4M9HA

Dna polymerase beta e295k soaked with dttp
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
324
structure length
314
Chain Sequence
LNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINKYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The E295K Cancer Variant of Human Polymerase beta Favors the Mismatch Conformational Pathway during Nucleotide Selection.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
molecule keywords DNA polymerase beta
total genus 98
structure length 314
sequence length 324
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4m9hA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4m9hA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4m9hA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4m9hA03
4I2JA 5EWEA 1NK0A 2IHNA 1NK5A 3EYZA 4KN4A 1WCLA 4FHXA 4ED6A 4YXMA 4MFCA 2ZH7A 1KSPA 1V9PA 1S9FA 3ZD9A 4X0AA 1QSSA 2DRBA 4QZAA 4LZGA 3HT3A 4WC4A 4ELTA 2AQ4A 1MQ2A 4WBYA 4XRHA 2HHVA 4R66A 4K4HA 4Q8EA 4BXOA 3MDCA 3LQCB 3TFSA 4ATBA 9ICXA 3ZDEA 1UT8A 4RT2A 4I27A 2ZHAA 9ICHA 3RJGA 7ICGA 3H8WA 4Q45A 3Q8KA 2P6UA 3V72A 5HR9A 9ICRA 5BOMA 5CA7A 4Q44A 4ECWA 3RBEA 1TK0A 4JWMA 2HVIA 4UD5A 2PFNA 2RFFA 1TAQA 4TURA 2ASDA 4KLOA 2UVWA 5L1KA 4AT9B 2P66A 1U9LA 1KFDA 2PI5A 3BQ1A 2DR9A 3BQ0A 1ZQEA 2W9CB 1ZQHA 2FMSA 2KZZA 4PH5A 3SI8A 9ICUA 4EBKA 1LB2B 4NLZA 4UQGA 2XY5A 1UT5A 7ICTA 2ZH3A 1DOQA 4ZH4A 2NRWA 1KLNA 4EYIB 4RNNA 2ZUCA 4F93B 3G6YA 2AQ0A 2W9MA 3ZDBA 5HC9A 8ICTA 2KN7A 3V7LA 1RXWA 4I2CA 1ZQIA 2R8GA 1D9DA 4M47A 4UD4A 3T5LA 4YXJA 2FLPA 2R8HA 4C8KA 4KLDA 4M9LA 4QZIA 3AQLA 4KMUA 1XSNA 4F5OA 3M8SA 4KLQA 8ICOA 3HJ1A 2FMQA 3UQ0A 3HPOA 2AGOA 1ZQRA 1IXRA 5KFUA 2FLNA 2VA3A 4EBDA 3Q8SB 2BQRA 3ETLA 8ICNA 4RWQA 1XSLA 5J2KA 1X2IA 5KFCA 3TAQA 1JX4A 1MIYA 4RQ1A 4DQSA 4KITB 2NRZA 1B43A 2LYHA 2XGPA 3V6HA 1SL0A 1QTMA 1UEUA 2ISOA 1S0NA 8ICXA 1TFWA 3MDAA 2ZH1A 2AGPA 8ICLA 3C66A 9ICPA 2PI4A 4QZ8A 5JUMA 3MFHA 2W8KA 3C2MA 1DK3A 4Z6DA 4TQSA 4ED7A 2IBKA 4R65A 2FLLA 5L1IA 3C21A 5KFLA 3C2KA 1NKEA 9ICAA 8ICZA 8ICGA 9ICIA 1BNOA 3H37A 4DL5A 4MEYA 5L1JA 2AJQA 4Z6FA 3OHBA 5D46A 5DDYA 4RU9A 4RPXA 3GIJA 1KFSA 8ICQA 4J9NA 3ZDCA 4ATBB 5DG9A 3TFRA 2DPJA 1MQ3A 4PHAA 4O5CA 1WOTA 3KHGA 3RB6A 3GV5B 4O3PA 1D8YA 1TV9A 4DOAA 2BCVA 3MR3A 3Q8PB 3GIKA 1CEZA 1QSLA 3OSPA 3OVSA 2PFQA 1S0VA 2W9BA 3H4DA 4RUAA 5J0YA 4J9KA 2J6SA 5HRIA 3AQNA 4PHDA 4X4OA 1T8EA 3OUYA 3NGDA 3BDPA 4F4YA 5KFOA 4FHPA 4NLNA 2ZH2A 3H8JA 4C8OA 3SV4A 5KFHA 4O3QA 5DG8A 4DO9A 4DFPA 1ZJNA 2ZH4A 4DQRA 1Z00A 4YN4A 1Z00B 8ICJA 3UXNA 1BPXA 3RTVA 3RB3A 2V9WA 9ICVA 1PX5A 2M9NA 5KFPA 4R64A 4JV0A 4FS2A 2C22A 5HNKA 4JV2A 3NYBA 3OGUA 4WBZA 4F4WA 5L1LA 9ICGA 2ISPA 4M0AA 4HYKA 3PR4A 5KFWA 2IHMA 2HHWA 4O3OA 5KFAA 1L3SA 4X4UA 2XC9A 5KFQA 3K4GA 3BQ2A 4J9SA 3V6JA 3L9DA 4M9JA 4XUSA 1QLNA 1L5UA 4XQ8A 4R8UA 1ZJMA 2BE3A 3PW7A 3GIIA 1ZQAA 5DG7A 3ZD8A 2PFPA 4F92B 2BPFA 1SZPA 4QWEA 3QE9Y 3M9OB 2R8IA 1HUZA 2KZMA 8ICKA 3N4MB 3ZDAA 1JAJA 2NRKA 4EBCA 4NKTA 4KLTA 3RH5A 5HREA 4RT3A 5KFVA 4M9GA 4RWPA 1CUKA 2FPKA 2Q0ZX 1TK8A 5KG1A 5EWFA 4EEYA 5DB6A 2A1JB 5IIMA 3UXPA 3WFOA 2ASJA 4RQ5A 4C8NA 1ZQXA 5DEDA 3B0XA 4WCWA 4FH5A 2M2TA 8ICPA 1B22A 4QZEA 7ICLA 2ZTEA 2NRVA 1S97A 4IR1A 4ECYA 1K1QA 2Y1JA 3AQKA 2HHSA 3OHAA 3N97B 2AU0A 4DOCA 1TAUA 4KLGA 4KLMA 4IQVA 4DS5A 8ICAA 1R8CA 2UVRA 5KFBA 4LVSA 5EWGA 1MC8A 1ZQOA 2IMWP 5J2DA 5CWRA 3ISBA 2ATLA 2JEFA 2UVVA 2ID1A 4RPZA 3RBDA 2DR7A 1KTQA 3UXOA 3OSNA 4PGYA 4IQUA 4R8UB 4QZBA 2XCAA 1JMSA 5DB8A 3RAXA 1ZQGA 1R8BA 4NKUA 3PO4A 7ICJA 3AU2A 1DGSA 3MFIA 2XY7A 9ICLA 3AQMA 4DSJA 8ICUA 4WC2A 3Q8MA 5DB7A 3MGIA 2O1PA 3MR2A 4DSEA 4EYHB 4Z6EA 4KLUA 4MF8A 1NK6A 4QZDA 3Q8QB 4X4PA 4RQ3A 2BCRA 4G3IA 4P2HA 3ORYA 9ICTA 4X5VA 4RNMA 4BGDA 4E8FA 3E2EA 5J0XA 4QWCA 2ZUBA 1T7PA 5DDMA 1Q78A 2AGQA 1R8AA 1NO5A 3HP6A 4I2FA 7ICRA 2H5XA 3ISCA 5KG7A 4IG8A 3IM1A 4DL4A 1BPZA 2Y1IA 1ZQCA 4ELVA 4DSFA 4YG2A 1PZNA 3GIMA 4M9HA 1YLQA 2W9BB 1AROP 5DGAA 1L3VA 4IRKA 3TQ1A 1U45A 7ICNA 4YFKA 1XU4A 1TFRA 5C5JA 3JPTA 1U49A 2O5AA 4AT7B 5HP4A 3QEAZ 4X4TA 1COOA 4I2BA 4M6WA 4RQ6A 2UVUA 5J0WA 4C8LA 5IINA 3QZ8A 2I9GA 8ICBA 4FHWA 1JN3A 2JZBB 3HW8A 4NLKA 2BQ3A 5KFTA 4QZFA 4B9MA 7ICHA 1KRPA 1X9MA 3TAPA 4TUPA 5HRFA 2JZBA 4P4PA 1SKSA 2J6TA 1EXNA 2ZH5A 5CJ7A 3EPGA 3JPPA 2HHPA 1JXEA 1H38A 5DQGA 3C1ZA 3H38A 4O5KA 2JEGA 4J9QA 4X4SA 3PNCA 3JPQA 1NOMA 1U4BA 1RXVA 1HUOA 4O3SA 2M2WA 4ED1A 1RYRA 5KT2A 4F4ZA 3EZ5A 5HRKA 2KP7A 4X4QA 1ZQQA 4DSLA 5D49A 4DL2A 2ZH8A 2BCSA 3M9MB 4IQWA 5KFEA 9ICCA 5CB1A 5DB9A 2FPMA 4J9OA 5IILA 1S76D 4TUSA 2XCPA 2DR8A 4ECQA 7ICKA 5J2HA 4B9UA 4UB2A 4Q43A 7ICOA 4O0IA 4LT6A 5IIIA 2ZJAA 4RQ4A 2HHTA 2HVHA 3MABA 5DKWA 3JPNA 4EBEA 1S0OA 4RQ8A 4RZRA 3Q8RB 4ECTA 4KLJA 4WC5A 5CHGA 9ICOA 5HRBA 1NK4A 1BPYA 1ZQMA 1ZETA 2M2VA 1MIWA 3C2LA 3PVXA 3H4BA 1ZQBA 1QSYA 4ECXA 1BPDA 4DLGA 4KN7A 5F9NA 4J9MA 1BGXT 4O9MA 1BPBA 1RPLA 1NJXA 5HMLA 7ICFA 2XY6A 2DPIA 3GFKB 5KT4A 1VJ7A 3RRGA 3SV3A 5J0TA 3PW5A 1SKRA 8ICYA 3TARA 4RQ7A 4QWBA 2BHNA 5IIKA 3GV7B 4B9SA 4S3NA 3OVAA 5KFKA 2W8LA 4Q8FA 1MIVA 3HWTA 1SL2A 3NTUA 4NM2A 3LWMA 3C5GA 3V7JA 2Q66A 4XA5A 2VA8A 3MGHA 3GILA 4ED3A 2C2RA 2JEJA 4RQ2A 5J0SA 3ISDA 2DFLA 4KLLA 5J29A 5KFMA 1XO1A 5J0QA 1NJWA 3H40A 4F3OA 4I29A 4M2YA 1NZPA 2R8KA 4WC0A 1TKDA 5BPCA 3BQTA 4PGXA 3JPRA 5KFDA 5J0PA 5KG6A 4YR2A 4ECVA 4M5DA 1D9FA 1ZYQA 1L3UA 3MBYA 1U48A 1ZQNA 1R89A 3UPSA 5J2CA 4X0BA 1T3NA 4I2GA 1UA1A 1XC9A 1SKWA 3WFQE 4JUZA 5J2IA 1ZQLA 2I1QA 1SL1A 1ZQUA 4ELUA 2MUTB 4F50A 2A1JA 3QZ7A 5KTQA 4E80A 1S10A 4B9NA 3LWLA 1Z3EB 5J2BA 3OV7A 1XSPA 2DRAA 1BVSA 1TVAA 5HRLA 4YMMA 8ICMA 2RDJA 1Q79A 5KFYA 5KT7A 4J9PA 4GXKA 3LDAA 4PHPA 2V4RA 1X9SA 5J2JA 5DLFA 8ICCA 1UEVA 5KFSA 5KG0A 2DR5A 5KFIA 5J0RA 4I2IA 4PGQA 3M8RA 2B21A 4DL6A 4ECZA 3EWAA 4I2AA 4ECSA 3OJUA 4P4MA 1ZQKA 4YQWA 1LV5A 1KNYA 2V4QA 2HHUA 4X4NA 4NY8A 2PXIA 2OWOA 5KFGA 5DBBA 4UAWA 1NKBA 1JXLA 9ICKA 2ZJ8A 5HRHA 1ZQVA 8ICFA 4NXZA 4UB1A 5HMMA 3EPIA 4M6WB 4F5RA 5CP2A 2BPCA 4JK1A 5KFFA 3PW0A 3KHRA 9ICQA 2PBEA 1S0MA 3HX0A 5J2AA 1NJYA 7ICUA 1NK8A 3JZ0A 5KFNA 4DFKA 4YMOA 3TI0A 3QEBZ 2BPGA 3AUOA 4M04A 1S77D 3V7KA 4FHVA 3Q8LA 1FA0A 2J6UA 2GWSA 5J0OA 8ICIA 2W9CA 1ZQYA 4FS1A 3PW2A 4O3NA 4YCXA 4IR9A 4R63A 4CCHA 2F1JA 4E0DA 1XWLA 5DBAA 4C8MA 5J2GA 4ED0A 4MF2A 1NK9A 4DWIA 2ASLA 3RRHA 2PFOA 2M2UA 2ZTCA 4JV1A 5HRDA 4DQPA 4RWNA 2F1HA 1OU5A 4UB4A 4WC6A 2MAXA 3WFRE 4F91B 4QZCA 3MR6A 4P4OA 4X4RA 1ZQPA 7ICIA 2FPLA 9ICBA 3PX0A 9ICEA 5KFJA 2DVIA 4KLHA 1K1SA 4M9NA 8ICWA 2HW3A 1N56A 1XS9D 9ICNA 4ECRA 4F5QA 3MR5A 5D4BA 1WCNA 3UQ2A 1UA0A 4WC7A 5HRGA 9ICJA 1DK2A 5KFRA 5J0UA 4QWDA 1TK5A 3GQCA 5DQIA 1ZQSA 3ZDDA 5KG2A 2BKEA 2HHXA 2ALZA 2HHQA 3BJYA 5DECA 4F2SA 2IA6A 1ZQFA 5DBCA 4RUCA 2VA2A 3OJSA 1JIHA 1T4GA 3C23A 4UBBA 3H3AA 2XO7A 3B0YA 4UB5A 1KDHA 5KG4A 1ZQDA 4YVZA 1NKCA 3RJHA 4QZHA 4AT9A 4DFJA 4I2DA 4E7XA 2BGWA 3PR5B 4RWOA 2ZHBA 3JPSA 4DL7A 3KHHA 9ICMA 1NK7A 3UPQA 4GC7A 8ICEA 3PMNA 4GC6A 2VANA 2ZUDA 1A77A 1ZQWA 1Y88A 5DLGA 3RH4A 4RNOA 5CR0A 4EP7A 4FBTA 2ZH6A 1BPEA 4I28A 4O5EA 4MFAA 2KFNA 7ICMA 4GLXA 4RQ0A 2C28A 5HHHA 2ZTDA 3RJEA 1RZTA 2KFZA 4BWJA 4ED8A 4I2EA 2KTQA 1BNPA 5F9LA 3SZ2A 4YP3A 4WC1A 5L9XA 3AU6A 2WTFA 4JWNA 3RJIA 2BCQA 5KT6A 9ICSA 4FO6A 3WFPA 5KG3A 4UBCA 3SYZA 8ICVA 3RR8A 3EW9A 4BWMA 2ZJ5A 4F4KA 2BR0A 5KFZA 8ICHA 3TANA 3V6KA 1RYSA 2W9AA 4UAYA 4ED2A 3KHLA 8ICRA 4K4IA 3OVBA 3RJJA 4FBUA 3PW4A 4BDPA 4EZ9A 4DS4A 4K4GA 7ICVA 5DQHA 2NRXA 4TUQA 3M9NB 4DOBA 7ICSA 4BXOB 5KT5A 2C2DA 3HIYA 4UAZA 5IIOA 4DL3A 4TQRA 1ZQZA 3RB0A 4AT8A 5J2FA 4AT8B 4PHEA 2RDIA 4MEXA 3HJ4A 4J9RA 3OUYB 4DQIA 4AT7A 4LZDA 5KG5A 3PO5A 4DSKA 4Z6CA 3JYYA 3GDXA 4EBJA 3PX6A 3G6XA 3RJFA 1KEJA 4J9LA 1NJZA 4F8RA 1VFGA 4X4VA 4IQTA 4YD2A 4KTQA 3THVA 4O3RA 2XGQA 1U47A 4DF8A 4QW8A 4KLFA 4DLEA 4IRDA 2F1IA 4QZ9A 3RR7A 1N48A 4B9TA 4DSIA 1V4AA 2BQUA 1L3TA 9ICFA 4YD1A 7ICPA 3PMLA 3JPOA 2KZ3A 1D8LA 7ICEA 3C18A 3RH6A 4WC3A 2BDPA 3IHQB 2FMPA 4B9LA 2NRTA 4F5PA 3FDSA 4YMNA 1X9WA 7ICQA 4PPXA 1IM4A 3KTQA 9ICWA 4QW9A 4QWAA 5J2EA 3GV8B 2BCUA 3RJKA 1ZQJA 4B9VA 1JQRA 4MFFA 2R8JA 3PV8A 4IRCA 5DGBA 3PX4A 2ZH9A 4UB3A 4EZ6A 1HJPA 4YR3A 1MSWD 1KFTA 4NM1A 5HHIA 3LK9A 3C5FA 3T5KA 4DFMA 1ZQTA 4I2HA 4NLGA 1F5AA 4QZGA 5TZVA 4DQQA 3K75D 5KFXA 4YR0A 4DF4A 4XQ7A 3WFSC 5KT3A 1UETA 3PY8A 5EOZA 3H7IA 2JEIA 3G6VA 3T3FA 4KLIA 4ECUA 4KLSA 5BOLA 4F4XA 3H39A 4GXJA 3RAQA 5F2VO 3H8SA 2C2EA 1TFYA 8ICSA 4KLEA 3C1YA 4RPYA 3T5JA 3RB4A 2P6RA 4DEZA 4FHYA 4F2RA 3FYHA 4F5NA 5IIJA 3T5HA 4FH3A 1A76A 4GXIA 1C7YA 2MUTA
chains in the Genus database with same CATH superfamily
