;  4UAY A;  3C1Z A;  1SXD A;  5KFN A;  2XGQ A;  5AM4 A;  1O08 A;  4KLD A;  2FDR A;  4Q44 A;  5ALZ A;  1L3V A;  4Q8F A;  3V7K A;  3I28 A;  2JEG A;  4E0D A;  3BDP A;  3RR7 A;  2ZH9 A;  4Y2P A;  2B56 A;  4JK1 A;  4EBK A;  3F2C A;  5KNI A;  5AK6 A;  1SKW A;  3NYB A;  5ALI A;  2W3R A;  3ZDC A;  5A0L A;  4DQP A;  2W9A A;  1SKR A;  2ZG6 A;  3C1Y A;  1BVS A;  4F2R A;  3WK4 A;  5AI8 A;  3PY8 A;  1DXS A;  3QU7 A;  4IRD A;  3WFR E;  3BQT A;  1S0O A;  5J0R A;  3C2M A;  4WC0 A;  2KIC A;  4QWB A;  2M2W A;  1PK3 A;  2OHF A;  2ZJA A;  2W54 A;  4MHV A;  3HP6 A;  1UCV A;  3THV A;  1PUZ A;  5AM2 A;  8ICV A;  1R8A A;  9ICX A;  2I1Q A;  2WF6 A;  4QZI A;  3WK9 A;  2O5A A;  4UB1 A;  3PR4 A;  3DEE A;  3VC8 A;  4DL5 A;  2ZH5 A;  4J9P A;  2FMQ A;  7ICJ A;  2NRZ A;  1SV0 C;  3HIY A;  1ZQZ A;  5FP0 A;  1GO3 F;  3D2Q A;  4O69 A;  3NVZ A;  4CF4 A;  1KN5 A;  5J2E A;  4NV0 A;  4I27 A;  4LZG A;  1CRX A;  3PVX A;  4I2I A;  1NKE A;  1V4A A;  2KOB A;  8ICJ A;  2XID A;  1ZRM A;  3JPN A;  2KJ9 A;  4KLQ A;  2C2E A;  4EEY A;  1N62 A;  1BPD A;  5KG3 A;  2IOF K;  4M47 A;  3H8W A;  2R8I A;  2RDJ A;  5KFF A;  1U9L A;  2EH9 A;  2EZZ A;  3PV8 A;  4PGY A;  4NWI A;  5EWF A;  3KKA A;  4NLZ A;  4UB8 U;  3OJS A;  1SL2 A;  3OUY B;  2ZH1 A;  3H4D A;  4YFK A;  2V9W A;  3QU4 A;  2IHM A;  4IR1 A;  4XJE A;  4KLJ A;  3N4M B;  2ZH3 A;  2ZUC A;  2Q4T A;  4BWJ A;  7ICI A;  3HJ4 A;  4I0U A;  2DR7 A;  4ATB B;  3V7J A;  2W9B B;  3MDA A;  1DGS A;  4DSE A;  4Z6F A;  4EEL A;  5H2F U;  3RB0 A;  5CFU A;  3ICX A;  3C2L A;  5ALJ A;  4DF8 A;  3GIJ A;  4JMU A;  4OJP A;  3WU2 U;  2NV3 A;  4R64 A;  3RH4 A;  5KFG A;  4RQ2 A;  3EWA A;  5KT5 A;  1DK3 A;  3SV3 A;  5EE1 A;  4RPX A;  5KFV A;  2G0A A;  2BPF A;  3BS7 A;  2KE7 A;  4X4U A;  2W03 A;  4X4N A;  1NK6 A;  1S97 A;  1LKY A;  3T5H A;  2ZUB A;  4Z6E A;  2NRK A;  4OO1 J;  4JUZ A;  2ZHA A;  5KFQ A;  3MR5 A;  5AIA A;  4UQG A;  1S10 A;  2BQU A;  3LQC B;  3GQC A;  4PHE A;  3ONN A;  1KEJ A;  2PFO A;  3H7I A;  1Z19 A;  5G5H A;  4YXM A;  3KFU F;  1MQ2 A;  2NYV A;  1ZQA A;  2UVV A;  1N61 A;  1MQ3 A;  4OD0 A;  5KG4 A;  4P0Q A;  1TFY A;  3OJU A;  3SYZ A;  3PSP A;  3BQ7 A;  3AQF A;  2W55 A;  2HHX A;  9ICE A;  3K1R B;  4WC6 A;  4R8U B;  3LDA A;  1N5X A;  4EGW A;  3C5F A;  4RT2 A;  2NO5 A;  4HAI A;  3AL0 B;  4F93 B;  2EDU A;  1XSL A;  3MFI A;  3C66 A;  3UXP A;  1UT8 A;  4M9N A;  1MC8 A;  2P35 A;  4ECQ A;  3JPQ A;  2PFQ A;  3F5A A;  5KFC A;  1L7P A;  4K4H A;  2DR8 A;  5ALL A;  4GC7 A;  5D46 A;  3KTQ A;  4F92 B;  1YZ6 A;  4PHD A;  1ZQD A;  4B9S A;  1MA7 A;  3UMC A;  1HEK A;  1VDV A;  4NXX A;  1PVR A;  4B9L A;  4UAZ A;  3GFK B;  4RWO A;  2GLE A;  4RQ5 A;  4F72 A;  2W8K A;  1WYG A;  2ID1 A;  1D9D A;  4DSK A;  1NZP A;  2HHU A;  4UW9 A;  4IQV A;  3PW5 A;  9ICP A;  5KFT A;  9ICI A;  2HSZ A;  2KFN A;  2ZH6 A;  2WB1 C;  4DFJ A;  1X66 A;  4RQN A;  1ZQT A;  5HRL A;  3PSF A;  5KFM A;  2YB1 A;  3ZDA A;  3S6J A;  4F5P A;  5KG6 A;  3TFR A;  2RRD A;  2JMG A;  4NLG A;  1K1Q A;  4C8K A;  2K8A A;  