1NK0A 2IHNA 4ED6A 2DRBA 3NVVA 4X0AA 1QSSA 4QZAA 2AQ4A 2HHVA 4R66A 4Q8EA 4LEYA 4RT2A 4I27A 4AYBC 7ICGA 3Q8KA 2EAPA 1KL9A 3RBEA 4JWMA 2WAQC 3NKUA 1TAQA 1L7OA 3H0RB 5EE9A 1U9LA 4UB6U 1ZQEA 1UQVA 2FMSA 4PH5A 4EBKA 1LB2B 5EE0A 1NZBA 4ZH4A 1KLNA 4EYIB 4EEDA 2N1RA 3ZDBA 8ICTA 2KN7A 3V7LA 2HBLA 4UD4A 4JB3A 2FLPA 2R8HA 4C8KA 1TE2A 1OXJA 4Y2PA 1XSNA 4F5OA 4US8A 3HJ1A 3UQ0A 4B9TA 4DSIA 4RWQA 8ICNA 3L5KA 1XSLA 5J2KA 2FCLA 1WWVA 3CK6A 4DQSA 4KITB 2NRZA 3V6HA 8ICXA 4OAIZ 2W8KA 3MFHA 5B3QA 4ED7A 9ICAA 2FLLA 1QQ5A 4G9BA 1F5SA 4OD0A 4Z6FA 5D46A 1L7MA 2RLTA 8ICQA 4J9NA 2R18A 1WOTA 1JROA 3RB6A 4O3PA 2KKVA 2BCVA 1VDVA 3MR3A 1QSLA 3E58A 5AICA 3KZIU 2PFQA 4J9KA 1N2XA 1PVRA 5HRIA 4X4OA 3OUYA 2ZG6A 3H8JA 1KQQA 1Z00A 2H3QA 5ALPA 4FS2A 4R64A 2OXOA 5KFPA 5ALIA 4JV2A 2ZIWB 2ISPA 4HYKA 3PR4A 3QUQA 3F5EA 4O3OA 5KFAA 3BQ2A 1PVPA 4J9SA 3V6JA 5ALJA 4XUSA 2BE3A 3GIIA 3ZD8A 4F92B 2LM4A 4QWEA 3QE9Y 2W04A 8ICKA 1HIWA 4OJ5A 4M9GA 4RWPA 4C4RA 1TK8A 1PUZA 5KG1A 4EEYA 5ALHA 3UXPA 2E3TA 2OH2A 2IOFK 4QZEA 7ICLA 3HJEA 1XNSA 5ALRA 4IR1A 2QB0B 3ED5A 2KVCA 4USAA 4IQVA 4DS5A 2A19A 4XJEA 1ZQOA 5J2DA 3ISBA 2JEFA 4Y2UA 3UXOA 2H3FA 2XCAA 4IQUA 1ZQGA 1DGSA 2HN2A 4WC2A 3Q8MA 4C7ZA 3MR2A 1VJ5A 4KLUA 2KSOB 3Q8QB 4X4PA 4RQ3A 4G3IA 3ORYA 3D6JA 2KOBA 4IL6U 1Q78A 3H8MA 3NRZA 4K9AA 2H5XA 5KG7A 2B6GA 1BPZA 4ELVA 1UPHA 3GIMA 3HKZC 4IRKA 7ICNA 1RG6A 4AT7B 1TFRA 1Q3VA 5HP4A 4RQ6A 5CFUA 5IINA 4FHWA 3HW8A 3F2CA 4B9MA 1S5LU 1X9MA 2JZBA 1SKSA 1TAMA 5CJ7A 1IG6A 2LPEA 3JPQA 1U4BA 4F4ZA 3SENA 3EZ5A 4DSLA 4NXWA 5D49A 5CB1A 2FPMA 4J9OA 2HOFA 2DKXA 5JTIA 4LT6A 3DDHA 4O0IA 2HHTA 1MN8A 1S0OA 4X4TA 3BZCA 1BPYA 1QSYA 1WG8A 4DLGA 5F9NA 2BBJA 4J9MA 2LI6A 7ICFA 1L8OA 4Y2YA 2YB4A 2CN1A 5J0TA 4QWBA 2BHNA 5IIKA 2WF7A 5KFKA 3WK7A 4GIBA 1MIVA 3HWTA 2JH1A 4RQ2A 1PK1A 2DFLA 1NZPA 3I28A 4I29A 1TKDA 4PGXA 1ZYQA 1ZQNA 1SWWA 1SKWA 5J2IA 1SL1A 1ZQUA 4E80A 2MUTB 1S10A 5AI0A 3AQFA 5J2BA 1PVQA 1F44A 1BVSA 3IG8A 1TVAA 3BQ7A 5HRLA 5KFYA 5KT7A 4PHPA 8ICCA 4OAFA 5KG0A 2YB1A 4HAIA 5ALEA 4I2IA 3M8RA 2D6FC 2B21A 4ECZA 3EWAA 2WF5A 1A6SA 5JRTA 1KNYA 1RDFA 3AN1A 1L8LA 1JXLA 2B4VA 9ICKA 1ZQ1C 3SQIA 2OYYA 4M6WB 2HBKA 5CP2A 2DL0A 3TADA 5KFFA 9ICQA 3SAFA 3HX0A 2ZXIA 1KBUA 4DFKA 4YMOA 4CGZA 3AUOA 3BS7A 4M04A 4FHVA 3Q8LA 1FA0A 5J0OA 3WU2U 4FS1A 4O3NA 4YCXA 4IR9A 4CCHA 4IQWA 4C8MA 1NK9A 4DWIA 4O6AA 4OO1J 1JUDA 4DQPA 2KD1A 1QH9A 1OU5A 1SIJA 3WFRE 3J81j 1IV8A 1WUDA 7ICIA 9ICEA 5KFJA 4KLHA 4M9NA 1XS9D 2Y0SC 4ECRA 2KJ8A 3ETRA 3MR5A 5D4BA 4WC7A 5AIAA 1DK2A 4GFJA 3ZI4A 5AHXA 5DECA 2KIWA 3CW2C 4RUCA 4LEZA 1T4GA 2XO7A 4YVZA 1NKCA 4DFJA 3IRUA 4E7XA 2DBYA 4DL7A 9ICMA 4GC6A 2GOLA 2ZUDA 2G5HB 2QKQA 2KJ5A 2YY6A 1BPEA 2KFNA 4GLXA 3E0FA 2ZTDA 2KFZA 5F9LA 4WC1A 4JWNA 3RJIA 3WKBA 2BCQA 4FO6A 8ICVA 2RRDA 2ZIUA 2NYVA 4U7CA 2CRXA 1JI7A 2OHFA 3NVWA 8ICRA 4P0QB 4K4IA 4FE3A 3PW4A 7ICVA 2EZXA 3S6JA 4DS4A 3M9NB 5AK5A 5K4LA 4UAZA 4TQRA 4Y2TA 1FEZA 4MEXA 4EENA 2F3NA 4DQIA 5KG5A 3GDXA 3RJFA 1Q3UA 4YD2A 2QLTA 4Y2SA 4DF8A 4QW8A 4IRDA 4QZ9A 4NWIA 2LKYA 1V4AA 2BQUA 2MRLA 3JPOA 1D8LA 7ICEA 4B9LA 2OCEA 2VIXA 4PPXA 1SV0A 3GV8B 5D61A 3SR6A 4CF5A 2ZH9A 4UB3A 4EZ6A 1HJPA 2ZIXA 4YR3A 5ALSA 3C5FA 3T5KA 1F5AA 4QJFB 2DWQA 3K75D 2M0NA 4DF4A 5KFXA 1GPJA 4XQ7A 2DQNB 1RQLA 3G6VA 3H39A 2KNJA 5BOLA 3RAQA 5JTGA 3H8SA 4U6PA 1TFYA 8ICSA 2HCFA 2DF4B 2P6RA 2WB1C 5AM5A 4EEKA 4FH3A 4B6JA 1C7YA 4I2JA 2FJ6A 2YMMA 4FHXA 2GH1A 4MFCA 2LHTA 3HT3A 2QB0A 1MQ2A 1VLBA 4K4HA 4BXOA 3LQCB 2G5IB 1UT8A 3ZDEA 9ICHA 1URJA 9ICRA 5BOMA 4ECWA 1TK0A 2HVIA 2ZXHA 4UD5A 2PFNA 4WQLA 4TURA 5ALZA 5B3PA 4KLOA 3RFAA 2P66A 3SI8A 9ICUA 4UQGA 1UT5A 1DOQA 2J6UA 4RNNA 4F93B 2AQ0A 1RXWA 4I2CA 4M47A 3T5LA 4KLDA 4M9LA 4QZIA 3K1RB 8ICOA 3HRDD 3BS5A 3HPOA 1IXRA 3ETLA 3NRWA 1N5WA 5KFCA 3TAQA 1MIYA 1SV0C 1QTMA 2ODGA 1TFWA 5GTIU 2CPRA 2H3VA 3PZPA 4R65A 2A3VA 5KFLA 3H37A 4DL5A 4MEYA 1DRGA 5DDYA 3QYPA 4ATBB 1IIPA 4RPXA 1KFSA 4K99A 3TFRA 2DPJA 1MQ3A 2BZFA 5AK6A 3GV5B 1N5XA 1TV9A 1D8YA 3CYMA 3GIKA 3OVSA 2W9BA 1SB3C 2WAQF 2KJ9A 3AQNA 1SZHA 4PHDA 1SGGA 3F5AA 1T8EA 5G5GA 5KFOA 5AI4A 2ZH2A 4DFPA 4US9A 5ALGA 3RB3A 5ALKA 1PX5A 2M9NA 2G09A 1V97A 5HNKA 4OAHA 9ICGA 3OPXA 4C0ZA 3IDWA 1L3SA 5KFQA 5ALNA 4M9JA 1QLNA 4XQ8A 4NXVA 2BBHA 1Z19A 1C20A 4RQNA 4NXUA 1HUZA 2NRKA 3N4MB 2XICA 3RH5A 4KLTA 5KFVA 1CUKA 3F53A 4PZNA 3F2DA 2F8KA 5DB6A 3WFOA 5DEDA 4WCWA 2MA1A 4F71A 5B5EU 2Y1JA 3AQKA 2HHSA 5KL1B 2AU0A 5CFSA 4KLGA 2EWRA 4KLMA 2UVRA 2ID1A 2ATLA 1K5OA 3WKCA 1R8BA 1JMSA 5DB8A 3RAXA 4NKUA 2QARA 2LYAA 3PO4A 3MFIA 1N61A 9ICLA 5AKHA 3MGIA 2Y0SF 4EYHB 1NK6A 3WKDA 3UM9A 2BCRA 4EEBA 4OJPA 2LMRA 4BGDA 2E8OA 1NI3A 4QWCA 2ZUBA 4CF4A 5TISU 4CE6A 1QQ6A 2VKQA 1ZQCA 3NVOA 4KX3A 4YFKA 1XU4A 5C5JA 2B56A 3QEAZ 2YMPA 4K98A 1COOA 4I2BA 2AXTU 2WF6A 2AHOB 1N62A 2G0AA 5J0WA 1DXSA 2EAMA 2I9GA 2F44A 2JZBB 2BQ3A 5KFTA 5HRFA 1EXNA 5DQGA 4UATA 2JEGA 4ZOHC 1RXVA 4ED1A 1RYRA 4X4QA 2BCSA 5KFEA 1S76D 2YMLA 4TUSA 4ECQA 5J2HA 4UB2A 1FIQA 3WKAA 2ESEA 4WC5A 4KLJA 5F3XB 1ZQMA 1S8OA 3C2LA 3H4BA 4ECXA 1BGXT 1NJXA 5HMLA 1LKYB 1VJ7A 3RRGA 5GTHU 3SV3A 1SKRA 8ICYA 3TARA 1Q46A 3A0BU 3OVAA 4Q8FA 2ZIWA 3NTUA 3GILA 5KFMA 5J0QA 1M6YA 1T3QA 2OEHA 3NASA 2IOHA 5KFDA 4ECVA 5KG6A 4YR2A 4WOYA 1D9FA 1L3UA 1R89A 3MBYA 5CEHA 4JUZA 2HOQA 2G06A 4F50A 3QZ7A 4FZNA 5AKGA 2H3ZA 3K7DA 1Q79A 3LDAA 1YZ7A 1X9SA 4PGQA 4DL6A 4P4MA 3IV6A 4YQWA 5KFGA 4UAWA 3U26A 1NKBA 1OW5A 8ICFA 3ER8C 3EPIA 4JK1A 3SEIA 7ICUA 2BPGA 3TI0A 1S77D 3V7KA 1KN5A 1V85A 2VJ4A 1ZQYA 3PW2A 3N28A 4R63A 4NY8A 5J2GA 4O68A 4NL9A 3C29A 2ASLA 3RRHA 2M2UA 2ZTCA 2MU2A 5HRDA 2F1HA 1WYGA 2MAXA 3MR6A 3PX0A 2DVIA 2HW3A 2B51A 9ICNA 1HEKA 1WCNA 2Y9TA 3UQ2A 9ICJA 2BDUA 3ZDDA 5KG2A 3BJYA 4F2SA 3AM9A 5ALYA 1ZQDA 3B0YA 4AT9A 2BGWA 3JPSA 2P35A 1NK7A 3UPQA 8ICEA 5ALUA 3PMNA 1X6IA 1A77A 1PK1B 4BJQA 3TKAA 4FBTA 2ZH6A 4O5EA 4I28A 4MFAA 2C28A 3A0HU 4BWJA 4I2EA 3UMBA 5L9XA 5KT6A 9ICSA 3WFPA 5KG3A 3SAHA 3SYZA 2BR0A 8ICHA 3BZKA 3V6KA 2W9AA 4FBUA 5AKXA 4K4GA 2EDUA 2YN4A 2YQEA 3CNHA 2EZYA 3DV9A 5KAFU 1UCVA 4DL3A 2K60A 1ZQZA 4AT8B 4PHEA 1QQ7A 2RDIA 3HJ4A 3PSFA 4J9RA 3PO5A 3NVYA 4Z6CA 1VFGA 4J9LA 1NJZA 4F8RA 3MGVA 4IQTA 4KTQA 3THVA 2XGQA 4Y2VA 4KLFA 2PMZF 1LKYA 3RR7A 9ICFA 1N60A 2KZ3A 1XO0A 4WC3A 2BDPA 3IHQB 3AEVA 4WJ3B 2NRTA 4F5PA 1X9WA 4YMNA 4Y2XA 1IM4A 3KTQA 4C80A 4QWAA 2BCUA 1ZQJA 2R8JA 3PV8A 2EANA 5AKEA 1PK3A 1KFTA 4NM1A 1MA7A 4I2HA 1ZQTA 4QZGA 1JRPA 4YR0A 4CNQA 3VC8A 4FO1A 3MC1A 3AMZA 1L7PA 5EOZA 3H7IA 3T3FA 2XI9A 5ALLA 1ZRNA 3T5JA 4RPYA 4DEZA 1ZD2P 3M7DA 4FHYA 4GXIA 3NS1A 4KN4A 4F72A 3KKAA 4YXMA 2ZH7A 1V9PA 3ZD9A 4LZGA 4WC4A 4WBYA 4FZLA 2JR5A 3MDCA 3TFSA 4CDGA 2HBMA 3RJGA 3H8WA 3BS5B 3ERCC 4Q44A 3JCFA 2RFFA 4EX6A 3WK4A 2UVWA 4AT9B 2VJ5A 2PI5A 3BQ0A 2W9CB 1ZQHA 4BX9C 2KZZA 1O03A 4NLZA 2XY5A 2ZIVB 2NRWA 5HC9A 1ZD4A 3G6YA 3QUTA 2W9MA 1N63A 3FC4A 1X6JA 2WF9A 1ZQIA 2R8GA 1D9DA 4ATBA 3AQLA 2G08A 3B9JA 3R9KA 3QNMA 4KLQA 3M8SA 2FMQA 1ZQRA 2AGOA 2ZH8A 2FLNA 4EBDA 2BQRA 4RQ1A 3D2NA 2LYHA 1SL0A 1UEUA 2ISOA 1S0NA 2HI0A 3MDAA 8ICLA 3C66A 5JUMA 4TQSA 2PI4A 5L1IA 1NKEA 8ICZA 2KEYA 9ICIA 5E79U 3F2BA 2W7OA 2AJQA 1SXEA 3OHBA 1RYUA 3PSPA 1J2NA 5DG9A 2XIDA 4O5CA 3KHGA 4O3MA 4DOAA 3CP8A 3OSPA 4Y2RA 1S0VA 5AM1A 3H4DA 1SV4A 2RP5A 2YMQA 1T94A 2HN1A 4FHPA 4NLNA 1Q8KA 5AIBA 4C8OA 3SV4A 1FFVA 5KFHA 5DG8A 1ZJNA 1GO3F 4DQRA 4NLCA 8ICJA 3UXNA 3D2SA 1FFUA 3RTVA 2V9WA 4UB8U 4PZOA 4JV0A 3OGUA 4M0AA 5ALVA 4X4UA 2PKEA 1YT3A 3K4GA 2KIVA 2QARB 3L9DA 4EX7A 4RQMA 2Q4TA 1L5UA 1ZJMA 4R8UA 4UARA 3PW7A 2KE7A 1ZQAA 1SXDA 2PFPA 4O69A 5AM0A 2BPFA 2KZMA 4NKTA 4EBCA 5HREA 4EGWA 1J2MA 4UASA 1P7DA 5IIMA 2ASJA 4C8NA 1ZQXA 5ALTA 3B0XA 4CF3A 2M2TA 8ICPA 3SAGA 1B22A 2ZTEA 2NRVA 4PL1A 1S97A 4ECYA 2DUYA 3OHAA 3N97B 4DOCA 1R8CA 2OM6A 5KFBA 4LVSA 5EWGA 1MC8A 2IMWP 5D62A 5CWRA 2UVVA 4QZBA 2JXJA 3AU2A 4DSJA 8ICUA 2W54A 4DSEA 4LEWA 4MF8A 4QIWC 2K4EA 2NO5A 1QCKA 3E2EA 2YTUA 2YX8A 5J0XA 5JU5A 2AGQA 3IM1A 3LVVA 5AM4A 2Y1IA 4M9HA 5A0LA 2W9BB 5DGAA 1L3VA 3N7SC 3JPTA 4NJ8A 3QZ8A 1JN3A 4EELA 5L1MA 7ICHA 3OTQA 1KRPA 2FE9A 2ZH5A 4P4PA 5EE1A 1H38A 1CRXA 3C1ZA 3KZXA 4O5KA 4J9QA 3PNCA 3KKAC 1NOMA 4O3SA 2RQ5A 1HUOA 3QUCA 4JMUA 5HRKA 4KM5A 4DL2A 2O6KA 4OJ6A 5ALOA 9ICCA 2K4IA 5IILA 4NXTA 3EUB2 2XCPA 4WQKA 2DR8A 7ICKA 4B9UA 2QB1A 7ICOA 2ZJAA 2HVHA 3MABA 5DKWA 3JPNA 4RQ8A 4RZRA 1KW4A 2XVTA 3Q8RB 1KKXA 2GA9D 1NK4A 1ZETA 3PVXA 3IG5A 4P0PB 1RPLA 3LYSA 2XY6A 5HR7A 3GV7B 2E1EA 4S3NA 2W8LA 3SD7A 3FAHA 4NM2A 3LWMA 3V7JA 2Q66A 3MGHA 2VA8A 2C2RA 2JEJA 3WK5A 3ISDA 1XO1A 4M2YA 4A8EA 4NXXA 3ONNA 3BQTA 3JPRA 2WFAA 5J0PA 4M5DA 1U48A 2CXYA 4NLBA 4PL2A 4I2GA 1XC9A 3WFQE 2I1QA 3SMVA 2A1JA 5KTQA 1Z3EB 1XSPA 2DRAA 5CFTA 2I5HA 3WK8A 2K89A 2HBJA 2V4RA 3PHZA 5DLFA 2DR5A 5KFIA 5J0RA 3ALRA 4LJXA 1ED1A 4I2AA 4ECSA 5FP0A 4X4NA 2PXIA 3I76A 2ZJ8A 5HRHA 4UB1A 2E5SA 5HMMA 2H3IA 4F5RA 3KHRA 2PBEA 2JH7A 3VCBA 5J2AA 1NJYA 3JZ0A 4AYBF 1B0XA 1ECWA 2GWSA 8ICIA 2W9CA 5ALQA 4MHVA 4K8VA 2F1JA 4ED0A 3PSIA 4JV1A 4WH5A 4RWNA 5AKZA 4FZMA 4WC6A 4P4OA 4KMOB 1ZQPA 4OJLA 2B0CA 1X42A 5KAIU 3N7PD 2HDOA 1Z4OA 2KKPA 5KFRA 4JLXA 2HHXA 2BKEA 3AL0B 3CRXA 2ALZA 3GU3A 1ZQFA 2IA6A 5DBCA 3OJSA 3C23A 3H3AA 2ZIUB 4UB5A 1KDHA 5KG4A 2ZIVA 4RWOA 3PR5B 3KHHA 4GC7A 1RQNA 2KVSA 2VANA 3QX7A 1ZQWA 2ZIXB 1WWUA 2HSZA 4RNOA 4EP7A 7ICMA 2GLEA 5HHHA 3RJEA 1RZTA 4ED8A 2WTFA 3KBBA 4DCCA 2NO4A 3EW9A 4BWMA 2ZJ5A 4F4KA 3H0MB 2W03A 1RYSA 4UAYA 4ED2A 3OVBA 3RJJA 4EZ9A 1ZOLA 5DQHA 2W55A 4BXOB 2C2DA 3M6KA 5IIOA 3RB0A 4AT8A 4QIWF 1Z1BA 4DSKA 4IC9A 5ALWA 3PX6A 3G6XA 4CRXA 4O3RA 1U47A 2F1IA 1L3TA 2F2AB 5ALDA 3PMLA 3QU4A 3C18A 3RH6A 2K8BB 3WKEA 2FMPA 2RHFA 2LBOA 2JRZA 3FDSA 7ICQA 2F77X 2HMXA 3RF9A 3RJKA 1JQRA 4IRCA 4MKPA 4J03A 2HOIA 4OAGA 4IS7A 1MSWD 5HHIA 3LK9A 4DFMA 5AI5A 3WFSC 2EZZA 5KT3A 3PY8A 4KLIA 4ECUA 4GXJA 3C1YA 3RB4A 4K97A 3FYHA 3HILA 3QUBA 5AKKA 2MUTA 5EWEA 1NK5A 5J8YC 3EYZA 2W11A 1WCLA 1KSPA 1S9FA 2FI1A 4EV6A 2MSNA 5AK3A 4C4SA 4ELTA 4XRHA 2KHVA 9ICXA 1RM6C 2GO7A 2ZHAA 4QNLA 4Q45A 2P6UA 2Z7JA 3V72A 5HR9A 5CA7A 4AP9A 2ASDA 5L1KA 1KFDA 3BQ1A 2ZH3A 2JGAA 7ICTA 3M6ZA 4NL9C 2ZUCA 2W43A 4YXJA 4KMUA 1SWVA 1ZRMA 4UAVA 5KFUA 2VA3A 3H0LB 3Q8SB 1X2IA 1CI4A 1JX4A 3UMCA 1L6NA 1B43A 2XGPA 2ZH1A 2AGPA 2GAFD 9ICPA 1DK3A 4QZ8A 3C2MA 4Z6DA 1J97A 2IBKA 1OUQA 1BNOA 3C21A 3C2KA 2KHQA 8ICGA 3EF2A 3L3FX 5L1JA 1ZD3A 3LVWA 5AI6A 4RU9A 3GIJA 3ZDCA 4PJ0U 2EAOA 5J8YA 5ALFA 4PHAA 1UHUA 2K8AA 5KNIA 3Q8PB 4C7YA 1CEZA 4RUAA 5J0YA 2J6SA 3NGDA 5B66U 3BDPA 4F4YA 1Z4NA 4BUGA 2ZH4A 4O3QA 4DO9A 4YN4A 1Z00B 4KX5A 1D8BA 1BPXA 9ICVA 3NYBA 2C22A 4WBZA 3NWIA 4F4WA 2EH9A 5L1LA 5AM3A 5KFWA 2IHMA 2HHWA 2A1AA 2XC9A 2IUBA 3C28A 5EE3A 2WB1F 1NNLA 3QU7A 4DFDA 2E8MA 5DG7A 1SZPA 3M9OB 2R8IA 3ZDAA 1JAJA 4RT3A 2IHOA 2FPKA 2Q0ZX 5EWFA 3M1YA 3FM9A 2A1JB 4RQ5A 4FH5A 4P0PA 2WF8A 1K1QA 3PSTA 3QXGA 1X9XA 3AQEA 1TAUA 2E8NA 1X40A 2DR7A 4RPZA 3RBDA 1KTQA 3OSNA 4PGYA 4R8UB 3NVZA 7ICJA 2XY7A 3AQMA 2O1PA 5DB7A 4Z6EA 4QZDA 2KSOA 4P2HA 9ICTA 4X5VA 4RNMA 4E8FA 1T7PA 5DDMA 1R8AA 1NO5A 2KK0A 3HP6A 4I2FA 7ICRA 3ISCA 4IG8A 4DL4A 3WK9A 2I6XA 4OCZA 4DSFA 4YG2A 1PZNA 4K9BA 1YLQA 1AROP 3TQ1A 1U45A 2O5AA 1U49A 2WHEA 4M6WA 2F8LA 2UVUA 4C8LA 2ES6A 2L5YA 2NV3A 1ZXIA 2W3SA 8ICBA 4NLKA 4QZFA 2G07A 3TAPA 4TUPA 2J6TA 3EPGA 2HHPA 3JPPA 3KFUF 1JXEA 3H38A 4X4SA 2M2WA 5KT2A 2KP7A 1O08A 1ZQQA 3M9MB 2EQYA 3KD3A 5DB9A 5HR6A 4Y2JA 5AKIA 4Q43A 5IIIA 4RQ4A 4K96A 4EBEA 1ZD5A 4ECTA 3ER9B 5CHGA 9ICOA 5HRBA 2K4HA 2M2VA 2IOFA 1MIWA 1ZQBA 5ALXA 1BPDA 4I0UA 4KN7A 4O9MA 1BPBA 2DPIA 3GFKB 5KT4A 3TACB 5AM2A 3IP4B 3PW5A 4RQ7A 4P0QA 4B9SA 1SL2A 1F0MA 3C5GA 4XA5A 4ED3A 4C4TA 5J0SA 2D3DA 4KLLA 5J29A 1NJWA 4F3OA 4WC0A 2DR9A 3H40A 2R8KA 5AK4A 5BPCA 1DGJA 3OWGA 3UPSA 1LVHA 2E8PA 5J2CA 3TADC 4X0BA 1T3NA 1UA1A 4KLSA 1ZQLA 4ELUA 3I1YA 4ACOA 4B9NA 4HX0A 3LWLA 3OV7A 2F76X 3DEEA 4YMMA 8ICMA 2RDJA 4J9PA 4GXKA 1UEVA 5J2JA 5KFSA 5CHEA 3OJUA 1ZQKA 1LV5A 2V4QA 2HHUA 2OWOA 5DBBA 1ZQVA 4NXZA 2BPCA 3PW0A 1S0MA 5AI9A 1NK8A 5KFNA 4JLZA 3QEBZ 2K4PA 2W3RA 1COKA 1JALA 4OJOA 2JMGA 2DKZA 4MF2A 4E0DA 1XWLA 5DBAA 3T79A 1AQ6A 2FDRA 1B4FA 2PFOA 3KOOA 2JV3A 4LEVA 1FO4A 5AKJA 3NUQA 4UB4A 4F91B 4QZCA 5C0YA 4X4RA 3WK6A 9ICBA 2FPLA 1K1SA 8ICWA 3QU2A 1N56A 4F5QA 5AI8A 1UA0A 2DGZA 5HRGA 5CRXA 3QU9A 5J0UA 4QWDA 1TK5A 3GQCA 5DQIA 1ZQSA 1X66A 5AKLA 2HHQA 2KMDA 3QU5A 2W7PA 2LM1A 2VA2A 4UW9A 1JIHA 4UBBA 8ICAA 3RJHA 4QZHA 4I2DA 2KV2A 2ZHBA 5KL8B 4O67A 4NV0A 1Y88A 1V38A 5DLGA 5T14A 3RH4A 5CR0A 2PMZC 4RQ0A 5G5HA 2AH5A 4ICAA 3K1ZA 2KTQA 1BNPA 3SZ2A 4YP3A 3AU6A 4N7RA 4UBCA 4FFDA 3RR8A 2Y9UA 3HKZF 5AKYA 4Y2QA 2KICA 5KFZA 3TANA 3GZFA 3KHLA 3MCRA 4BDPA 2NRXA 3N7RC 4TUQA 4DOBA 7ICSA 3HIYA 5KT5A 3ICXA 5J2FA 3OUYB 4AT7A 4LZDA 1L7NA 2D8CA 3L4PA 3JYYA 4EBJA 2JHDA 1KEJA 4X4VA 2E1FA 5H2FU 5D63A 4DLEA 2K8CB 1N48A 7ICPA 4YD1A 4KB6A 3D2QA 1YZ6A 2LYBA 9ICWA 4QW9A 5J2EA 4B9VA 4MFFA 5DGBA 3PX4A 1Z1VA 4NLGA 4DQQA 5TZVA 3O0FA 1UETA 2JEIA 4F4XA 5F2VO 1A0PA 5ALMA 2C2EA 4KLEA 3UMGA 4UAUA 4F2RA 4F5NA 5IIJA 3T5HA 3IN5A 1A76A 2KG5A
chains in the Genus database with same CATH topology
4I2JA 5EWEA 1NK0A 2IHNA 1NK5A 3EYZA 4KN4A 1WCLA 4FHXA 4ED6A 4YXMA 4MFCA 2ZH7A 1KSPA 1V9PA 1S9FA 3ZD9A 4X0AA 1QSSA 2DRBA 4QZAA 4LZGA 3HT3A 4WC4A 4ELTA 2AQ4A 1MQ2A 4WBYA 4XRHA 2HHVA 4R66A 4K4HA 4Q8EA 4BXOA 3MDCA 3LQCB 3TFSA 4ATBA 9ICXA 3ZDEA 1UT8A 4RT2A 4I27A 2ZHAA 9ICHA 3RJGA 7ICGA 3H8WA 4Q45A 3Q8KA 2P6UA 3V72A 5HR9A 9ICRA 5BOMA 5CA7A 4Q44A 4ECWA 3RBEA 1TK0A 4JWMA 2HVIA 4UD5A 2PFNA 2RFFA 1TAQA 4TURA 2ASDA 4KLOA 2UVWA 5L1KA 4AT9B 2P66A 1U9LA 1KFDA 2PI5A 3BQ1A 2DR9A 3BQ0A 1ZQEA 2W9CB 1ZQHA 2FMSA 2KZZA 4PH5A 3SI8A 9ICUA 4EBKA 1LB2B 4NLZA 4UQGA 2XY5A 1UT5A 7ICTA 2ZH3A 1DOQA 4ZH4A 2NRWA 1KLNA 4EYIB 4RNNA 2ZUCA 4F93B 3G6YA 2AQ0A 2W9MA 3ZDBA 5HC9A 8ICTA 2KN7A 3V7LA 1RXWA 4I2CA 1ZQIA 2R8GA 1D9DA 4M47A 4UD4A 3T5LA 4YXJA 2FLPA 2R8HA 4C8KA 4KLDA 4M9LA 4QZIA 3AQLA 4KMUA 1XSNA 4F5OA 3M8SA 4KLQA 8ICOA 3HJ1A 2FMQA 3UQ0A 3HPOA 2AGOA 1ZQRA 1IXRA 5KFUA 2FLNA 2VA3A 4EBDA 3Q8SB 2BQRA 3ETLA 8ICNA 4RWQA 1XSLA 5J2KA 1X2IA 5KFCA 3TAQA 1JX4A 1MIYA 4RQ1A 4DQSA 4KITB 2NRZA 1B43A 2LYHA 2XGPA 3V6HA 1SL0A 1QTMA 1UEUA 2ISOA 1S0NA 8ICXA 1TFWA 3MDAA 2ZH1A 2AGPA 8ICLA 3C66A 9ICPA 2PI4A 4QZ8A 5JUMA 3MFHA 2W8KA 3C2MA 1DK3A 4Z6DA 4TQSA 4ED7A 2IBKA 4R65A 2FLLA 5L1IA 3C21A 5KFLA 3C2KA 1NKEA 9ICAA 8ICZA 8ICGA 9ICIA 1BNOA 3H37A 4DL5A 4MEYA 5L1JA 2AJQA 4Z6FA 3OHBA 5D46A 5DDYA 4RU9A 4RPXA 3GIJA 1KFSA 8ICQA 4J9NA 3ZDCA 4ATBB 5DG9A 3TFRA 2DPJA 1MQ3A 4PHAA 4O5CA 1WOTA 3KHGA 3RB6A 3GV5B 4O3PA 1D8YA 1TV9A 4DOAA 2BCVA 3MR3A 3Q8PB 3GIKA 1CEZA 1QSLA 3OSPA 3OVSA 2PFQA 1S0VA 2W9BA 3H4DA 4RUAA 5J0YA 4J9KA 2J6SA 5HRIA 3AQNA 4PHDA 4X4OA 1T8EA 3OUYA 3NGDA 3BDPA 4F4YA 5KFOA 4FHPA 4NLNA 2ZH2A 3H8JA 4C8OA 3SV4A 5KFHA 4O3QA 5DG8A 4DO9A 4DFPA 1ZJNA 2ZH4A 4DQRA 1Z00A 4YN4A 1Z00B 8ICJA 3UXNA 1BPXA 3RTVA 3RB3A 2V9WA 9ICVA 1PX5A 2M9NA 5KFPA 4R64A 4JV0A 4FS2A 2C22A 5HNKA 4JV2A 3NYBA 3OGUA 4WBZA 4F4WA 5L1LA 9ICGA 2ISPA 4M0AA 4HYKA 3PR4A 5KFWA 2IHMA 2HHWA 4O3OA 5KFAA 1L3SA 4X4UA 2XC9A 5KFQA 3K4GA 3BQ2A 4J9SA 3V6JA 3L9DA 4M9JA 4XUSA 1QLNA 1L5UA 4XQ8A 4R8UA 1ZJMA 2BE3A 3PW7A 3GIIA 1ZQAA 5DG7A 3ZD8A 2PFPA 4F92B 2BPFA 1SZPA 4QWEA 3QE9Y 3M9OB 2R8IA 1HUZA 2KZMA 8ICKA 3N4MB 3ZDAA 1JAJA 2NRKA 4EBCA 4NKTA 4KLTA 3RH5A 5HREA 4RT3A 5KFVA 4M9GA 4RWPA 1CUKA 2FPKA 2Q0ZX 1TK8A 5KG1A 5EWFA 4EEYA 5DB6A 2A1JB 5IIMA 3UXPA 3WFOA 2ASJA 4RQ5A 4C8NA 1ZQXA 5DEDA 3B0XA 4WCWA 4FH5A 2M2TA 8ICPA 1B22A 4QZEA 7ICLA 2ZTEA 2NRVA 1S97A 4IR1A 4ECYA 1K1QA 2Y1JA 3AQKA 2HHSA 3OHAA 3N97B 2AU0A 4DOCA 1TAUA 4KLGA 4KLMA 4IQVA 4DS5A 8ICAA 1R8CA 2UVRA 5KFBA 4LVSA 5EWGA 1MC8A 1ZQOA 2IMWP 5J2DA 5CWRA 3ISBA 2ATLA 2JEFA 2UVVA 2ID1A 4RPZA 3RBDA 2DR7A 1KTQA 3UXOA 3OSNA 4PGYA 4IQUA 4R8UB 4QZBA 2XCAA 1JMSA 5DB8A 3RAXA 1ZQGA 1R8BA 4NKUA 3PO4A 7ICJA 3AU2A 1DGSA 3MFIA 2XY7A 9ICLA 3AQMA 4DSJA 8ICUA 4WC2A 3Q8MA 5DB7A 3MGIA 2O1PA 3MR2A 4DSEA 4EYHB 4Z6EA 4KLUA 4MF8A 1NK6A 4QZDA 3Q8QB 4X4PA 4RQ3A 2BCRA 4G3IA 4P2HA 3ORYA 9ICTA 4X5VA 4RNMA 4BGDA 4E8FA 3E2EA 5J0XA 4QWCA 2ZUBA 1T7PA 5DDMA 1Q78A 2AGQA 1R8AA 1NO5A 3HP6A 4I2FA 7ICRA 2H5XA 3ISCA 5KG7A 4IG8A 3IM1A 4DL4A 1BPZA 2Y1IA 1ZQCA 4ELVA 4DSFA 4YG2A 1PZNA 3GIMA 4M9HA 1YLQA 2W9BB 1AROP 5DGAA 1L3VA 4IRKA 3TQ1A 1U45A 7ICNA 4YFKA 1XU4A 1TFRA 5C5JA 3JPTA 1U49A 2O5AA 4AT7B 5HP4A 3QEAZ 4X4TA 1COOA 4I2BA 4M6WA 4RQ6A 2UVUA 5J0WA 4C8LA 5IINA 3QZ8A 2I9GA 8ICBA 4FHWA 1JN3A 2JZBB 3HW8A 4NLKA 2BQ3A 5KFTA 4QZFA 4B9MA 7ICHA 1KRPA 1X9MA 3TAPA 4TUPA 5HRFA 2JZBA 4P4PA 1SKSA 2J6TA 1EXNA 2ZH5A 5CJ7A 3EPGA 3JPPA 2HHPA 1JXEA 1H38A 5DQGA 3C1ZA 3H38A 4O5KA 2JEGA 4J9QA 4X4SA 3PNCA 3JPQA 1NOMA 1U4BA 1RXVA 1HUOA 4O3SA 2M2WA 4ED1A 1RYRA 5KT2A 4F4ZA 3EZ5A 5HRKA 2KP7A 4X4QA 1ZQQA 4DSLA 5D49A 4DL2A 2ZH8A 2BCSA 3M9MB 4IQWA 5KFEA 9ICCA 5CB1A 5DB9A 2FPMA 4J9OA 5IILA 1S76D 4TUSA 2XCPA 2DR8A 4ECQA 7ICKA 5J2HA 4B9UA 4UB2A 4Q43A 7ICOA 4O0IA 4LT6A 5IIIA 2ZJAA 4RQ4A 2HHTA 2HVHA 3MABA 5DKWA 3JPNA 4EBEA 1S0OA 4RQ8A 4RZRA 3Q8RB 4ECTA 4KLJA 4WC5A 5CHGA 9ICOA 5HRBA 1NK4A 1BPYA 1ZQMA 1ZETA 2M2VA 1MIWA 3C2LA 3PVXA 3H4BA 1ZQBA 1QSYA 4ECXA 1BPDA 4DLGA 4KN7A 5F9NA 4J9MA 1BGXT 4O9MA 1BPBA 1RPLA 1NJXA 5HMLA 7ICFA 2XY6A 2DPIA 3GFKB 5KT4A 1VJ7A 3RRGA 3SV3A 5J0TA 3PW5A 1SKRA 8ICYA 3TARA 4RQ7A 4QWBA 2BHNA 5IIKA 3GV7B 4B9SA 4S3NA 3OVAA 5KFKA 