5KFK A;  4FFD A;  1M6Y A;  2OXO A;  5D49 A;  2HBK A;  5EWG A;  1TFR A;  4O3R A;  8ICF A;  8ICC A;  5J2A A;  1KL9 A;  2QB0 A;  4IRC A;  5D4B A;  4TUS A;  4ED0 A;  2RP5 A;  2ASD A;  5T14 A;  3ETL A;  4DQI A;  2OM6 A;  1COK A;  5D62 A;  1ZQI A;  4MF8 A;  5J2F A;  2KV2 A;  2DL0 A;  5AKK A;  2RHF A;  3CRX A;  4QIW C;  2V4Q A;  3H0R B;  4WC7 A;  2I9G A;  5AKH A;  5DB9 A;  3C2K A;  4C8N A;  1JQR A;  1RXW A;  3F2B A;  2YN4 A;  3TQ1 A;  4PL1 A;  4ED1 A;  4I2J A;  3RJF A;  5EE3 A;  4XUS A;  2A1J A;  4ED3 A;  3ALR A;  8ICK A;  5KTQ A;  3RFA A;  3JPT A;  3MGH A;  3WFP A;  3O0F A;  3TKA A;  4NXU A;  2ZXI A;  3E58 A;  7ICR A;  5HRG A;  2GWS A;  4DL6 A;  3PW4 A;  5ALP A;  5KFH A;  4EX6 A;  2JH1 A;  5HNK A;  3M6Z A;  5KG1 A;  4YR2 A;  4CE6 A;  1ZQE A;  3BQ2 A;  1MIW A;  3RAQ A;  5ALT A;  5DED A;  3ISC A;  4TQR A;  3M9O B;  3M9N B;  1ZQJ A;  2W3S A;  3SR6 A;  4G9B A;  1Y88 A;  2C28 A;  5B66 U;  4ED2 A;  1ZQC A;  9ICJ A;  5L9X A;  3PX4 A;  2G06 A;  4UAW A;  2MSN A;  5KT3 A;  2EQY A;  1CI4 A;  2IMW P;  4MEX A;  4R65 A;  3QU5 A;  1Q3U A;  4UAR A;  5F9N A;  1ZJM A;  3NVV A;  4Z6C A;  4RQ1 A;  1RYS A;  3IG5 A;  3FM9 A;  3GV8 B;  4J9K A;  1KLN A;  3TAP A;  1S0N A;  4C7Z A;  1RPL A;  2M0N A;  1S77 D;  4J9R A;  2E8N A;  4F4X A;  2PBE A;  3UPS A;  1NOM A;  1L6N A;  5HML A;  4RQ8 A;  2HBM A;  5CRX A;  3Q8L A;  4FBU A;  2B6G A;  4ATB A;  1XWL A;  4NLN A;  5KFE A;  1RDF A;  3V6H A;  4DCC A;  1U45 A;  4HX0 A;  4M0A A;  2BDU A;  4EED A;  4RQ4 A;  2KJ8 A;  4K97 A;  3AMZ A;  2BHN A;  2JGA A;  1KSP A;  2AHO B;  5E79 U;  2DKX A;  3TAR A;  1UET A;  4GFJ A;  1X40 A;  2KZ3 A;  4RT3 A;  4EP7 A;  3QYP A;  3JPP A;  2KEY A;  4F3O A;  3GIM A;  2HHV A;  4DSJ A;  3GDX A;  1SGG A;  1QQ6 A;  4C8L A;  4BX9 C;  2XY6 A;  5CB1 A;  3LWM A;  2VAN A;  1ZQR A;  3RJK A;  1XO1 A;  2K4E A;  4YP3 A;  5KL1 B;  1ZQY A;  1OU5 A;  2IOH A;  2K8C B;  1J2M A;  4BUG A;  4DQR A;  2LI6 A;  2Y0S F;  2Y1J A;  5HRI A;  2NRX A;  4BWM A;  4KX5 A;  5IIM A;  3JZ0 A;  3D2N A;  1X9S A;  3QNM A;  2ZIW B;  2OH2 A;  1B22 A;  3PW7 A;  5IIO A;  5KG2 A;  4KLI A;  5J0W A;  4FHY A;  4FHP A;  3B9J A;  4O3S A;  1IXR A;  5KG0 A;  2H3Q A;  2QAR A;  2DRA A;  4FH3 A;  1QTM A;  3D6J A;  2WAQ F;  4LJX A;  4DOB A;  2ESE A;  4UAT A;  8ICR A;  2DBY A;  3M8R A;  5G5G A;  1QQ5 A;  4QJF B;  1KKX A;  3QUC A;  4JLZ A;  4YMN A;  1LKY B;  8ICN A;  3GII A;  4FH5 A;  5KFS A;  2FLP A;  3I76 A;  4FBT A;  5ALD A;  8ICX A;  1COO A;  4M9L A;  1NNL A;  5BPC A;  4M9G A;  4ELT A;  4GIB A;  2K4H A;  4X4T A;  2AQ4 A;  4YMO A;  3NGD A;  3EYZ A;  1N2X A;  4KB6 A;  5DQI A;  5ALF A;  4DO9 A;  2J6S A;  4KTQ A;  5K4L A;  1UQV A;  1J97 A;  3B0Y A;  3HX0 A;  3CNH A;  2KD1 A;  5HRD A;  2YMP A;  9ICS A;  4B9T A;  4RQ0 A;  5J2K A;  4Y2U A;  3L9D A;  3AN1 A;  2D6F C;  5ALV A;  3T79 A;  2HOF A;  1SZH A;  2KTQ A;  1DGJ A;  5J0U A;  1QSL A;  4RQ6 A;  3PHZ A;  3JYY A;  4MKP A;  2EAM A;  3HJE A;  4KMO B;  2JEJ A;  2B51 A;  4A8E A;  4FHW A;  1HUZ A;  2HN1 A;  3QU9 A;  