2W8LA 4Q8FA 1MIVA 3HWTA 1SL2A 3NTUA 4NM2A 3LWMA 3C5GA 3V7JA 2Q66A 4XA5A 2VA8A 3MGHA 3GILA 4ED3A 2C2RA 2JEJA 4RQ2A 5J0SA 3ISDA 2DFLA 4KLLA 5J29A 5KFMA 1XO1A 5J0QA 1NJWA 3H40A 4F3OA 4I29A 4M2YA 1NZPA 2R8KA 4WC0A 1TKDA 5BPCA 3BQTA 4PGXA 3JPRA 5KFDA 5J0PA 5KG6A 4YR2A 4ECVA 4M5DA 1D9FA 1ZYQA 1L3UA 3MBYA 1U48A 1ZQNA 1R89A 3UPSA 5J2CA 4X0BA 1T3NA 4I2GA 1UA1A 1XC9A 1SKWA 3WFQE 4JUZA 5J2IA 1ZQLA 2I1QA 1SL1A 1ZQUA 4ELUA 2MUTB 4F50A 2A1JA 3QZ7A 5KTQA 4E80A 1S10A 4B9NA 3LWLA 1Z3EB 5J2BA 3OV7A 1XSPA 2DRAA 1BVSA 1TVAA 5HRLA 4YMMA 8ICMA 2RDJA 1Q79A 5KFYA 5KT7A 4J9PA 4GXKA 3LDAA 4PHPA 2V4RA 1X9SA 5J2JA 5DLFA 8ICCA 1UEVA 5KFSA 5KG0A 2DR5A 5KFIA 5J0RA 4I2IA 4PGQA 3M8RA 2B21A 4DL6A 4ECZA 3EWAA 4I2AA 4ECSA 3OJUA 4P4MA 1ZQKA 4YQWA 1LV5A 1KNYA 2V4QA 2HHUA 4X4NA 4NY8A 2PXIA 2OWOA 5KFGA 5DBBA 4UAWA 1NKBA 1JXLA 9ICKA 2ZJ8A 5HRHA 1ZQVA 8ICFA 4NXZA 4UB1A 5HMMA 3EPIA 4M6WB 4F5RA 5CP2A 2BPCA 4JK1A 5KFFA 3PW0A 3KHRA 9ICQA 2PBEA 1S0MA 3HX0A 5J2AA 1NJYA 7ICUA 1NK8A 3JZ0A 5KFNA 4DFKA 4YMOA 3TI0A 3QEBZ 2BPGA 3AUOA 4M04A 1S77D 3V7KA 4FHVA 3Q8LA 1FA0A 2J6UA 2GWSA 5J0OA 8ICIA 2W9CA 1ZQYA 4FS1A 3PW2A 4O3NA 4YCXA 4IR9A 4R63A 4CCHA 2F1JA 4E0DA 1XWLA 5DBAA 4C8MA 5J2GA 4ED0A 4MF2A 1NK9A 4DWIA 2ASLA 3RRHA 2PFOA 2M2UA 2ZTCA 4JV1A 5HRDA 4DQPA 4RWNA 2F1HA 1OU5A 4UB4A 4WC6A 2MAXA 3WFRE 4F91B 4QZCA 3MR6A 4P4OA 4X4RA 1ZQPA 7ICIA 2FPLA 9ICBA 3PX0A 9ICEA 5KFJA 2DVIA 4KLHA 1K1SA 4M9NA 8ICWA 2HW3A 1N56A 1XS9D 9ICNA 4ECRA 4F5QA 3MR5A 5D4BA 1WCNA 3UQ2A 1UA0A 4WC7A 5HRGA 9ICJA 1DK2A 5KFRA 5J0UA 4QWDA 1TK5A 3GQCA 5DQIA 1ZQSA 3ZDDA 5KG2A 2BKEA 2HHXA 2ALZA 2HHQA 3BJYA 5DECA 4F2SA 2IA6A 1ZQFA 5DBCA 4RUCA 2VA2A 3OJSA 1JIHA 1T4GA 3C23A 4UBBA 3H3AA 2XO7A 3B0YA 4UB5A 1KDHA 5KG4A 1ZQDA 4YVZA 1NKCA 3RJHA 4QZHA 4AT9A 4DFJA 4I2DA 4E7XA 2BGWA 3PR5B 4RWOA 2ZHBA 3JPSA 4DL7A 3KHHA 9ICMA 1NK7A 3UPQA 4GC7A 8ICEA 3PMNA 4GC6A 2VANA 2ZUDA 1A77A 1ZQWA 1Y88A 5DLGA 3RH4A 4RNOA 5CR0A 4EP7A 4FBTA 2ZH6A 1BPEA 4I28A 4O5EA 4MFAA 2KFNA 7ICMA 4GLXA 4RQ0A 2C28A 5HHHA 2ZTDA 3RJEA 1RZTA 2KFZA 4BWJA 4ED8A 4I2EA 2KTQA 1BNPA 5F9LA 3SZ2A 4YP3A 4WC1A 5L9XA 3AU6A 2WTFA 4JWNA 3RJIA 2BCQA 5KT6A 9ICSA 4FO6A 3WFPA 5KG3A 4UBCA 3SYZA 8ICVA 3RR8A 3EW9A 4BWMA 2ZJ5A 4F4KA 2BR0A 5KFZA 8ICHA 3TANA 3V6KA 1RYSA 2W9AA 4UAYA 4ED2A 3KHLA 8ICRA 4K4IA 3OVBA 3RJJA 4FBUA 3PW4A 4BDPA 4EZ9A 4DS4A 4K4GA 7ICVA 5DQHA 2NRXA 4TUQA 3M9NB 4DOBA 7ICSA 4BXOB 5KT5A 2C2DA 3HIYA 4UAZA 5IIOA 4DL3A 4TQRA 1ZQZA 3RB0A 4AT8A 5J2FA 4AT8B 4PHEA 2RDIA 4MEXA 3HJ4A 4J9RA 3OUYB 4DQIA 4AT7A 4LZDA 5KG5A 3PO5A 4DSKA 4Z6CA 3JYYA 3GDXA 4EBJA 3PX6A 3G6XA 3RJFA 1KEJA 4J9LA 1NJZA 4F8RA 1VFGA 4X4VA 4IQTA 4YD2A 4KTQA 3THVA 4O3RA 2XGQA 1U47A 4DF8A 4QW8A 4KLFA 4DLEA 4IRDA 2F1IA 4QZ9A 3RR7A 1N48A 4B9TA 4DSIA 1V4AA 2BQUA 1L3TA 9ICFA 4YD1A 7ICPA 3PMLA 3JPOA 2KZ3A 1D8LA 7ICEA 3C18A 3RH6A 4WC3A 2BDPA 3IHQB 2FMPA 4B9LA 2NRTA 4F5PA 3FDSA 4YMNA 1X9WA 7ICQA 4PPXA 1IM4A 3KTQA 9ICWA 4QW9A 4QWAA 5J2EA 3GV8B 2BCUA 3RJKA 1ZQJA 4B9VA 1JQRA 4MFFA 2R8JA 3PV8A 4IRCA 5DGBA 3PX4A 2ZH9A 4UB3A 4EZ6A 1HJPA 4YR3A 1MSWD 1KFTA 4NM1A 5HHIA 3LK9A 3C5FA 3T5KA 4DFMA 1ZQTA 4I2HA 4NLGA 1F5AA 4QZGA 5TZVA 4DQQA 3K75D 5KFXA 4YR0A 4DF4A 4XQ7A 3WFSC 5KT3A 1UETA 3PY8A 5EOZA 3H7IA 2JEIA 3G6VA 3T3FA 4KLIA 4ECUA 4KLSA 5BOLA 4F4XA 3H39A 4GXJA 3RAQA 5F2VO 3H8SA 2C2EA 1TFYA 8ICSA 4KLEA 3C1YA 4RPYA 3T5JA 3RB4A 2P6RA 4DEZA 4FHYA 4F2RA 3FYHA 4F5NA 5IIJA 3T5HA 4FH3A 1A76A 4GXIA 1C7YA 2MUTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I2J A;  5EWE A;  1NK0 A;  2IHN A;  1NK5 A;  3EYZ A;  4KN4 A;  1WCL A;  4FHX A;  4ED6 A;  4YXM A;  4MFC A;  2ZH7 A;  1KSP A;  1V9P A;  1S9F A;  3ZD9 A;  4X0A A;  1QSS A;  2DRB A;  4QZA A;  4LZG A;  3HT3 A;  4WC4 A;  4ELT A;  2AQ4 A;  1MQ2 A;  4WBY A;  4XRH A;  2HHV A;  4R66 A;  4K4H A;  4Q8E A;  4BXO A;  3MDC A;  3LQC B;  3TFS A;  4ATB A;  9ICX A;  3ZDE A;  1UT8 A;  4RT2 A;  4I27 A;  2ZHA A;  9ICH A;  3RJG A;  7ICG A;  3H8W A;  4Q45 A;  3Q8K A;  2P6U A;  3V72 A;  5HR9 A;  9ICR A;  5BOM A;  5CA7 A;  4Q44 A;  4ECW A;  3RBE A;  1TK0 A;  4JWM A;  2HVI A;  4UD5 A;  2PFN A;  2RFF A;  1TAQ A;  4TUR A;  2ASD A;  4KLO A;  2UVW A;  5L1K A;  4AT9 B;  2P66 A;  1U9L A;  1KFD A;  2PI5 A;  3BQ1 A;  2DR9 A;  3BQ0 A;  1ZQE A;  2W9C B;  1ZQH A;  2FMS A;  2KZZ A;  4PH5 A;  3SI8 A;  9ICU A;  4EBK A;  1LB2 B;  4NLZ A;  4UQG A;  2XY5 A;  1UT5 A;  7ICT A;  2ZH3 A;  1DOQ A;  4ZH4 A;  2NRW A;  1KLN A;  4EYI B;  4RNN A;  2ZUC A;  4F93 B;  3G6Y A;  2AQ0 A;  2W9M A;  3ZDB A;  5HC9 A;  8ICT A;  2KN7 A;  3V7L A;  1RXW A;  4I2C A;  1ZQI A;  2R8G A;  1D9D A;  4M47 A;  4UD4 A;  3T5L A;  4YXJ A;  2FLP A;  2R8H A;  4C8K A;  4KLD A;  4M9L A;  4QZI A;  3AQL A;  4KMU A;  1XSN A;  4F5O A;  3M8S A;  4KLQ A;  8ICO A;  3HJ1 A;  2FMQ A;  3UQ0 A;  3HPO A;  2AGO A;  1ZQR A;  1IXR A;  5KFU A;  2FLN A;  2VA3 A;  4EBD A;  3Q8S B;  2BQR A;  3ETL A;  8ICN A;  4RWQ A;  1XSL A;  5J2K A;  1X2I A;  5KFC A;  3TAQ A;  1JX4 A;  1MIY A;  4RQ1 A;  4DQS A;  4KIT B;  2NRZ A;  1B43 A;  2LYH A;  2XGP A;  3V6H A;  1SL0 A;  1QTM A;  1UEU A;  2ISO A;  1S0N A;  8ICX A;  1TFW A;  3MDA A;  2ZH1 A;  2AGP A;  8ICL A;  3C66 A;  9ICP A;  2PI4 A;  4QZ8 A;  5JUM A;  3MFH A;  2W8K A;  3C2M A;  1DK3 A;  4Z6D A;  4TQS A;  4ED7 A;  2IBK A;  4R65 A;  2FLL A;  5L1I A;  3C21 A;  5KFL A;  3C2K A;  1NKE A;  9ICA A;  8ICZ A;  8ICG A;  9ICI A;  1BNO A;  3H37 A;  4DL5 A;  4MEY A;  5L1J A;  2AJQ A;  4Z6F A;  3OHB A;  5D46 A;  5DDY A;  4RU9 A;  4RPX A;  3GIJ A;  1KFS A;  8ICQ A;  4J9N A;  3ZDC A;  4ATB B;  5DG9 A;  3TFR A;  2DPJ A;  1MQ3 A;  4PHA A;  4O5C A;  1WOT A;  3KHG A;  3RB6 A;  3GV5 B;  4O3P A;  1D8Y A;  1TV9 A;  4DOA A;  2BCV A;  3MR3 A;  3Q8P B;  3GIK A;  1CEZ A;  1QSL A;  3OSP A;  3OVS A;  2PFQ A;  1S0V A;  2W9B A;  3H4D A;  4RUA A;  5J0Y A;  4J9K A;  2J6S A;  5HRI A;  3AQN A;  4PHD A;  4X4O A;  1T8E A;  3OUY A;  3NGD A;  3BDP A;  4F4Y A;  5KFO A;  4FHP A;  4NLN A;  2ZH2 A;  3H8J A;  4C8O A;  3SV4 A;  5KFH A;  4O3Q A;  5DG8 A;  4DO9 A;  4DFP A;  1ZJN A;  2ZH4 A;  4DQR A;  1Z00 A;  4YN4 A;  1Z00 B;  8ICJ A;  3UXN A;  1BPX A;  3RTV A;  3RB3 A;  2V9W A;  9ICV A;  1PX5 A;  2M9N A;  5KFP A;  4R64 A;  4JV0 A;  4FS2 A;  2C22 A;  5HNK A;  4JV2 A;  3NYB A;  3OGU A;  4WBZ A;  4F4W A;  5L1L A;  9ICG A;  2ISP A;  4M0A A;  4HYK A;  3PR4 A;  5KFW A;  2IHM A;  2HHW A;  4O3O A;  5KFA A;  1L3S A;  4X4U A;  2XC9 A;  5KFQ A;  3K4G A;  3BQ2 A;  4J9S A;  3V6J A;  3L9D A;  4M9J A;  4XUS A;  1QLN A;  1L5U A;  4XQ8 A;  4R8U A;  1ZJM A;  2BE3 A;  3PW7 A;  3GII A;  1ZQA A;  5DG7 A;  3ZD8 A;  2PFP A;  4F92 B;  2BPF A;  1SZP A;  4QWE A;  3QE9 Y;  3M9O B;  2R8I A;  1HUZ A;  2KZM A;  8ICK A;  3N4M B;  3ZDA A;  1JAJ A;  2NRK A;  4EBC A;  4NKT A;  4KLT A;  3RH5 A;  5HRE A;  4RT3 A;  5KFV A;  4M9G A;  4RWP A;  1CUK A;  2FPK A;  2Q0Z X;  1TK8 A;  5KG1 A;  5EWF A;  4EEY A;  5DB6 A;  2A1J B;  5IIM A;  3UXP A;  3WFO A;  2ASJ A;  4RQ5 A;  4C8N A;  1ZQX A;  5DED A;  3B0X A;  4WCW A;  4FH5 A;  2M2T A;  8ICP A;  1B22 A;  4QZE A;  7ICL A;  2ZTE A;  2NRV A;  1S97 A;  4IR1 A;  4ECY A;  1K1Q A;  2Y1J A;  3AQK A;  2HHS A;  3OHA A;  3N97 B;  2AU0 A;  4DOC A;  1TAU A;  4KLG A;  4KLM A;  4IQV A;  4DS5 A;  8ICA A;  1R8C A;  2UVR A;  5KFB A;  4LVS A;  5EWG A;  1MC8 A;  1ZQO A;  2IMW P;  5J2D A;  5CWR A;  3ISB A;  2ATL A;  2JEF A;  2UVV A;  2ID1 A;  4RPZ A;  3RBD A;  2DR7 A;  1KTQ A;  3UXO A;  3OSN A;  4PGY A;  4IQU A;  4R8U B;  4QZB A;  2XCA A;  1JMS A;  5DB8 A;  3RAX A;  1ZQG A;  1R8B A;  4NKU A;  3PO4 A;  7ICJ A;  3AU2 A;  1DGS A;  3MFI A;  2XY7 A;  9ICL A;  3AQM A;  4DSJ A;  8ICU A;  4WC2 A;  3Q8M A;  5DB7 A;  3MGI A;  2O1P A;  3MR2 A;  4DSE A;  4EYH B;  4Z6E A;  4KLU A;  4MF8 A;  1NK6 A;  4QZD A;  3Q8Q B;  4X4P A;  4RQ3 A;  2BCR A;  4G3I A;  4P2H A;  3ORY A;  9ICT A;  4X5V A;  4RNM A;  4BGD A;  4E8F A;  3E2E A;  5J0X A;  4QWC A;  2ZUB A;  1T7P A;  5DDM A;  1Q78 A;  2AGQ A;  1R8A A;  1NO5 A;  3HP6 A;  4I2F A;  7ICR A;  2H5X A;  3ISC A;  5KG7 A;  4IG8 A;  3IM1 A;  4DL4 A;  1BPZ A;  2Y1I A;  1ZQC A;  4ELV A;  4DSF A;  4YG2 A;  1PZN A;  3GIM A;  4M9H A;  1YLQ A;  2W9B B;  1ARO P;  5DGA A;  1L3V A;  4IRK A;  3TQ1 A;  1U45 A;  7ICN A;  4YFK A;  1XU4 A;  1TFR A;  5C5J A;  3JPT A;  1U49 A;  2O5A A;  4AT7 B;  5HP4 A;  3QEA Z;  4X4T A;  1COO A;  4I2B A;  4M6W A;  4RQ6 A;  2UVU A;  5J0W A;  4C8L A;  5IIN A;  3QZ8 A;  2I9G A;  8ICB A;  4FHW A;  1JN3 A;  2JZB B;  3HW8 A;  4NLK A;  2BQ3 A;  5KFT A;  4QZF A;  4B9M A;  7ICH A;  1KRP A;  1X9M A;  3TAP A;  4TUP A;  5HRF A;  2JZB A;  4P4P A;  1SKS A;  2J6T A;  1EXN A;  2ZH5 A;  5CJ7 A;  3EPG A;  3JPP A;  2HHP A;  1JXE A;  1H38 A;  5DQG A;  3C1Z A;  3H38 A;  4O5K A;  2JEG A;  4J9Q A;  4X4S A;  3PNC A;  3JPQ A;  1NOM A;  1U4B A;  1RXV A;  1HUO A;  4O3S A;  2M2W A;  4ED1 A;  1RYR A;  5KT2 A;  4F4Z A;  3EZ5 A;  5HRK A;  2KP7 A;  4X4Q A;  1ZQQ A;  4DSL A;  5D49 A;  4DL2 A;  2ZH8 A;  2BCS A;  3M9M B;  4IQW A;  5KFE A;  9ICC A;  5CB1 A;  5DB9 A;  2FPM A;  4J9O A;  5IIL A;  1S76 D;  4TUS A;  2XCP A;  2DR8 A;  4ECQ A;  7ICK A;  5J2H A;  4B9U A;  4UB2 A;  4Q43 A;  7ICO A;  4O0I A;  4LT6 A;  5III A;  2ZJA A;  4RQ4 A;  2HHT A;  2HVH A;  3MAB A;  5DKW A;  3JPN A;  4EBE A;  1S0O A;  4RQ8 A;  4RZR A;  3Q8R B;  4ECT A;  4KLJ A;  4WC5 A;  5CHG A;  9ICO A;  5HRB A;  1NK4 A;  1BPY A;  1ZQM A;  1ZET A;  2M2V A;  1MIW A;  3C2L A;  3PVX A;  3H4B A;  1ZQB A;  1QSY A;  4ECX A;  1BPD A;  4DLG A;  4KN7 A;  5F9N A;  4J9M A;  1BGX T;  4O9M A;  1BPB A;  1RPL A;  1NJX A;  5HML A;  7ICF A;  2XY6 A;  2DPI A;  3GFK B;  5KT4 A;  1VJ7 A;  3RRG A;  3SV3 A;  5J0T A;  3PW5 A;  1SKR A;  8ICY A;  3TAR A;  4RQ7 A;  4QWB A;  2BHN A;  5IIK A;  3GV7 B;  4B9S A;  4S3N A;  3OVA A;  5KFK A;  2W8L A;  4Q8F A;  1MIV A;  3HWT A;  1SL2 A;  3NTU A;  4NM2 A;  3LWM A;  3C5G A;  3V7J A;  2Q66 A;  4XA5 A;  2VA8 A;  3MGH A;  3GIL A;  4ED3 A;  2C2R A;  2JEJ A;  4RQ2 A;  5J0S A;  3ISD A;  2DFL A;  4KLL A;  5J29 A;  5KFM A;  1XO1 A;  5J0Q A;  1NJW A;  3H40 A;  4F3O A;  4I29 A;  4M2Y A;  1NZP A;  2R8K A;  4WC0 A;  1TKD A;  5BPC A;  3BQT A;  4PGX A;  3JPR A;  5KFD A;  5J0P A;  5KG6 A;  4YR2 A;  4ECV A;  4M5D A;  1D9F A;  1ZYQ A;  1L3U A;  3MBY A;  1U48 A;  1ZQN A;  1R89 A;  3UPS A;  5J2C A;  4X0B A;  1T3N A;  4I2G A;  1UA1 A;  1XC9 A;  1SKW A;  3WFQ E;  4JUZ A;  5J2I A;  1ZQL A;  2I1Q A;  1SL1 A;  1ZQU A;  4ELU A;  2MUT B;  4F50 A;  2A1J A;  3QZ7 A;  5KTQ A;  4E80 A;  1S10 A;  4B9N A;  3LWL A;  1Z3E B;  5J2B A;  3OV7 A;  1XSP A;  2DRA A;  1BVS A;  1TVA A;  5HRL A;  4YMM A;  8ICM A;  2RDJ A;  1Q79 A;  5KFY A;  5KT7 A;  4J9P A;  4GXK A;  3LDA A;  4PHP A;  2V4R A;  1X9S A;  5J2J A;  5DLF A;  8ICC A;  1UEV A;  5KFS A;  5KG0 A;  2DR5 A;  5KFI A;  5J0R A;  4I2I A;  4PGQ A;  3M8R A;  2B21 A;  4DL6 A;  4ECZ A;  3EWA A;  4I2A A;  4ECS A;  3OJU A;  4P4M A;  1ZQK A;  4YQW A;  1LV5 A;  1KNY A;  2V4Q A;  2HHU A;  4X4N A;  4NY8 A;  2PXI A;  2OWO A;  5KFG A;  5DBB A;  4UAW A;  1NKB A;  1JXL A;  9ICK A;  2ZJ8 A;  5HRH A;  1ZQV A;  8ICF A;  4NXZ A;  4UB1 A;  5HMM A;  3EPI A;  4M6W B;  4F5R A;  5CP2 A;  2BPC A;  4JK1 A;  5KFF A;  3PW0 A;  3KHR A;  9ICQ A;  2PBE A;  1S0M A;  3HX0 A;  5J2A A;  1NJY A;  7ICU A;  1NK8 A;  3JZ0 A;  5KFN A;  4DFK A;  4YMO A;  3TI0 A;  3QEB Z;  2BPG A;  3AUO A;  4M04 A;  1S77 D;  3V7K A;  4FHV A;  3Q8L A;  1FA0 A;  2J6U A;  2GWS A;  5J0O A;  8ICI A;  2W9C A;  1ZQY A;  4FS1 A;  3PW2 A;  4O3N A;  4YCX A;  4IR9 A;  4R63 A;  4CCH A;  2F1J A;  4E0D A;  1XWL A;  5DBA A;  4C8M A;  5J2G A;  4ED0 A;  4MF2 A;  1NK9 A;  4DWI A;  2ASL A;  3RRH A;  2PFO A;  2M2U A;  2ZTC A;  4JV1 A;  5HRD A;  4DQP A;  4RWN A;  2F1H A;  1OU5 A;  4UB4 A;  4WC6 A;  2MAX A;  3WFR E;  4F91 B;  4QZC A;  3MR6 A;  4P4O A;  4X4R A;  1ZQP A;  7ICI A;  2FPL A;  9ICB A;  3PX0 A;  9ICE A;  5KFJ A;  2DVI A;  4KLH A;  1K1S A;  4M9N A;  8ICW A;  2HW3 A;  1N56 A;  1XS9 D;  9ICN A;  4ECR A;  4F5Q A;  3MR5 A;  5D4B A;  1WCN A;  3UQ2 A;  1UA0 A;  4WC7 A;  5HRG A;  9ICJ A;  1DK2 A;  5KFR A;  5J0U A;  4QWD A;  1TK5 A;  3GQC A;  5DQI A;  1ZQS A;  3ZDD A;  5KG2 A;  2BKE A;  2HHX A;  2ALZ A;  2HHQ A;  3BJY A;  5DEC A;  4F2S A;  2IA6 A;  1ZQF A;  5DBC A;  4RUC A;  2VA2 A;  3OJS A;  1JIH A;  1T4G A;  3C23 A;  4UBB A;  3H3A A;  2XO7 A;  3B0Y A;  4UB5 A;  1KDH A;  5KG4 A;  1ZQD A;  4YVZ A;  1NKC A;  3RJH A;  4QZH A;  4AT9 A;  4DFJ A;  4I2D A;  4E7X A;  2BGW A;  3PR5 B;  4RWO A;  2ZHB A;  3JPS A;  4DL7 A;  3KHH A;  9ICM A;  1NK7 A;  3UPQ A;  4GC7 A;  8ICE A;  3PMN A;  4GC6 A;  2VAN A;  2ZUD A;  1A77 A;  1ZQW A;  1Y88 A;  5DLG A;  3RH4 A;  4RNO A;  5CR0 A;  4EP7 A;  4FBT A;  2ZH6 A;  1BPE A;  4I28 A;  4O5E A;  4MFA A;  2KFN A;  7ICM A;  4GLX A;  4RQ0 A;  2C28 A;  5HHH A;  2ZTD A;  3RJE A;  1RZT A;  2KFZ A;  4BWJ A;  4ED8 A;  4I2E A;  2KTQ A;  1BNP A;  5F9L A;  3SZ2 A;  4YP3 A;  4WC1 A;  5L9X A;  3AU6 A;  2WTF A;  4JWN A;  3RJI A;  2BCQ A;  5KT6 A;  9ICS A;  4FO6 A;  3WFP A;  5KG3 A;  4UBC A;  3SYZ A;  8ICV A;  3RR8 A;  3EW9 A;  4BWM A;  2ZJ5 A;  4F4K A;  2BR0 A;  5KFZ A;  8ICH A;  3TAN A;  3V6K A;  1RYS A;  2W9A A;  4UAY A;  4ED2 A;  3KHL A;  8ICR A;  4K4I A;  3OVB A;  3RJJ A;  4FBU A;  3PW4 A;  4BDP A;  4EZ9 A;  4DS4 A;  4K4G A;  7ICV A;  5DQH A;  2NRX A;  4TUQ A;  3M9N B;  4DOB A;  7ICS A;  4BXO B;  5KT5 A;  2C2D A;  3HIY A;  4UAZ A;  5IIO A;  4DL3 A;  4TQR A;  1ZQZ A;  3RB0 A;  4AT8 A;  5J2F A;  4AT8 B;  4PHE A;  2RDI A;  4MEX A;  3HJ4 A;  4J9R A;  3OUY B;  4DQI A;  4AT7 A;  4LZD A;  5KG5 A;  3PO5 A;  4DSK A;  4Z6C A;  3JYY A;  3GDX A;  4EBJ A;  3PX6 A;  3G6X A;  3RJF A;  1KEJ A;  4J9L A;  1NJZ A;  4F8R A;  1VFG A;  4X4V A;  4IQT A;  4YD2 A;  4KTQ A;  3THV A;  4O3R A;  2XGQ A;  1U47 A;  4DF8 A;  4QW8 A;  4KLF A;  4DLE A;  4IRD A;  2F1I A;  4QZ9 A;  3RR7 A;  1N48 A;  4B9T A;  4DSI A;  1V4A A;  2BQU A;  1L3T A;  9ICF A;  4YD1 A;  7ICP A;  3PML A;  3JPO A;  2KZ3 A;  1D8L A;  7ICE A;  3C18 A;  3RH6 A;  4WC3 A;  2BDP A;  3IHQ B;  2FMP A;  4B9L A;  2NRT A;  4F5P A;  3FDS A;  4YMN A;  1X9W A;  7ICQ A;  4PPX A;  1IM4 A;  3KTQ A;  9ICW A;  4QW9 A;  4QWA A;  5J2E A;  3GV8 B;  2BCU A;  3RJK A;  1ZQJ A;  4B9V A;  1JQR A;  4MFF A;  2R8J A;  3PV8 A;  4IRC A;  5DGB A;  3PX4 A;  2ZH9 A;  4UB3 A;  4EZ6 A;  1HJP A;  4YR3 A;  1MSW D;  1KFT A;  4NM1 A;  5HHI A;  3LK9 A;  3C5F A;  3T5K A;  4DFM A;  1ZQT A;  4I2H A;  4NLG A;  1F5A A;  4QZG A;  5TZV A;  4DQQ A;  3K75 D;  5KFX A;  4YR0 A;  4DF4 A;  4XQ7 A;  3WFS C;  5KT3 A;  1UET A;  3PY8 A;  5EOZ A;  3H7I A;  2JEI A;  3G6V A;  3T3F A;  4KLI A;  4ECU A;  4KLS A;  5BOL A;  4F4X A;  3H39 A;  4GXJ A;  3RAQ A;  5F2V O;  3H8S A;  2C2E A;  1TFY A;  8ICS A;  4KLE A;  3C1Y A;  4RPY A;  3T5J A;  3RB4 A;  2P6R A;  4DEZ A;  4FHY A;  4F2R A;  3FYH A;  4F5N A;  5IIJ A;  3T5H A;  4FH3 A;  1A76 A;  4GXI A;  1C7Y A;  2MUT A; 
#chains in the Genus database with same CATH topology
 1NK0 A;  2IHN A;  4ED6 A;  2DRB A;  3NVV A;  4X0A A;  1QSS A;  4QZA A;  2AQ4 A;  2HHV A;  4R66 A;  4Q8E A;  4LEY A;  4RT2 A;  4I27 A;  4AYB C;  7ICG A;  3Q8K A;  2EAP A;  1KL9 A;  3RBE A;  4JWM A;  2WAQ C;  3NKU A;  1TAQ A;  1L7O A;  3H0R B;  5EE9 A;  1U9L A;  4UB6 U;  1ZQE A;  1UQV A;  2FMS A;  4PH5 A;  4EBK A;  1LB2 B;  5EE0 A;  1NZB A;  4ZH4 A;  1KLN A;  4EYI B;  4EED A;  2N1R A;  3ZDB A;  8ICT A;  2KN7 A;  3V7L A;  2HBL A;  4UD4 A;  4JB3 A;  2FLP A;  2R8H A;  4C8K A;  1TE2 A;  1OXJ A;  4Y2P A;  1XSN A;  4F5O A;  4US8 A;  3HJ1 A;  3UQ0 A;  4B9T A;  4DSI A;  4RWQ A;  8ICN A;  3L5K A;  1XSL A;  5J2K A;  2FCL A;  1WWV A;  3CK6 A;  4DQS A;  4KIT B;  2NRZ A;  3V6H A;  8ICX A;  4OAI Z;  2W8K A;  3MFH A;  5B3Q A;  4ED7 A;  9ICA A;  2FLL A;  1QQ5 A;  4G9B A;  1F5S A;  4OD0 A;  4Z6F A;  5D46 A;  1L7M A;  2RLT A;  8ICQ A;  4J9N A;  2R18 A;  1WOT A;  1JRO A;  3RB6 A;  4O3P A;  2KKV A;  2BCV A;  1VDV A;  3MR3 A;  1QSL A;  3E58 A;  5AIC A;  3KZI U;  2PFQ A;  4J9K A;  1N2X A;  1PVR A;  5HRI A;  4X4O A;  3OUY A;  2ZG6 A;  3H8J A;  1KQQ A;  1Z00 A;  2H3Q A;  5ALP A;  4FS2 A;  4R64 A;  2OXO A;  5KFP A;  5ALI A;  4JV2 A;  2ZIW B;  2ISP A;  4HYK A;  3PR4 A;  3QUQ A;  3F5E A;  4O3O A;  5KFA A;  3BQ2 A;  1PVP A;  4J9S A;  3V6J A;  5ALJ A;  4XUS A;  2BE3 A;  3GII A;  3ZD8 A;  4F92 B;  2LM4 A;  4QWE A;  3QE9 Y;  2W04 A;  8ICK A;  1HIW A;  4OJ5 A;  4M9G A;  4RWP A;  4C4R A;  1TK8 A;  1PUZ A;  5KG1 A;  4EEY A;  5ALH A;  3UXP A;  2E3T A;  2OH2 A;  2IOF K;  4QZE A;  7ICL A;  3HJE A;  1XNS A;  5ALR A;  4IR1 A;  2QB0 B;  3ED5 A;  2KVC A;  4USA A;  4IQV A;  4DS5 A;  2A19 A;  4XJE A;  1ZQO A;  5J2D A;  3ISB A;  2JEF A;  4Y2U A;  3UXO A;  2H3F A;  2XCA A;  4IQU A;  1ZQG A;  1DGS A;  2HN2 A;  4WC2 A;  3Q8M A;  4C7Z A;  3MR2 A;  1VJ5 A;  4KLU A;  2KSO B;  3Q8Q B;  4X4P A;  4RQ3 A;  4G3I A;  3ORY A;  3D6J A;  2KOB A;  4IL6 U;  1Q78 A;  3H8M A;  3NRZ A;  4K9A A;  2H5X A;  5KG7 A;  2B6G A;  1BPZ A;  4ELV A;  1UPH A;  3GIM A;  3HKZ C;  4IRK A;  7ICN A;  1RG6 A;  4AT7 B;  