5KFX A;  1ZQK A;  5EE9 A;  3LVV A;  5AK5 A;  8ICT A;  3V6J A;  3MDC A;  3WKB A;  2PKE A;  1R8C A;  1WWV A;  4K9A A;  1A76 A;  3IV6 A;  9ICO A;  3RH6 A;  2F3N A;  5ALU A;  2R8H A;  3N97 B;  3RH5 A;  7ICN A;  2LYB A;  1ZQB A;  1NK0 A;  4BXO A;  2KK0 A;  2ZIX B;  1TKD A;  2KFZ A;  4X4P A;  2E8M A;  5CFS A;  2ASJ A;  4I2B A;  4I28 A;  4OAH A;  3N28 A;  1SXE A;  4EEK A;  1ZQS A;  4Y2S A;  4K96 A;  1P7D A;  1WCN A;  4DL4 A;  1Z00 A;  3QZ8 A;  2ODG A;  2WTF A;  2EAP A;  5KFL A;  5JUM A;  4M2Y A;  1IM4 A;  5DG8 A;  4KLT A;  4JV2 A;  8ICE A;  1TFW A;  7ICV A;  4AYB C;  3N7S C;  3BS5 A;  4P4P A;  2AU0 A;  3KZI U;  2AGO A;  4IL6 U;  7ICM A;  2HMX A;  1J2N A;  3PNC A;  3OVA A;  2QB0 B;  4OCZ A;  4F71 A;  1HUO A;  3SAH A;  2EAO A;  4IQU A;  3BJY A;  4KLG A;  1ZQG A;  4FHV A;  2IHO A;  2JV3 A;  3QXG A;  5KG5 A;  1ZYQ A;  3GU3 A;  4I2H A;  2A1A A;  3ORY A;  7ICS A;  3CK6 A;  3UMB A;  2RLT A;  2A1J B;  2VJ5 A;  5DBC A;  2FI1 A;  2M2V A;  4N7R A;  4FE3 A;  1NK5 A;  5GTI U;  1A77 A;  3SEN A;  3TAD C;  1URJ A;  4ZH4 A;  1NKB A;  2EZX A;  2KKP A;  4KN4 A;  4QZE A;  3CYM A;  4CF5 A;  2OYY A;  5DLF A;  2VA8 A;  4X5V A;  1JI7 A;  5ALY A;  1ED1 A;  5HR7 A;  4CCH A;  1L5U A;  3RR8 A;  5ALK A;  3ED5 A;  1BPB A;  4F4Y A;  4UB4 A;  3ZI4 A;  3K75 D;  2JHD A;  2XCP A;  3IG8 A;  4AT7 A;  3AUO A;  1FFV A;  2RFF A;  4KM5 A;  2FPM A;  2GO7 A;  3FAH A;  4ECU A;  1JAL A;  4F91 B;  5KFJ A;  3OPX A;  1RZT A;  2NO4 A;  4KLS A;  3CP8 A;  4RPZ A;  4C4S A;  1KTQ A;  2XVT A;  1QSY A;  5CA7 A;  1KFD A;  1ZQX A;  4E8F A;  1BPY A;  4NL9 A;  5DLG A;  3SD7 A;  1OXJ A;  7ICP A;  2F77 X;  5JTI A;  4G3I A;  4YR3 A;  3LVW A;  1GPJ A;  5AI5 A;  3RJG A;  1FA0 A;  5DGA A;  4C0Z A;  2VIX A;  2LM1 A;  4TUP A;  2MAX A;  2ZH8 A;  4CRX A;  1KRP A;  1ZD5 A;  5AKZ A;  2XI9 A;  4K4G A;  2ZIW A;  3AU6 A;  1ZQO A;  3SAG A;  1X6I A;  8ICH A;  3HKZ C;  2E5S A;  3M1Y A;  4B9M A;  2CPR A;  4YR0 A;  2J6U A;  1UEU A;  1Z3E B;  8ICM A;  2O1P A;  4E80 A;  1TV9 A;  1BGX T;  3SMV A;  3BZC A;  1FFU A;  2HVI A;  2KHV A;  1MN8 A;  4NLB A;  3MR3 A;  3RTV A;  2DUY A;  1LB2 B;  1IV8 A;  2HI0 A;  4O0I A;  3NRW A;  4Y2T A;  9ICF A;  1U49 A;  1ZOL A;  4ECY A;  2H3F A;  5DBA A;  2QLT A;  1R89 A;  1SV0 A;  3AQL A;  3A0H U;  1SB3 C;  4KIT B;  4IQW A;  1TAQ A;  1NJX A;  3RB6 A;  4IS7 A;  4DF4 A;  3QZ7 A;  2JZB B;  1JX4 A;  4J9N A;  3OV7 A;  2P6R A;  2IUB A;  2OCE A;  3BQ1 A;  2HBJ A;  3KHG A;  4Y2R A;  1UA0 A;  3G6X A;  2BQR A;  2QAR B;  4CNQ A;  1NJY A;  4DL7 A;  1AQ6 A;  2N1R A;  2NRT A;  4PL2 A;  1ZQP A;  5KFZ A;  5IIK A;  3QX7 A;  5DG7 A;  4IR9 A;  1FO4 A;  4O3P A;  3JPS A;  5HR9 A;  4FZM A;  2H5X A;  3MAB A;  1OUQ A;  3AQN A;  5KAF U;  3LK9 A;  2HHT A;  1LVH A;  2GOL A;  1KFS A;  1PX5 A;  2RDI A;  3MC1 A;  1Q78 A;  8ICL A;  3H40 A;  2M2T A;  4QWC A;  3HW8 A;  5KFI A;  3NVY A;  5KFB A;  2ZJ8 A;  2W7O A;  1ZQV A;  4MFC A;  2XC9 A;  4Y2V A;  2ZIX A;  2WB1 F;  9ICL A;  1JXL A;  4M6W A;  1XSN A;  2UVR A;  1T4G A;  1N63 A;  1Z4O A;  3R9K A;  3RF9 A;  1JN3 A;  3KHR A;  1MIV A;  2PMZ C;  4QZH A;  2ZH4 A;  4C8O A;  2BGW A;  3AQE A;  1JRP A;  1NI3 A;  2JXJ A;  3SEI A;  9ICR A;  5HRK A;  4RWP A;  4XRH A;  1BNO A;  4QZC A;  3AEV A;  4C80 A;  3PMN A;  4RNM A;  4QZ8 A;  1NJW A;  3QU2 A;  2R8J A;  4EV6 A;  3E0F A;  1WG8 A;  4QIW F;  2YY6 A;  3FYH A;  4O68 A;  2VJ4 A;  3NVW A;  3GV5 B;  4E7X A;  4DFK A;  2BQ3 A;  2E1F A;  5DG9 A;  5L1J A;  7ICQ A;  4ICA A;  5AK4 A;  4AT9 A;  2HN2 A;  2KJ5 A;  5IIN A;  2CRX A;  4BXO B;  5B5E U;  8ICQ A;  4JWM A;  3MBY A;  1KDH A;  4B6J A;  1MIY A;  5AIB A;  3M9M B;  3UXN A;  2C22 A;  1RXV A;  8ICG A;  2LPE A;  5J0X A;  4QZD A;  3H8J A;  2E3T A;  5F9L A;  4RU9 A;  1RQL A;  3AQM A;  1Z00 B;  1L7M A;  3RB4 A;  3OHA A;  4DSL A;  1C7Y A;  3PST A;  4LEV A;  3C28 A;  4Q45 A;  4LEY A;  5J2G A;  4C7Y A;  4PJ0 U;  3SV4 A;  3LYS A;  9ICT A;  4B9U A;  5HRB A;  4ECV A;  4Y2X A;  3BS5 B;  9ICK A;  5DB7 A;  3WFQ E;  2JEI A;  4BDP A;  2ZH7 A;  2R18 A;  3N7R C;  2ATL A;  2HHS A;  2R8G A;  1BPZ A;  5J2B A;  5JRT A;  2IBK A;  3HJ1 A;  3PZP A;  1JAJ A;  4RQ3 A;  3UQ0 A;  3TAC B;  4IQT A;  2KVS A;  4X0B A;  3RAX A;  4O9M A;  1ZRN A;  1JXE A;  4WBY A;  3NKU A;  1JIH A;  2KN7 A;  1YT3 A;  2KKV A;  2Y9T A;  3GV7 B;  4NJ8 A;  5KFR A;  4EBD A;  4O3Q A;  4DFP A;  1UEV A;  4EX7 A;  4QW9 A;  2PXI A;  1YLQ A;  2CN1 A;  1S8O A;  2GAF D;  2BPG A;  4I2A A;  2WF5 A;  2RQ5 A;  5ALH A;  2HDO A;  1TAU A;  4EZ6 A;  7ICL A;  5DGB A;  1X9X A;  5KFW A;  2NRV A;  4KX3 A;  4WJ3 B;  4F5O A;  1X9M A;  3M6K A;  4QWD A;  3H39 A;  1IIP A;  3MR2 A;  2DWQ A;  3UQ2 A;  4AT7 B;  1F5S A;  5AHX A;  3H4B A;  5CP2 A;  1PZN A;  1KNY A;  1KQQ A;  1MSW D;  1ECW A;  5C0Y A;  4NXV A;  3E2E A;  4M9J A;  1UHU A;  4UBB A;  4US8 A;  3ZD9 A;  3GIL A;  4P4O A;  1X42 A;  4IC9 A;  4NKT A;  4GXJ A;  2W9M A;  3B0X A;  2V4R A;  1JUD A;  3H0M B;  5CR0 A;  8ICI A;  4U6P A;  4ED8 A;  5AK3 A;  2F1J A;  4KLH A;  3C5G A;  2P6U A;  3PML A;  2AQ0 A;  4F50 A;  2F8K A;  5KAI U;  4B9V A;  5DB8 A;  3QUT A;  4K4I A;  3T5K A;  2AH5 A;  4YVZ A;  3BZK A;  2M9N A;  2BPC A;  2JZB A;  1X9W A;  5D63 A;  2H3I A;  3ER8 C;  2G09 A;  1RM6 C;  1WUD A;  2MRL A;  3Q8P B;  1VJ5 A;  4WBZ A;  1H38 A;  2A3V A;  5J8Y C;  1JMS A;  4YD1 A;  4ECZ A;  4DOC A;  4QNL A;  5BOM A;  4MF2 A;  9ICM A;  4Q43 A;  2IA6 A;  2C2D A;  3RRG A;  3T5J A;  1Q46 A;  5IIJ A;  1SIJ A;  3WKA A;  3SQI A;  3OTQ A;  1QQ7 A;  2DQN B;  2K4I A;  9ICH A;  2KVC A;  2JR5 A;  1U48 A;  1OW5 A;  4AP9 A;  5HRE A;  2ALZ A;  4XA5 A;  3Q8K A;  2Y0S C;  1R8B A;  2HVH A;  3ZDD A;  1JRO A;  3HRD D;  3QUQ A;  3PR5 B;  3OSP A;  3C23 A;  2DF4 B;  2AGP A;  5TIS U;  4K8V A;  4RNO A;  3AQK A;  4EBE A;  4P0P B;  3ERC C;  4O5K A;  2MUT B;  5AM1 A;  5AIC A;  4C8M A;  1RYR A;  4X4R A;  3HT3 A;  2PI5 A;  3PO5 A;  2LYA A;  5B3P A;  4QZ9 A;  1U47 A;  1NK9 A;  3NTU A;  3Q8S B;  2YTU A;  2HOI A;  8ICY A;  1VJ7 A;  3UPQ A;  3ZDB A;  5EE0 A;  3OWG A;  8ICP A;  1IG6 A;  4OAF A;  5DQG A;  3M7D A;  4K98 