1TFR A;  1Q3V A;  5HP4 A;  4RQ6 A;  5CFU A;  5IIN A;  4FHW A;  3HW8 A;  3F2C A;  4B9M A;  1S5L U;  1X9M A;  2JZB A;  1SKS A;  1TAM A;  5CJ7 A;  1IG6 A;  2LPE A;  3JPQ A;  1U4B A;  4F4Z A;  3SEN A;  3EZ5 A;  4DSL A;  4NXW A;  5D49 A;  5CB1 A;  2FPM A;  4J9O A;  2HOF A;  2DKX A;  5JTI A;  4LT6 A;  3DDH A;  4O0I A;  2HHT A;  1MN8 A;  1S0O A;  4X4T A;  3BZC A;  1BPY A;  1QSY A;  1WG8 A;  4DLG A;  5F9N A;  2BBJ A;  4J9M A;  2LI6 A;  7ICF A;  1L8O A;  4Y2Y A;  2YB4 A;  2CN1 A;  5J0T A;  4QWB A;  2BHN A;  5IIK A;  2WF7 A;  5KFK A;  3WK7 A;  4GIB A;  1MIV A;  3HWT A;  2JH1 A;  4RQ2 A;  1PK1 A;  2DFL A;  1NZP A;  3I28 A;  4I29 A;  1TKD A;  4PGX A;  1ZYQ A;  1ZQN A;  1SWW A;  1SKW A;  5J2I A;  1SL1 A;  1ZQU A;  4E80 A;  2MUT B;  1S10 A;  5AI0 A;  3AQF A;  5J2B A;  1PVQ A;  1F44 A;  1BVS A;  3IG8 A;  1TVA A;  3BQ7 A;  5HRL A;  5KFY A;  5KT7 A;  4PHP A;  8ICC A;  4OAF A;  5KG0 A;  2YB1 A;  4HAI A;  5ALE A;  4I2I A;  3M8R A;  2D6F C;  2B21 A;  4ECZ A;  3EWA A;  2WF5 A;  1A6S A;  5JRT A;  1KNY A;  1RDF A;  3AN1 A;  1L8L A;  1JXL A;  2B4V A;  9ICK A;  1ZQ1 C;  3SQI A;  2OYY A;  4M6W B;  2HBK A;  5CP2 A;  2DL0 A;  3TAD A;  5KFF A;  9ICQ A;  3SAF A;  3HX0 A;  2ZXI A;  1KBU A;  4DFK A;  4YMO A;  4CGZ A;  3AUO A;  3BS7 A;  4M04 A;  4FHV A;  3Q8L A;  1FA0 A;  5J0O A;  3WU2 U;  4FS1 A;  4O3N A;  4YCX A;  4IR9 A;  4CCH A;  4IQW A;  4C8M A;  1NK9 A;  4DWI A;  4O6A A;  4OO1 J;  1JUD A;  4DQP A;  2KD1 A;  1QH9 A;  1OU5 A;  1SIJ A;  3WFR E;  3J81 j;  1IV8 A;  1WUD A;  7ICI A;  9ICE A;  5KFJ A;  4KLH A;  4M9N A;  1XS9 D;  2Y0S C;  4ECR A;  2KJ8 A;  3ETR A;  3MR5 A;  5D4B A;  4WC7 A;  5AIA A;  1DK2 A;  4GFJ A;  3ZI4 A;  5AHX A;  5DEC A;  2KIW A;  3CW2 C;  4RUC A;  4LEZ A;  1T4G A;  2XO7 A;  4YVZ A;  1NKC A;  4DFJ A;  3IRU A;  4E7X A;  2DBY A;  4DL7 A;  9ICM A;  4GC6 A;  2GOL A;  2ZUD A;  2G5H B;  2QKQ A;  2KJ5 A;  2YY6 A;  1BPE A;  2KFN A;  4GLX A;  3E0F A;  2ZTD A;  2KFZ A;  5F9L A;  4WC1 A;  4JWN A;  3RJI A;  3WKB A;  2BCQ A;  4FO6 A;  8ICV A;  2RRD A;  2ZIU A;  2NYV A;  4U7C A;  2CRX A;  1JI7 A;  2OHF A;  3NVW A;  8ICR A;  4P0Q B;  4K4I A;  4FE3 A;  3PW4 A;  7ICV A;  2EZX A;  3S6J A;  4DS4 A;  3M9N B;  5AK5 A;  5K4L A;  4UAZ A;  4TQR A;  4Y2T A;  1FEZ A;  4MEX A;  4EEN A;  2F3N A;  4DQI A;  5KG5 A;  3GDX A;  3RJF A;  1Q3U A;  4YD2 A;  2QLT A;  4Y2S A;  4DF8 A;  4QW8 A;  4IRD A;  4QZ9 A;  4NWI A;  2LKY A;  1V4A A;  2BQU A;  2MRL A;  3JPO A;  1D8L A;  7ICE A;  4B9L A;  2OCE A;  2VIX A;  4PPX A;  1SV0 A;  3GV8 B;  5D61 A;  3SR6 A;  4CF5 A;  2ZH9 A;  4UB3 A;  4EZ6 A;  1HJP A;  2ZIX A;  4YR3 A;  5ALS A;  3C5F A;  3T5K A;  1F5A A;  4QJF B;  2DWQ A;  3K75 D;  2M0N A;  4DF4 A;  5KFX A;  1GPJ A;  4XQ7 A;  2DQN B;  1RQL A;  3G6V A;  3H39 A;  2KNJ A;  5BOL A;  3RAQ A;  5JTG A;  3H8S A;  4U6P A;  1TFY A;  8ICS A;  2HCF A;  2DF4 B;  2P6R A;  2WB1 C;  5AM5 A;  4EEK A;  4FH3 A;  4B6J A;  1C7Y A;  4I2J A;  2FJ6 A;  2YMM A;  4FHX A;  2GH1 A;  4MFC A;  2LHT A;  3HT3 A;  2QB0 A;  1MQ2 A;  1VLB A;  4K4H A;  4BXO A;  3LQC B;  2G5I B;  1UT8 A;  3ZDE A;  9ICH A;  1URJ A;  9ICR A;  5BOM A;  4ECW A;  1TK0 A;  2HVI A;  2ZXH A;  4UD5 A;  2PFN A;  4WQL A;  4TUR A;  5ALZ A;  5B3P A;  4KLO A;  3RFA A;  2P66 A;  3SI8 A;  9ICU A;  4UQG A;  1UT5 A;  1DOQ A;  2J6U A;  4RNN A;  4F93 B;  2AQ0 A;  1RXW A;  4I2C A;  4M47 A;  3T5L A;  4KLD A;  4M9L A;  4QZI A;  3K1R B;  8ICO A;  3HRD D;  3BS5 A;  3HPO A;  1IXR A;  3ETL A;  3NRW A;  1N5W A;  5KFC A;  3TAQ A;  1MIY A;  1SV0 C;  1QTM A;  2ODG A;  1TFW A;  5GTI U;  2CPR A;  2H3V A;  3PZP A;  4R65 A;  2A3V A;  5KFL A;  3H37 A;  4DL5 A;  4MEY A;  1DRG A;  5DDY A;  3QYP A;  4ATB B;  1IIP A;  4RPX A;  1KFS A;  4K99 A;  3TFR A;  2DPJ A;  1MQ3 A;  2BZF A;  5AK6 A;  3GV5 B;  1N5X A;  1TV9 A;  1D8Y A;  3CYM A;  3GIK A;  3OVS A;  2W9B A;  1SB3 C;  2WAQ F;  2KJ9 A;  3AQN A;  1SZH A;  4PHD A;  1SGG A;  3F5A A;  1T8E A;  5G5G A;  5KFO A;  5AI4 A;  2ZH2 A;  4DFP A;  4US9 A;  5ALG A;  3RB3 A;  5ALK A;  1PX5 A;  2M9N A;  2G09 A;  1V97 A;  5HNK A;  4OAH A;  9ICG A;  3OPX A;  4C0Z A;  3IDW A;  1L3S A;  5KFQ A;  5ALN A;  4M9J A;  1QLN A;  4XQ8 A;  4NXV A;  2BBH A;  1Z19 A;  1C20 A;  4RQN A;  4NXU A;  1HUZ A;  2NRK A;  3N4M B;  2XIC A;  3RH5 A;  4KLT A;  5KFV A;  1CUK A;  3F53 A;  4PZN A;  3F2D A;  2F8K A;  5DB6 A;  3WFO A;  5DED A;  4WCW A;  2MA1 A;  4F71 A;  5B5E U;  2Y1J A;  3AQK A;  2HHS A;  5KL1 B;  2AU0 A;  5CFS A;  4KLG A;  2EWR A;  4KLM A;  2UVR A;  2ID1 A;  2ATL A;  1K5O A;  3WKC A;  1R8B A;  1JMS A;  5DB8 A;  3RAX A;  4NKU A;  2QAR A;  2LYA A;  3PO4 A;  3MFI A;  1N61 A;  9ICL A;  5AKH A;  3MGI A;  2Y0S F;  4EYH B;  1NK6 A;  3WKD A;  3UM9 A;  2BCR A;  4EEB A;  4OJP A;  2LMR A;  4BGD A;  2E8O A;  1NI3 A;  4QWC A;  2ZUB A;  4CF4 A;  5TIS U;  4CE6 A;  1QQ6 A;  2VKQ A;  1ZQC A;  3NVO A;  4KX3 A;  4YFK A;  1XU4 A;  5C5J A;  2B56 A;  3QEA Z;  2YMP A;  4K98 A;  1COO A;  4I2B A;  2AXT U;  2WF6 A;  2AHO B;  1N62 A;  2G0A A;  5J0W A;  1DXS A;  2EAM A;  2I9G A;  2F44 A;  2JZB B;  2BQ3 A;  5KFT A;  5HRF A;  1EXN A;  5DQG A;  4UAT A;  2JEG A;  4ZOH C;  1RXV A;  4ED1 A;  1RYR A;  4X4Q A;  2BCS A;  5KFE A;  1S76 D;  2YML A;  4TUS A;  4ECQ A;  5J2H A;  4UB2 A;  1FIQ A;  3WKA A;  2ESE A;  4WC5 A;  4KLJ A;  5F3X B;  1ZQM A;  1S8O A;  3C2L A;  3H4B A;  4ECX A;  1BGX T;  1NJX A;  5HML A;  1LKY B;  1VJ7 A;  3RRG A;  5GTH U;  3SV3 A;  1SKR A;  8ICY A;  3TAR A;  1Q46 A;  3A0B U;  3OVA A;  4Q8F A;  2ZIW A;  3NTU A;  3GIL A;  5KFM A;  5J0Q A;  1M6Y A;  1T3Q A;  2OEH A;  3NAS A;  2IOH A;  5KFD A;  4ECV A;  5KG6 A;  4YR2 A;  4WOY A;  1D9F A;  1L3U A;  1R89 A;  3MBY A;  5CEH A;  4JUZ A;  2HOQ A;  2G06 A;  4F50 A;  3QZ7 A;  4FZN A;  5AKG A;  2H3Z A;  3K7D A;  1Q79 A;  3LDA A;  1YZ7 A;  1X9S A;  4PGQ A;  4DL6 A;  4P4M A;  3IV6 A;  4YQW A;  5KFG A;  4UAW A;  3U26 A;  1NKB A;  1OW5 A;  8ICF A;  3ER8 C;  3EPI A;  4JK1 A;  3SEI A;  7ICU A;  2BPG A;  3TI0 A;  1S77 D;  3V7K A;  1KN5 A;  1V85 A;  2VJ4 A;  1ZQY A;  3PW2 A;  3N28 A;  4R63 A;  4NY8 A;  5J2G A;  4O68 A;  4NL9 A;  3C29 A;  2ASL A;  3RRH A;  2M2U A;  2ZTC A;  2MU2 A;  5HRD A;  2F1H A;  1WYG A;  2MAX A;  3MR6 A;  3PX0 A;  2DVI A;  2HW3 A;  2B51 A;  9ICN A;  1HEK A;  1WCN A;  2Y9T A;  3UQ2 A;  9ICJ A;  2BDU A;  3ZDD A;  5KG2 A;  3BJY A;  4F2S A;  3AM9 A;  5ALY A;  1ZQD A;  3B0Y A;  4AT9 A;  2BGW A;  3JPS A;  2P35 A;  1NK7 A;  3UPQ A;  8ICE A;  5ALU A;  3PMN A;  1X6I A;  1A77 A;  1PK1 B;  4BJQ A;  3TKA A;  4FBT A;  2ZH6 A;  4O5E A;  4I28 A;  4MFA A;  2C28 A;  3A0H U;  4BWJ A;  4I2E A;  3UMB A;  5L9X A;  5KT6 A;  9ICS A;  3WFP A;  5KG3 A;  3SAH A;  3SYZ A;  2BR0 A;  8ICH A;  3BZK A;  3V6K A;  2W9A A;  4FBU A;  5AKX A;  4K4G A;  2EDU A;  2YN4 A;  2YQE A;  3CNH A;  2EZY A;  3DV9 A;  5KAF U;  1UCV A;  4DL3 A;  2K60 A;  1ZQZ A;  4AT8 B;  4PHE A;  1QQ7 A;  2RDI A;  3HJ4 A;  3PSF A;  4J9R A;  3PO5 A;  3NVY A;  4Z6C A;  1VFG A;  4J9L A;  1NJZ A;  4F8R A;  3MGV A;  4IQT A;  4KTQ A;  3THV A;  2XGQ A;  4Y2V A;  4KLF A;  2PMZ F;  1LKY A;  3RR7 A;  9ICF A;  1N60 A;  2KZ3 A;  1XO0 A;  4WC3 A;  2BDP A;  3IHQ B;  3AEV A;  4WJ3 B;  2NRT A;  4F5P A;  1X9W A;  4YMN A;  4Y2X A;  1IM4 A;  3KTQ A;  4C80 A;  4QWA A;  2BCU A;  1ZQJ A;  2R8J A;  3PV8 A;  2EAN A;  5AKE A;  1PK3 A;  1KFT A;  4NM1 A;  1MA7 A;  4I2H A;  1ZQT A;  4QZG A;  1JRP A;  4YR0 A;  4CNQ A;  3VC8 A;  4FO1 A;  3MC1 A;  3AMZ A;  1L7P A;  5EOZ A;  3H7I A;  3T3F A;  2XI9 A;  5ALL A;  1ZRN A;  3T5J A;  4RPY A;  4DEZ A;  1ZD2 P;  3M7D A;  4FHY A;  4GXI A;  3NS1 A;  4KN4 A;  4F72 A;  3KKA A;  4YXM A;  2ZH7 A;  1V9P A;  3ZD9 A;  4LZG A;  4WC4 A;  4WBY A;  4FZL A;  2JR5 A;  3MDC A;  3TFS A;  4CDG A;  2HBM A;  3RJG A;  3H8W A;  3BS5 B;  3ERC C;  4Q44 A;  3JCF A;  2RFF A;  4EX6 A;  3WK4 A;  2UVW A;  4AT9 B;  2VJ5 A;  2PI5 A;  3BQ0 A;  2W9C B;  1ZQH A;  4BX9 C;  2KZZ A;  1O03 A;  4NLZ A;  2XY5 A;  2ZIV B;  2NRW A;  5HC9 A;  1ZD4 A;  3G6Y A;  3QUT A;  2W9M A;  1N63 A;  3FC4 A;  1X6J A;  2WF9 A;  1ZQI A;  2R8G A;  1D9D A;  4ATB A;  3AQL A;  2G08 A;  3B9J A;  3R9K A;  3QNM A;  4KLQ A;  3M8S A;  2FMQ A;  1ZQR A;  2AGO A;  2ZH8 A;  2FLN A;  4EBD A;  2BQR A;  4RQ1 A;  3D2N A;  2LYH A;  1SL0 A;  1UEU A;  2ISO A;  1S0N A;  2HI0 A;  3MDA A;  8ICL A;  3C66 A;  5JUM A;  4TQS A;  2PI4 A;  5L1I A;  1NKE A;  8ICZ A;  2KEY A;  9ICI A;  5E79 U;  3F2B A;  2W7O A;  2AJQ A;  1SXE A;  3OHB A;  1RYU A;  3PSP A;  1J2N A;  5DG9 A;  