A;  5KT2 A;  1B0X A;  4UB6 U;  5AKX A;  4PGX A;  2DFL A;  4OJL A;  4GLX A;  2QB1 A;  1BNP A;  4QZF A;  3HPO A;  1WOT A;  3UM9 A;  5ALQ A;  4KLE A;  4ED7 A;  2KP7 A;  2ZTC A;  3WK6 A;  3IHQ B;  2E8O A;  2XY7 A;  4NXZ A;  2K89 A;  1VLB A;  1XU4 A;  3KOO A;  3T3F A;  2ZJ5 A;  2ZH2 A;  5HC9 A;  2IOF A;  5KFA A;  3QUB A;  4U7C A;  4J9Q A;  2FPL A;  1NJZ A;  1D9F A;  2VA2 A;  5ALO A;  2A19 A;  4EEN A;  2XO7 A;  5AI4 A;  4DL2 A;  1CUK A;  4O5C A;  2HCF A;  5KT4 A;  4M6W B;  4YCX A;  4DLE A;  5J8Y A;  1UPH A;  2B4V A;  2LM4 A;  3MR6 A;  7ICU A;  2FE9 A;  2XY5 A;  2YMQ A;  5AKL A;  3C29 A;  3Q8R B;  2LMR A;  3F5E A; 
#chains in the Genus database with same CATH homology
 5J2A A;  3RBE A;  4B9M A;  4UD5 A;  1ZQL A;  4YR0 A;  2J6U A;  1UEU A;  5DKW A;  4IRC A;  1WCL A;  3RJI A;  1Z3E B;  5D4B A;  4TUS A;  4ED0 A;  3WFS C;  8ICM A;  2AJQ A;  2B21 A;  2UVW A;  3WFO A;  2O1P A;  2ASD A;  4E80 A;  1TV9 A;  1BGX T;  3ETL A;  4DQI A;  1ZQI A;  4MF8 A;  5J2F A;  2W9C B;  4KMU A;  2HVI A;  5J2C A;  5KFU A;  2V4Q A;  4WC7 A;  4IRK A;  2I9G A;  4J9O A;  5DB9 A;  3C2K A;  3QEB Z;  4C8N A;  4ELV A;  1JQR A;  4UB3 A;  3MR3 A;  3RTV A;  1RXW A;  5TZV A;  3ISD A;  4WC4 A;  3TQ1 A;  1LB2 B;  4ED1 A;  4I2J A;  2OWO A;  4O0I A;  5L1L A;  9ICF A;  1U49 A;  3RJF A;  7ICG A;  4XUS A;  1QSS A;  2A1J A;  4PGQ A;  3Q8Q B;  4ECY A;  4ED3 A;  3PX0 A;  8ICB A;  2ZH3 A;  1XSP A;  5KTQ A;  8ICK A;  3TI0 A;  3JPT A;  3MGH A;  3WFP A;  2ISP A;  5DBA A;  5HRG A;  7ICR A;  2GWS A;  2PFP A;  4KLD A;  1R89 A;  4R8U A;  8ICA A;  4DL6 A;  3OSN A;  1BPX A;  3PW4 A;  4AT9 B;  1K1S A;  3AQL A;  1NO5 A;  4YQW A;  7ICM A;  4KIT B;  5HHI A;  5KFH A;  4ECS A;  1TAQ A;  5IIL A;  4IQW A;  4J9L A;  3RB6 A;  1NJX A;  5HR9 A;  5L1K A;  1QLN A;  5L1I A;  5HNK A;  4DF4 A;  2PI4 A;  3C21 A;  4YMM A;  5KG1 A;  4YR2 A;  4YG2 A;  3QZ7 A;  1ZQE A;  4AT8 B;  3BQ2 A;  2JZB B;  5J0S A;  1MIW A;  3RAQ A;  1JX4 A;  3ISC A;  4TQR A;  3ZD8 A;  3M9O B;  3MGI A;  3EPI A;  4J9N A;  5J0Q A;  1ZQM A;  4ELU A;  3M9N B;  1ZQJ A;  3OV7 A;  4TUR A;  2P6R A;  4F4Z A;  3BQ1 A;  1U4B A;  2FMP A;  1Y88 A;  3KHG A;  3M8S A;  2C28 A;  1UA0 A;  4RWQ A;  4DQQ A;  1ZQN A;  5HHH A;  2W8L A;  1TVA A;  4ED2 A;  2FMS A;  3G6X A;  9ICM A;  2ZHB A;  2BQR A;  1ZQC A;  4M5D A;  9ICJ A;  5L9X A;  3PX4 A;  1ZQF A;  4I2G A;  3HWT A;  1NJY A;  4UAW A;  4DLG A;  2DR5 A;  4JV0 A;  4DL7 A;  4KLM A;  2NRT A;  5KT3 A;  5KG7 A;  3QEA Z;  1X2I A;  5EOZ A;  4FHX A;  1ZQP A;  5KFZ A;  5IIK A;  3PW2 A;  4R65 A;  4MEX A;  5KFO A;  5DG7 A;  2DPI A;  2IMW P;  2BDP A;  5J0P A;  3G6V A;  4IR9 A;  5F9N A;  5J0T A;  4O3P A;  3JPS A;  3Q8M A;  1T8E A;  4NLK A;  4RNN A;  2H5X A;  2M2U A;  3MAB A;  1F5A A;  4QWE A;  4WC1 A;  1ZJM A;  3AQN A;  3LK9 A;  5CJ7 A;  2HHT A;  1KFS A;  4Z6C A;  1PX5 A;  2RDI A;  4PHP A;  9ICV A;  4RQ1 A;  1RYS A;  4UD4 A;  1Q78 A;  8ICL A;  3H40 A;  2M2T A;  4JV1 A;  4QWC A;  3GV8 B;  3HW8 A;  2LYH A;  5KFI A;  2XGP A;  4J9K A;  5KFB A;  1KLN A;  3TAP A;  3TAN A;  1S9F A;  1S0N A;  2R8K A;  1RPL A;  2ZJ8 A;  2KZZ A;  9ICA A;  1S77 D;  1VFG A;  4J9R A;  1ZQV A;  4F4X A;  4UB2 A;  1TK0 A;  2JEF A;  4MFC A;  3SI8 A;  2XC9 A;  3GIK A;  2PBE A;  1NOM A;  3UPS A;  5HML A;  7ICO A;  4RQ8 A;  9ICL A;  1JXL A;  4M6W A;  4DQS A;  2PFN A;  1T7P A;  1XSN A;  2UVR A;  4KLF A;  7ICK A;  9ICB A;  4WC5 A;  1ARO P;  1T4G A;  3Q8L A;  4FBU A;  1BPE A;  9ICC A;  2RFF A;  5J29 A;  2BKE A;  4P2H A;  4ATB A;  7ICH A;  4DWI A;  2ASL A;  1XWL A;  5J2I A;  1JN3 A;  3KHR A;  4NLN A;  3C18 A;  1CEZ A;  5DBB A;  5KFE A;  1LV5 A;  9ICW A;  1MIV A;  2BE3 A;  4QZG A;  2IHN A;  4QZH A;  5KFY A;  2ZH4 A;  3V6H A;  4C8O A;  4I2F A;  1U45 A;  2BGW A;  4DS4 A;  4KLL A;  4M0A A;  4M04 A;  4WC2 A;  3FDS A;  9ICR A;  5HRK A;  1KFT A;  3SZ2 A;  4RZR A;  4RWP A;  5DB6 A;  4XRH A;  4RQ4 A;  1ZET A;  5KT7 A;  2DPJ A;  2BCQ A;  7ICF A;  1BNO A;  4QZC A;  4NKU A;  2BR0 A;  5J0O A;  3PMN A;  5J2J A;  2BHN A;  4DS5 A;  2AGQ A;  1KSP A;  1L3S A;  4RNM A;  5CWR A;  7ICT A;  4QZ8 A;  3TAR A;  1NJW A;  1UET A;  2KZ3 A;  4RT3 A;  4EP7 A;  3RBD A;  3JPP A;  4F3O A;  1EXN A;  2R8J A;  3OHB A;  3GIM A;  3EPG A;  3OGU A;  2HHV A;  4X4O A;  4DSJ A;  4F5N A;  3GDX A;  1NK8 A;  4DSI A;  3FYH A;  4C8L A;  4J9M A;  3GV5 B;  4E7X A;  2XY6 A;  9ICN A;  4TQS A;  4DFK A;  4O3N A;  5CB1 A;  2BQ3 A;  5DG9 A;  5L1J A;  7ICQ A;  3LWM A;  2VAN A;  3UXO A;  4ECR A;  1ZQR A;  4X4S A;  3RJK A;  1XO1 A;  4YP3 A;  3OVS A;  4ED6 A;  4RWN A;  4RQ7 A;  1ZQY A;  5KT6 A;  4AT9 A;  1OU5 A;  2VA3 A;  4EBJ A;  1DK2 A;  4DQR A;  2Y1J A;  2ZUD A;  4UAY A;  5HRI A;  3C1Z A;  5KFN A;  4PH5 A;  4BXO B;  5IIN A;  4MFF A;  2XGQ A;  2NRX A;  4BWM A;  4F5Q A;  5IIM A;  8ICQ A;  3JZ0 A;  4JWM A;  4I2C A;  3MBY A;  3EZ5 A;  1KDH A;  5EWE A;  4Q44 A;  1X9S A;  3M9M B;  1L3V A;  4F2S A;  3V7K A;  4Q8F A;  3UXN A;  1MIY A;  2MUT A;  4PHA A;  3PW7 A;  2C22 A;  1RXV A;  5IIO A;  1L3T A;  2JEG A;  5KG2 A;  3ZDE A;  3BDP A;  3RR7 A;  4KLI A;  3TFS A;  5J0W A;  5J0X A;  4QZD A;  4JK1 A;  4TUQ A;  4KLO A;  8ICG A;  3H8J A;  4MEY A;  4FHY A;  4EBK A;  5F9L A;  4FHP A;  4RU9 A;  1SKW A;  3NYB A;  1B22 A;  1SL0 A;  3AQM A;  1Z00 B;  4QZB A;  4EYI B;  3ZDC A;  4O3S A;  2FLN A;  2W9A A;  4DQP A;  1IXR A;  1SKR A;  4Z6D A;  5HP4 A;  3RB4 A;  3OHA A;  4DSL A;  5KG0 A;  1C7Y A;  4J9S A;  3C1Y A;  3TAQ A;  2DRA A;  4LT6 A;  3QE9 Y;  4FH3 A;  4NM2 A;  1QTM A;  4Q45 A;  1D8L A;  1BVS A;  5J2G A;  4F2R A;  2HW3 A;  4AT8 A;  4DOB A;  1ZQH A;  3SV4 A;  4R63 A;  8ICR A;  3M8R A;  3PW0 A;  3PY8 A;  9ICT A;  2Q66 A;  4B9U A;  5HRB A;  4ECV A;  4IRD A;  2BCS A;  4JWN A;  9ICK A;  3WFR E;  2Q0Z X;  5DB7 A;  3BQT A;  2ZTE A;  5J0R A;  4YMN A;  3C2M A;  1S0O A;  2JEI A;  3WFQ E;  4WC0 A;  4BDP A;  4QWB A;  2M2W A;  2ZH7 A;  2BCU A;  8ICN A;  3GII A;  4FH5 A;  5KFS A;  2ATL A;  2HHS A;  1Q79 A;  2R8G A;  2ZJA A;  1S0V A;  1BPZ A;  2FLP A;  5J2B A;  3HP6 A;  4FBT A;  2IBK A;  3THV A;  3HJ1 A;  