2XID A;  4O5C A;  3KHG A;  4O3M A;  4DOA A;  3CP8 A;  3OSP A;  4Y2R A;  1S0V A;  5AM1 A;  3H4D A;  1SV4 A;  2RP5 A;  2YMQ A;  1T94 A;  2HN1 A;  4FHP A;  4NLN A;  1Q8K A;  5AIB A;  4C8O A;  3SV4 A;  1FFV A;  5KFH A;  5DG8 A;  1ZJN A;  1GO3 F;  4DQR A;  4NLC A;  8ICJ A;  3UXN A;  3D2S A;  1FFU A;  3RTV A;  2V9W A;  4UB8 U;  4PZO A;  4JV0 A;  3OGU A;  4M0A A;  5ALV A;  4X4U A;  2PKE A;  1YT3 A;  3K4G A;  2KIV A;  2QAR B;  3L9D A;  4EX7 A;  4RQM A;  2Q4T A;  1L5U A;  1ZJM A;  4R8U A;  4UAR A;  3PW7 A;  2KE7 A;  1ZQA A;  1SXD A;  2PFP A;  4O69 A;  5AM0 A;  2BPF A;  2KZM A;  4NKT A;  4EBC A;  5HRE A;  4EGW A;  1J2M A;  4UAS A;  1P7D A;  5IIM A;  2ASJ A;  4C8N A;  1ZQX A;  5ALT A;  3B0X A;  4CF3 A;  2M2T A;  8ICP A;  3SAG A;  1B22 A;  2ZTE A;  2NRV A;  4PL1 A;  1S97 A;  4ECY A;  2DUY A;  3OHA A;  3N97 B;  4DOC A;  1R8C A;  2OM6 A;  5KFB A;  4LVS A;  5EWG A;  1MC8 A;  2IMW P;  5D62 A;  5CWR A;  2UVV A;  4QZB A;  2JXJ A;  3AU2 A;  4DSJ A;  8ICU A;  2W54 A;  4DSE A;  4LEW A;  4MF8 A;  4QIW C;  2K4E A;  2NO5 A;  1QCK A;  3E2E A;  2YTU A;  2YX8 A;  5J0X A;  5JU5 A;  2AGQ A;  3IM1 A;  3LVV A;  5AM4 A;  2Y1I A;  4M9H A;  5A0L A;  2W9B B;  5DGA A;  1L3V A;  3N7S C;  3JPT A;  4NJ8 A;  3QZ8 A;  1JN3 A;  4EEL A;  5L1M A;  7ICH A;  3OTQ A;  1KRP A;  2FE9 A;  2ZH5 A;  4P4P A;  5EE1 A;  1H38 A;  1CRX A;  3C1Z A;  3KZX A;  4O5K A;  4J9Q A;  3PNC A;  3KKA C;  1NOM A;  4O3S A;  2RQ5 A;  1HUO A;  3QUC A;  4JMU A;  5HRK A;  4KM5 A;  4DL2 A;  2O6K A;  4OJ6 A;  5ALO A;  9ICC A;  2K4I A;  5IIL A;  4NXT A;  3EUB 2;  2XCP A;  4WQK A;  2DR8 A;  7ICK A;  4B9U A;  2QB1 A;  7ICO A;  2ZJA A;  2HVH A;  3MAB A;  5DKW A;  3JPN A;  4RQ8 A;  4RZR A;  1KW4 A;  2XVT A;  3Q8R B;  1KKX A;  2GA9 D;  1NK4 A;  1ZET A;  3PVX A;  3IG5 A;  4P0P B;  1RPL A;  3LYS A;  2XY6 A;  5HR7 A;  3GV7 B;  2E1E A;  4S3N A;  2W8L A;  3SD7 A;  3FAH A;  4NM2 A;  3LWM A;  3V7J A;  2Q66 A;  3MGH A;  2VA8 A;  2C2R A;  2JEJ A;  3WK5 A;  3ISD A;  1XO1 A;  4M2Y A;  4A8E A;  4NXX A;  3ONN A;  3BQT A;  3JPR A;  2WFA A;  5J0P A;  4M5D A;  1U48 A;  2CXY A;  4NLB A;  4PL2 A;  4I2G A;  1XC9 A;  3WFQ E;  2I1Q A;  3SMV A;  2A1J A;  5KTQ A;  1Z3E B;  1XSP A;  2DRA A;  5CFT A;  2I5H A;  3WK8 A;  2K89 A;  2HBJ A;  2V4R A;  3PHZ A;  5DLF A;  2DR5 A;  5KFI A;  5J0R A;  3ALR A;  4LJX A;  1ED1 A;  4I2A A;  4ECS A;  5FP0 A;  4X4N A;  2PXI A;  3I76 A;  2ZJ8 A;  5HRH A;  4UB1 A;  2E5S A;  5HMM A;  2H3I A;  4F5R A;  3KHR A;  2PBE A;  2JH7 A;  3VCB A;  5J2A A;  1NJY A;  3JZ0 A;  4AYB F;  1B0X A;  1ECW A;  2GWS A;  8ICI A;  2W9C A;  5ALQ A;  4MHV A;  4K8V A;  2F1J A;  4ED0 A;  3PSI A;  4JV1 A;  4WH5 A;  4RWN A;  5AKZ A;  4FZM A;  4WC6 A;  4P4O A;  4KMO B;  1ZQP A;  4OJL A;  2B0C A;  1X42 A;  5KAI U;  3N7P D;  2HDO A;  1Z4O A;  2KKP A;  5KFR A;  4JLX A;  2HHX A;  2BKE A;  3AL0 B;  3CRX A;  2ALZ A;  3GU3 A;  1ZQF A;  2IA6 A;  5DBC A;  3OJS A;  3C23 A;  3H3A A;  2ZIU B;  4UB5 A;  1KDH A;  5KG4 A;  2ZIV A;  4RWO A;  3PR5 B;  3KHH A;  4GC7 A;  1RQN A;  2KVS A;  2VAN A;  3QX7 A;  1ZQW A;  2ZIX B;  1WWU A;  2HSZ A;  4RNO A;  4EP7 A;  7ICM A;  2GLE A;  5HHH A;  3RJE A;  1RZT A;  4ED8 A;  2WTF A;  3KBB A;  4DCC A;  2NO4 A;  3EW9 A;  4BWM A;  2ZJ5 A;  4F4K A;  3H0M B;  2W03 A;  1RYS A;  4UAY A;  4ED2 A;  3OVB A;  3RJJ A;  4EZ9 A;  1ZOL A;  5DQH A;  2W55 A;  4BXO B;  2C2D A;  3M6K A;  5IIO A;  3RB0 A;  4AT8 A;  4QIW F;  1Z1B A;  4DSK A;  4IC9 A;  5ALW A;  3PX6 A;  3G6X A;  4CRX A;  4O3R A;  1U47 A;  2F1I A;  1L3T A;  2F2A B;  5ALD A;  3PML A;  3QU4 A;  3C18 A;  3RH6 A;  2K8B B;  3WKE A;  2FMP A;  2RHF A;  2LBO A;  2JRZ A;  3FDS A;  7ICQ A;  2F77 X;  2HMX A;  3RF9 A;  3RJK A;  1JQR A;  4IRC A;  4MKP A;  4J03 A;  2HOI A;  4OAG A;  4IS7 A;  1MSW D;  5HHI A;  3LK9 A;  4DFM A;  5AI5 A;  3WFS C;  2EZZ A;  5KT3 A;  3PY8 A;  4KLI A;  4ECU A;  4GXJ A;  3C1Y A;  3RB4 A;  4K97 A;  3FYH A;  3HIL A;  3QUB A;  5AKK A;  2MUT A;  5EWE A;  1NK5 A;  5J8Y C;  3EYZ A;  2W11 A;  1WCL A;  1KSP A;  1S9F A;  2FI1 A;  4EV6 A;  2MSN A;  5AK3 A;  4C4S A;  4ELT A;  4XRH A;  2KHV A;  9ICX A;  1RM6 C;  2GO7 A;  2ZHA A;  4QNL A;  4Q45 A;  2P6U A;  2Z7J A;  3V72 A;  5HR9 A;  5CA7 A;  4AP9 A;  2ASD A;  5L1K A;  1KFD A;  3BQ1 A;  2ZH3 A;  2JGA A;  7ICT A;  3M6Z A;  4NL9 C;  2ZUC A;  2W43 A;  4YXJ A;  4KMU A;  1SWV A;  1ZRM A;  4UAV A;  5KFU A;  2VA3 A;  3H0L B;  3Q8S B;  1X2I A;  1CI4 A;  1JX4 A;  3UMC A;  1L6N A;  1B43 A;  2XGP A;  2ZH1 A;  2AGP A;  2GAF D;  9ICP A;  1DK3 A;  4QZ8 A;  3C2M A;  4Z6D A;  1J97 A;  2IBK A;  1OUQ A;  1BNO A;  3C21 A;  3C2K A;  2KHQ A;  8ICG A;  3EF2 A;  3L3F X;  5L1J A;  1ZD3 A;  3LVW A;  5AI6 A;  4RU9 A;  3GIJ A;  3ZDC A;  4PJ0 U;  2EAO A;  5J8Y A;  5ALF A;  4PHA A;  1UHU A;  2K8A A;  5KNI A;  3Q8P B;  4C7Y A;  1CEZ A;  4RUA A;  5J0Y A;  2J6S A;  3NGD A;  5B66 U;  3BDP A;  4F4Y A;  1Z4N A;  4BUG A;  2ZH4 A;  4O3Q A;  4DO9 A;  4YN4 A;  1Z00 B;  4KX5 A;  1D8B A;  1BPX A;  9ICV A;  3NYB A;  2C22 A;  4WBZ A;  3NWI A;  4F4W A;  2EH9 A;  5L1L A;  5AM3 A;  5KFW A;  2IHM A;  2HHW A;  2A1A A;  2XC9 A;  2IUB A;  3C28 A;  5EE3 A;  2WB1 F;  1NNL A;  3QU7 A;  4DFD A;  2E8M A;  5DG7 A;  1SZP A;  3M9O B;  2R8I A;  3ZDA A;  1JAJ A;  4RT3 A;  2IHO A;  2FPK A;  2Q0Z X;  5EWF A;  3M1Y A;  3FM9 A;  2A1J B;  4RQ5 A;  4FH5 A;  4P0P A;  2WF8 A;  1K1Q A;  3PST A;  3QXG A;  1X9X A;  3AQE A;  1TAU A;  2E8N A;  1X40 A;  2DR7 A;  4RPZ A;  3RBD A;  1KTQ A;  3OSN A;  4PGY A;  4R8U B;  3NVZ A;  7ICJ A;  2XY7 A;  3AQM A;  2O1P A;  5DB7 A;  4Z6E A;  4QZD A;  2KSO A;  4P2H A;  9ICT A;  4X5V A;  4RNM A;  4E8F A;  1T7P A;  5DDM A;  1R8A A;  1NO5 A;  2KK0 A;  3HP6 A;  4I2F A;  7ICR A;  3ISC A;  4IG8 A;  4DL4 A;  3WK9 A;  2I6X A;  4OCZ A;  4DSF A;  4YG2 A;  1PZN A;  4K9B A;  1YLQ A;  1ARO P;  3TQ1 A;  1U45 A;  2O5A A;  1U49 A;  2WHE A;  4M6W A;  2F8L A;  2UVU A;  4C8L A;  2ES6 A;  2L5Y A;  2NV3 A;  1ZXI A;  2W3S A;  8ICB A;  4NLK A;  4QZF A;  2G07 A;  3TAP A;  4TUP A;  2J6T A;  3EPG A;  2HHP A;  3JPP A;  3KFU F;  1JXE A;  3H38 A;  4X4S A;  2M2W A;  5KT2 A;  2KP7 A;  1O08 A;  1ZQQ A;  3M9M B;  2EQY A;  3KD3 A;  5DB9 A;  5HR6 A;  4Y2J A;  5AKI A;  4Q43 A;  5III A;  4RQ4 A;  4K96 A;  4EBE A;  1ZD5 A;  4ECT A;  3ER9 B;  5CHG A;  9ICO A;  5HRB A;  2K4H A;  2M2V A;  2IOF A;  1MIW A;  1ZQB A;  5ALX A;  1BPD A;  4I0U A;  4KN7 A;  4O9M A;  1BPB A;  2DPI A;  3GFK B;  5KT4 A;  3TAC B;  5AM2 A;  3IP4 B;  3PW5 A;  4RQ7 A;  4P0Q A;  4B9S A;  1SL2 A;  1F0M A;  3C5G A;  4XA5 A;  4ED3 A;  4C4T A;  5J0S A;  2D3D A;  4KLL A;  5J29 A;  1NJW A;  4F3O A;  4WC0 A;  2DR9 A;  3H40 A;  2R8K A;  5AK4 A;  5BPC A;  1DGJ A;  3OWG A;  3UPS A;  1LVH A;  2E8P A;  5J2C A;  3TAD C;  4X0B A;  1T3N A;  1UA1 A;  4KLS A;  1ZQL A;  4ELU A;  3I1Y A;  4ACO A;  4B9N A;  4HX0 A;  3LWL A;  3OV7 A;  2F76 X;  3DEE A;  4YMM A;  8ICM A;  2RDJ A;  4J9P A;  4GXK A;  1UEV A;  5J2J A;  5KFS A;  5CHE A;  3OJU A;  1ZQK A;  1LV5 A;  2V4Q A;  2HHU A;  2OWO A;  5DBB A;  1ZQV A;  4NXZ A;  2BPC A;  3PW0 A;  1S0M A;  5AI9 A;  1NK8 A;  5KFN A;  4JLZ A;  3QEB Z;  2K4P A;  2W3R A;  1COK A;  1JAL A;  4OJO A;  2JMG A;  2DKZ A;  4MF2 A;  4E0D A;  1XWL A;  5DBA A;  3T79 A;  1AQ6 A;  2FDR A;  1B4F A;  2PFO A;  3KOO A;  2JV3 A;  4LEV A;  1FO4 A;  5AKJ A;  3NUQ A;  4UB4 A;  4F91 B;  4QZC A;  5C0Y A;  4X4R A;  3WK6 A;  9ICB A;  2FPL A;  1K1S A;  8ICW A;  3QU2 A;  1N56 A;  4F5Q A;  5AI8 A;  1UA0 A;  2DGZ A;  5HRG A;  5CRX A;  3QU9 A;  5J0U A;  4QWD A;  1TK5 A;  3GQC A;  5DQI A;  1ZQS A;  1X66 A;  5AKL A;  2HHQ A;  2KMD A;  3QU5 A;  2W7P A;  2LM1 A;  2VA2 A;  4UW9 A;  1JIH A;  4UBB A;  8ICA A;  3RJH A;  4QZH A;  4I2D A;  2KV2 A;  2ZHB A;  5KL8 B;  4O67 A;  4NV0 A;  1Y88 A;  1V38 A;  5DLG A;  5T14 A;  3RH4 A;  5CR0 A;  2PMZ C;  4RQ0 A;  5G5H A;  2AH5 A;  4ICA A;  3K1Z A;  2KTQ A;  1BNP A;  3SZ2 A;  4YP3 A;  3AU6 A;  4N7R A;  4UBC A;  4FFD A;  3RR8 A;  2Y9U A;  3HKZ F;  5AKY A;  4Y2Q A;  2KIC A;  5KFZ A;  3TAN A;  3GZF A;  3KHL A;  3MCR A;  4BDP A;  2NRX A;  3N7R C;  4TUQ A;  4DOB A;  7ICS A;  3HIY A;  5KT5 A;  3ICX A;  5J2F A;  3OUY B;  4AT7 A;  4LZD A;  1L7N A;  2D8C A;  3L4P A;  3JYY A;  4EBJ A;  2JHD A;  1KEJ A;  4X4V A;  2E1F A;  5H2F U;  5D63 A;  4DLE A;  2K8C B;  1N48 A;  7ICP A;  4YD1 A;  4KB6 A;  3D2Q A;  1YZ6 A;  2LYB A;  9ICW A;  4QW9 A;  5J2E A;  4B9V A;  4MFF A;  5DGB A;  3PX4 A;  1Z1V A;  4NLG A;  4DQQ A;  5TZV A;  3O0F A;  1UET A;  2JEI A;  4F4X A;  5F2V O;  1A0P A;  5ALM A;  2C2E A;  4KLE A;  3UMG A;  4UAU A;  4F2R A;  4F5N A;  5IIJ A;  3T5H A;  3IN5 A;  1A76 A;  2KG5 A; 