1JAJ A;  8ICX A;  1COO A;  4RQ3 A;  3MFH A;  3UQ0 A;  1NK7 A;  4M9L A;  8ICV A;  1TK8 A;  2UVU A;  1R8A A;  4IQT A;  5BPC A;  9ICX A;  2I1Q A;  4RUC A;  4QZI A;  4ELT A;  4M9G A;  4X0B A;  4X4T A;  3RAX A;  2AQ4 A;  4DEZ A;  5J0Y A;  1DOQ A;  1N48 A;  2J6T A;  4YMO A;  3NGD A;  3EYZ A;  4O9M A;  2O5A A;  1JXE A;  4UB1 A;  5DQI A;  3PR4 A;  4DO9 A;  4WBY A;  2J6S A;  4DL5 A;  4DFM A;  2ZH5 A;  1XS9 D;  2ZH9 A;  4J9P A;  4KTQ A;  1JIH A;  4FS2 A;  2KN7 A;  2FMQ A;  7ICJ A;  2NRZ A;  3B0Y A;  3HX0 A;  3HIY A;  4R66 A;  9ICU A;  1ZQZ A;  3GV7 B;  3PO4 A;  5KFR A;  5HRD A;  4EBD A;  9ICS A;  4EYH B;  1ZQW A;  4O3O A;  4B9T A;  5DDM A;  4RQ0 A;  4O3Q A;  7ICE A;  4DFP A;  5J2K A;  8ICS A;  1UEV A;  3L9D A;  4QW9 A;  4HYK A;  2PXI A;  5J2E A;  2ZTD A;  2BCV A;  4I27 A;  1YLQ A;  4LZG A;  5CHG A;  2F1I A;  4O3R A;  3PVX A;  4I2I A;  1NKE A;  4P4M A;  2BPG A;  1V4A A;  8ICJ A;  4I2A A;  1TK5 A;  2KTQ A;  3JPN A;  4DOA A;  4YN4 A;  1N56 A;  4MFA A;  5J0U A;  1QSL A;  4EZ6 A;  2C2E A;  4KLQ A;  1TAU A;  4RQ6 A;  7ICL A;  4IG8 A;  4EEY A;  3JYY A;  5DGB A;  5KFW A;  4QWA A;  1BPD A;  2NRV A;  5KG3 A;  3G6Y A;  5C5J A;  4F5O A;  3H8W A;  4DSF A;  1X9M A;  2JEJ A;  4M47 A;  5HRH A;  4FHW A;  2R8I A;  1HUZ A;  4QWD A;  4WC3 A;  2RDJ A;  5KFF A;  1U9L A;  3H39 A;  3PV8 A;  5KFX A;  4O5E A;  4S3N A;  3MR2 A;  1ZQK A;  4PGY A;  3UQ2 A;  5EWF A;  1V9P A;  1UT5 A;  4AT7 B;  5F2V O;  8ICT A;  3V6J A;  4NLZ A;  3H4B A;  3OJS A;  2W9C A;  5CP2 A;  1SL2 A;  4UBC A;  1PZN A;  3JPR A;  3MDC A;  1KNY A;  1MSW D;  1R8C A;  3OVB A;  1A76 A;  2NRW A;  3OUY B;  1NKC A;  9ICO A;  3RH6 A;  4E0D A;  4M9J A;  3E2E A;  2ZH1 A;  3H4D A;  3BQ0 A;  4YFK A;  2V9W A;  2R8H A;  4UBB A;  3N97 B;  3RH5 A;  7ICN A;  3ZD9 A;  3GIL A;  4P4O A;  1ZQB A;  1NK0 A;  4BXO A;  1TKD A;  2IHM A;  4IR1 A;  2KFZ A;  4NKT A;  4X4P A;  4KLJ A;  4GXJ A;  4I2D A;  2W9M A;  3B0X A;  2V4R A;  3V6K A;  5CR0 A;  4FS1 A;  3N4M B;  1ZJN A;  2ZUC A;  2ASJ A;  4ED8 A;  4I2B A;  4I28 A;  8ICI A;  2F1J A;  2C2R A;  3RJE A;  4KLH A;  4PPX A;  4XQ7 A;  5DQH A;  3C5G A;  1S76 D;  4BWJ A;  7ICI A;  3HJ4 A;  2DR7 A;  1ZQS A;  2P6U A;  4ATB B;  3PML A;  2AQ0 A;  3V7J A;  2W9B B;  4F50 A;  1WCN A;  3MDA A;  1DGS A;  9ICQ A;  4DSE A;  4Z6F A;  4DL4 A;  3RB0 A;  1Z00 A;  3C2L A;  4B9V A;  4I29 A;  2DR9 A;  5DB8 A;  3QZ8 A;  4DF8 A;  3GIJ A;  3T5K A;  4K4I A;  9ICG A;  4NY8 A;  4YVZ A;  2WTF A;  4GXI A;  2M9N A;  2BPC A;  5KFL A;  5JUM A;  5BOL A;  4M2Y A;  2JZB A;  1IM4 A;  5DG8 A;  4R64 A;  4ECT A;  3RH4 A;  4RPY A;  1X9W A;  5KFG A;  4RQ2 A;  4ECX A;  4JV2 A;  4KLT A;  3EWA A;  3ISB A;  3K4G A;  1XC9 A;  3KHH A;  5KT5 A;  8ICE A;  7ICV A;  1TFW A;  1DK3 A;  3SV3 A;  3LWL A;  2BCR A;  4RPX A;  5KFV A;  4P4P A;  3Q8P B;  2AU0 A;  2AGO A;  2BPF A;  4WBZ A;  4X4U A;  1H38 A;  4X4N A;  1NK6 A;  1JMS A;  4YD1 A;  2XCA A;  4ECZ A;  1S97 A;  4DOC A;  5BOM A;  4EBC A;  3T5H A;  2ZUB A;  3PNC A;  4Q43 A;  4Z6E A;  2C2D A;  2IA6 A;  3RRG A;  4MF2 A;  3T5J A;  2NRK A;  2F1H A;  5IIJ A;  3H8S A;  1HUO A;  1HJP A;  4JUZ A;  4BGD A;  4F8R A;  2ZHA A;  5KFQ A;  3MR5 A;  5HMM A;  9ICH A;  8ICO A;  1U48 A;  3OVA A;  4UQG A;  1S10 A;  2P66 A;  4B9N A;  5HRF A;  2BQU A;  5HRE A;  2ALZ A;  3LQC B;  4XA5 A;  4IQU A;  3BJY A;  3GQC A;  2Y1I A;  3Q8K A;  4KLG A;  4PHE A;  1ZQG A;  2HVH A;  3IM1 A;  1R8B A;  5DEC A;  3JPO A;  3ZDD A;  1KEJ A;  2PFO A;  1ZQU A;  3H7I A;  3PR5 B;  4FHV A;  5KG5 A;  3OSP A;  4YXM A;  1ZYQ A;  3C23 A;  1MQ2 A;  2DVI A;  1S0M A;  2AGP A;  4Q8E A;  4I2H A;  4X4Q A;  4YXJ A;  3ORY A;  1ZQA A;  2UVV A;  7ICS A;  3AU2 A;  1B43 A;  5J2H A;  1MQ3 A;  3H38 A;  4RNO A;  4WCW A;  5KG4 A;  1TFY A;  3OJU A;  3V72 A;  4EBE A;  3AQK A;  2A1J B;  5DBC A;  3SYZ A;  4O5K A;  2MUT B;  3EW9 A;  3T5L A;  2M2V A;  2HHX A;  9ICE A;  2HHW A;  2FLL A;  4C8M A;  1NK5 A;  4M9H A;  1RYR A;  4X4R A;  3HT3 A;  2PI5 A;  4UB5 A;  1A77 A;  3PO5 A;  4WC6 A;  4R8U B;  2HHP A;  3LDA A;  4DL3 A;  3H37 A;  3KHL A;  4F4K A;  1L3U A;  4QZ9 A;  4KN7 A;  4QZA A;  4ZH4 A;  3C5F A;  1NKB A;  1U47 A;  4RT2 A;  4KN4 A;  1NK9 A;  2ISO A;  4QZE A;  3NTU A;  3Q8S B;  4QW8 A;  5III A;  4F93 B;  1XSL A;  5DLF A;  2VA8 A;  4X5V A;  3MFI A;  3C66 A;  3UXP A;  1UT8 A;  4CCH A;  1L5U A;  4M9N A;  1SZP A;  8ICY A;  3RR8 A;  1MC8 A;  1VJ7 A;  3UPQ A;  3ZDB A;  4ECQ A;  4LZD A;  3JPQ A;  1UA1 A;  2PFQ A;  8ICP A;  4KLU A;  4F4W A;  4NM1 A;  5KFC A;  4RUA A;  8ICZ A;  1BPB A;  4F4Y A;  4GC6 A;  4UB4 A;  5DQG A;  4K4H A;  2DR8 A;  5KT2 A;  5D46 A;  3K75 D;  4GC7 A;  3KTQ A;  3RJJ A;  2XCP A;  4F92 B;  3PX6 A;  4AT7 A;  4PGX A;  3AUO A;  2DFL A;  4GXK A;  4GLX A;  4FO6 A;  1SL1 A;  2FPM A;  5KFP A;  4PHD A;  1ZQD A;  1D8Y A;  4B9S A;  1BNP A;  4QZF A;  4ECU A;  4F91 B;  5KFJ A;  1RZT A;  3HPO A;  5J2D A;  3RJH A;  4KLS A;  2KZM A;  4KLE A;  1WOT A;  3OUY A;  4RPZ A;  4ED7 A;  4B9L A;  1KTQ A;  4UAZ A;  2FPK A;  2ZTC A;  1QSY A;  2KP7 A;  3GFK B;  3IHQ B;  5CA7 A;  2XY7 A;  4NXZ A;  4RWO A;  4RQ5 A;  5KFD A;  5DED A;  3V7L A;  1ZQX A;  1KFD A;  2W8K A;  4F5R A;  1ZQQ A;  1XU4 A;  2ID1 A;  1BPY A;  1D9D A;  4E8F A;  5DLG A;  4I2E A;  3T3F A;  2ZJ5 A;  4DSK A;  2ZH2 A;  2HHU A;  1SKS A;  1NZP A;  5HC9 A;  4IQV A;  7ICP A;  5KFA A;  4ECW A;  3PW5 A;  4J9Q A;  2FPL A;  1NJZ A;  4EZ9 A;  1D9F A;  4LVS A;  2VA2 A;  5KFT A;  9ICP A;  4G3I A;  8ICU A;  9ICI A;  2ZH6 A;  2W9B A;  2KFN A;  4YR3 A;  4DFJ A;  3RRH A;  2HHQ A;  2XO7 A;  1ZQT A;  5HRL A;  4DL2 A;  4X4V A;  5KFM A;  4X0A A;  3RJG A;  1FA0 A;  1CUK A;  5DGA A;  2DRB A;  4TUP A;  3ZDA A;  4O5C A;  3H3A A;  2MAX A;  5DDY A;  5KT4 A;  4F5P A;  5KG6 A;  2ZH8 A;  1KRP A;  4M6W B;  4YCX A;  3TFR A;  4XQ8 A;  4K4G A;  4DLE A;  4NLG A;  1K1Q A;  3AU6 A;  5KFK A;  4C8K A;  3MR6 A;  7ICU A;  2XY5 A;  1ZQO A;  3RB3 A;  1T3N A;  4YD2 A;  1NK4 A;  3Q8R B;  5D49 A;  8ICH A;  8ICW A;  5EWG A;  1TFR A;  8ICF A;  8ICC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...