#chains in the Genus database with same CATH homology
 4I2J A;  5EWE A;  1NK0 A;  2IHN A;  1NK5 A;  3EYZ A;  4KN4 A;  1WCL A;  4FHX A;  4ED6 A;  4YXM A;  4MFC A;  2ZH7 A;  1KSP A;  1V9P A;  1S9F A;  3ZD9 A;  4X0A A;  1QSS A;  2DRB A;  4QZA A;  4LZG A;  3HT3 A;  4WC4 A;  4ELT A;  2AQ4 A;  1MQ2 A;  4WBY A;  4XRH A;  2HHV A;  4R66 A;  4K4H A;  4Q8E A;  4BXO A;  3MDC A;  3LQC B;  3TFS A;  4ATB A;  9ICX A;  3ZDE A;  1UT8 A;  4RT2 A;  4I27 A;  2ZHA A;  9ICH A;  3RJG A;  7ICG A;  3H8W A;  4Q45 A;  3Q8K A;  2P6U A;  3V72 A;  5HR9 A;  9ICR A;  5BOM A;  5CA7 A;  4Q44 A;  4ECW A;  3RBE A;  1TK0 A;  4JWM A;  2HVI A;  4UD5 A;  2PFN A;  2RFF A;  1TAQ A;  4TUR A;  2ASD A;  4KLO A;  2UVW A;  5L1K A;  4AT9 B;  2P66 A;  1U9L A;  1KFD A;  2PI5 A;  3BQ1 A;  2DR9 A;  3BQ0 A;  1ZQE A;  2W9C B;  1ZQH A;  2FMS A;  2KZZ A;  4PH5 A;  3SI8 A;  9ICU A;  4EBK A;  1LB2 B;  4NLZ A;  4UQG A;  2XY5 A;  1UT5 A;  7ICT A;  2ZH3 A;  1DOQ A;  4ZH4 A;  2NRW A;  1KLN A;  4EYI B;  4RNN A;  2ZUC A;  4F93 B;  3G6Y A;  2AQ0 A;  2W9M A;  3ZDB A;  5HC9 A;  8ICT A;  2KN7 A;  3V7L A;  1RXW A;  4I2C A;  1ZQI A;  2R8G A;  1D9D A;  4M47 A;  4UD4 A;  3T5L A;  4YXJ A;  2FLP A;  2R8H A;  4C8K A;  4KLD A;  4M9L A;  4QZI A;  3AQL A;  4KMU A;  1XSN A;  4F5O A;  3M8S A;  4KLQ A;  8ICO A;  3HJ1 A;  2FMQ A;  3UQ0 A;  3HPO A;  2AGO A;  1ZQR A;  1IXR A;  5KFU A;  2FLN A;  2VA3 A;  4EBD A;  3Q8S B;  2BQR A;  3ETL A;  8ICN A;  4RWQ A;  1XSL A;  5J2K A;  1X2I A;  5KFC A;  3TAQ A;  1JX4 A;  1MIY A;  4RQ1 A;  4DQS A;  4KIT B;  2NRZ A;  1B43 A;  2LYH A;  2XGP A;  3V6H A;  1SL0 A;  1QTM A;  1UEU A;  2ISO A;  1S0N A;  8ICX A;  1TFW A;  3MDA A;  2ZH1 A;  2AGP A;  8ICL A;  3C66 A;  9ICP A;  2PI4 A;  4QZ8 A;  5JUM A;  3MFH A;  2W8K A;  3C2M A;  1DK3 A;  4Z6D A;  4TQS A;  4ED7 A;  2IBK A;  4R65 A;  2FLL A;  5L1I A;  3C21 A;  5KFL A;  3C2K A;  1NKE A;  9ICA A;  8ICZ A;  8ICG A;  9ICI A;  1BNO A;  3H37 A;  4DL5 A;  4MEY A;  5L1J A;  2AJQ A;  4Z6F A;  3OHB A;  5D46 A;  5DDY A;  4RU9 A;  4RPX A;  3GIJ A;  1KFS A;  8ICQ A;  4J9N A;  3ZDC A;  4ATB B;  5DG9 A;  3TFR A;  2DPJ A;  1MQ3 A;  4PHA A;  4O5C A;  1WOT A;  3KHG A;  3RB6 A;  3GV5 B;  4O3P A;  1D8Y A;  1TV9 A;  4DOA A;  2BCV A;  3MR3 A;  3Q8P B;  3GIK A;  1CEZ A;  1QSL A;  3OSP A;  3OVS A;  2PFQ A;  1S0V A;  2W9B A;  3H4D A;  4RUA A;  5J0Y A;  4J9K A;  2J6S A;  5HRI A;  3AQN A;  4PHD A;  4X4O A;  1T8E A;  3OUY A;  3NGD A;  3BDP A;  4F4Y A;  5KFO A;  4FHP A;  4NLN A;  2ZH2 A;  3H8J A;  4C8O A;  3SV4 A;  5KFH A;  4O3Q A;  5DG8 A;  4DO9 A;  4DFP A;  1ZJN A;  2ZH4 A;  4DQR A;  1Z00 A;  4YN4 A;  1Z00 B;  8ICJ A;  3UXN A;  1BPX A;  3RTV A;  3RB3 A;  2V9W A;  9ICV A;  1PX5 A;  2M9N A;  5KFP A;  4R64 A;  4JV0 A;  4FS2 A;  2C22 A;  5HNK A;  4JV2 A;  3NYB A;  3OGU A;  4WBZ A;  4F4W A;  5L1L A;  9ICG A;  2ISP A;  4M0A A;  4HYK A;  3PR4 A;  5KFW A;  2IHM A;  2HHW A;  4O3O A;  5KFA A;  1L3S A;  4X4U A;  2XC9 A;  5KFQ A;  3K4G A;  3BQ2 A;  4J9S A;  3V6J A;  3L9D A;  4M9J A;  4XUS A;  1QLN A;  1L5U A;  4XQ8 A;  4R8U A;  1ZJM A;  2BE3 A;  3PW7 A;  3GII A;  1ZQA A;  5DG7 A;  3ZD8 A;  2PFP A;  4F92 B;  2BPF A;  1SZP A;  4QWE A;  3QE9 Y;  3M9O B;  2R8I A;  1HUZ A;  2KZM A;  8ICK A;  3N4M B;  3ZDA A;  1JAJ A;  2NRK A;  4EBC A;  4NKT A;  4KLT A;  3RH5 A;  5HRE A;  4RT3 A;  5KFV A;  4M9G A;  4RWP A;  1CUK A;  2FPK A;  2Q0Z X;  1TK8 A;  5KG1 A;  5EWF A;  4EEY A;  5DB6 A;  2A1J B;  5IIM A;  3UXP A;  3WFO A;  2ASJ A;  4RQ5 A;  4C8N A;  1ZQX A;  5DED A;  3B0X A;  4WCW A;  4FH5 A;  2M2T A;  8ICP A;  1B22 A;  4QZE A;  7ICL A;  2ZTE A;  2NRV A;  1S97 A;  4IR1 A;  4ECY A;  1K1Q A;  2Y1J A;  3AQK A;  2HHS A;  3OHA A;  3N97 B;  2AU0 A;  4DOC A;  1TAU A;  4KLG A;  4KLM A;  4IQV A;  4DS5 A;  8ICA A;  1R8C A;  2UVR A;  5KFB A;  4LVS A;  5EWG A;  1MC8 A;  1ZQO A;  2IMW P;  5J2D A;  5CWR A;  3ISB A;  2ATL A;  2JEF A;  2UVV A;  2ID1 A;  4RPZ A;  3RBD A;  2DR7 A;  1KTQ A;  3UXO A;  3OSN A;  4PGY A;  4IQU A;  4R8U B;  4QZB A;  2XCA A;  1JMS A;  5DB8 A;  3RAX A;  1ZQG A;  1R8B A;  4NKU A;  3PO4 A;  7ICJ A;  3AU2 A;  1DGS A;  3MFI A;  2XY7 A;  9ICL A;  3AQM A;  4DSJ A;  8ICU A;  4WC2 A;  3Q8M A;  5DB7 A;  3MGI A;  2O1P A;  3MR2 A;  4DSE A;  4EYH B;  4Z6E A;  4KLU A;  4MF8 A;  1NK6 A;  4QZD A;  3Q8Q B;  4X4P A;  4RQ3 A;  2BCR A;  4G3I A;  4P2H A;  3ORY A;  9ICT A;  4X5V A;  4RNM A;  4BGD A;  4E8F A;  3E2E A;  5J0X A;  4QWC A;  2ZUB A;  1T7P A;  5DDM A;  1Q78 A;  2AGQ A;  1R8A A;  1NO5 A;  3HP6 A;  4I2F A;  7ICR A;  2H5X A;  3ISC A;  5KG7 A;  4IG8 A;  3IM1 A;  4DL4 A;  1BPZ A;  2Y1I A;  1ZQC A;  4ELV A;  4DSF A;  4YG2 A;  1PZN A;  3GIM A;  4M9H A;  1YLQ A;  2W9B B;  1ARO P;  5DGA A;  1L3V A;  4IRK A;  3TQ1 A;  1U45 A;  7ICN A;  4YFK A;  1XU4 A;  1TFR A;  5C5J A;  3JPT A;  1U49 A;  2O5A A;  4AT7 B;  5HP4 A;  3QEA Z;  4X4T A;  1COO A;  4I2B A;  4M6W A;  4RQ6 A;  2UVU A;  5J0W A;  4C8L A;  5IIN A;  3QZ8 A;  2I9G A;  8ICB A;  4FHW A;  1JN3 A;  2JZB B;  3HW8 A;  4NLK A;  2BQ3 A;  5KFT A;  4QZF A;  4B9M A;  7ICH A;  1KRP A;  1X9M A;  3TAP A;  4TUP A;  5HRF A;  2JZB A;  4P4P A;  1SKS A;  2J6T A;  1EXN A;  2ZH5 A;  5CJ7 A;  3EPG A;  3JPP A;  2HHP A;  1JXE A;  1H38 A;  5DQG A;  3C1Z A;  3H38 A;  4O5K A;  2JEG A;  4J9Q A;  4X4S A;  3PNC A;  3JPQ A;  1NOM A;  1U4B A;  1RXV A;  1HUO A;  4O3S A;  2M2W A;  4ED1 A;  1RYR A;  5KT2 A;  4F4Z A;  3EZ5 A;  5HRK A;  2KP7 A;  4X4Q A;  1ZQQ A;  4DSL A;  5D49 A;  4DL2 A;  2ZH8 A;  2BCS A;  3M9M B;  4IQW A;  5KFE A;  9ICC A;  5CB1 A;  5DB9 A;  2FPM A;  4J9O A;  5IIL A;  1S76 D;  4TUS A;  2XCP A;  2DR8 A;  4ECQ A;  7ICK A;  5J2H A;  4B9U A;  4UB2 A;  4Q43 A;  7ICO A;  4O0I A;  4LT6 A;  5III A;  2ZJA A;  4RQ4 A;  2HHT A;  2HVH A;  3MAB A;  5DKW A;  3JPN A;  4EBE A;  1S0O A;  4RQ8 A;  4RZR A;  3Q8R B;  4ECT A;  4KLJ A;  4WC5 A;  5CHG A;  9ICO A;  5HRB A;  1NK4 A;  1BPY A;  1ZQM A;  1ZET A;  2M2V A;  1MIW A;  3C2L A;  3PVX A;  3H4B A;  1ZQB A;  1QSY A;  4ECX A;  1BPD A;  4DLG A;  4KN7 A;  5F9N A;  4J9M A;  1BGX T;  4O9M A;  1BPB A;  1RPL A;  1NJX A;  5HML A;  7ICF A;  2XY6 A;  2DPI A;  3GFK B;  5KT4 A;  1VJ7 A;  3RRG A;  3SV3 A;  5J0T A;  3PW5 A;  1SKR A;  8ICY A;  3TAR A;  4RQ7 A;  4QWB A;  2BHN A;  5IIK A;  3GV7 B;  4B9S A;  4S3N A;  3OVA A;  5KFK A;  2W8L A;  4Q8F A;  1MIV A;  3HWT A;  1SL2 A;  3NTU A;  4NM2 A;  3LWM A;  3C5G A;  3V7J A;  2Q66 A;  4XA5 A;  2VA8 A;  3MGH A;  3GIL A;  4ED3 A;  2C2R A;  2JEJ A;  4RQ2 A;  5J0S A;  3ISD A;  2DFL A;  4KLL A;  5J29 A;  5KFM A;  1XO1 A;  5J0Q A;  1NJW A;  3H40 A;  4F3O A;  4I29 A;  4M2Y A;  1NZP A;  2R8K A;  4WC0 A;  1TKD A;  5BPC A;  3BQT A;  4PGX A;  3JPR A;  5KFD A;  5J0P A;  5KG6 A;  4YR2 A;  4ECV A;  4M5D A;  1D9F A;  1ZYQ A;  1L3U A;  3MBY A;  1U48 A;  1ZQN A;  1R89 A;  3UPS A;  5J2C A;  4X0B A;  1T3N A;  4I2G A;  1UA1 A;  1XC9 A;  1SKW A;  3WFQ E;  4JUZ A;  5J2I A;  1ZQL A;  2I1Q A;  1SL1 A;  1ZQU A;  4ELU A;  2MUT B;  4F50 A;  2A1J A;  3QZ7 A;  5KTQ A;  4E80 A;  1S10 A;  4B9N A;  3LWL A;  1Z3E B;  5J2B A;  3OV7 A;  1XSP A;  2DRA A;  1BVS A;  1TVA A;  5HRL A;  4YMM A;  8ICM A;  2RDJ A;  1Q79 A;  5KFY A;  5KT7 A;  4J9P A;  4GXK A;  3LDA A;  4PHP A;  2V4R A;  1X9S A;  5J2J A;  5DLF A;  8ICC A;  1UEV A;  5KFS A;  5KG0 A;  2DR5 A;  5KFI A;  5J0R A;  4I2I A;  4PGQ A;  3M8R A;  2B21 A;  4DL6 A;  4ECZ A;  3EWA A;  4I2A A;  4ECS A;  3OJU A;  4P4M A;  1ZQK A;  4YQW A;  1LV5 A;  1KNY A;  2V4Q A;  2HHU A;  4X4N A;  4NY8 A;  2PXI A;  2OWO A;  5KFG A;  5DBB A;  4UAW A;  1NKB A;  1JXL A;  9ICK A;  2ZJ8 A;  5HRH A;  1ZQV A;  8ICF A;  4NXZ A;  4UB1 A;  5HMM A;  3EPI A;  4M6W B;  4F5R A;  5CP2 A;  2BPC A;  4JK1 A;  5KFF A;  3PW0 A;  3KHR A;  9ICQ A;  2PBE A;  1S0M A;  3HX0 A;  5J2A A;  1NJY A;  7ICU A;  1NK8 A;  3JZ0 A;  5KFN A;  4DFK A;  4YMO A;  3TI0 A;  3QEB Z;  2BPG A;  3AUO A;  4M04 A;  1S77 D;  3V7K A;  4FHV A;  3Q8L A;  1FA0 A;  2J6U A;  2GWS A;  5J0O A;  8ICI A;  2W9C A;  1ZQY A;  4FS1 A;  3PW2 A;  4O3N A;  4YCX A;  4IR9 A;  4R63 A;  4CCH A;  2F1J A;  4E0D A;  1XWL A;  5DBA A;  4C8M A;  5J2G A;  4ED0 A;  4MF2 A;  1NK9 A;  4DWI A;  2ASL A;  3RRH A;  2PFO A;  2M2U A;  2ZTC A;  4JV1 A;  5HRD A;  4DQP A;  4RWN A;  2F1H A;  1OU5 A;  4UB4 A;  4WC6 A;  2MAX A;  3WFR E;  4F91 B;  4QZC A;  3MR6 A;  4P4O A;  4X4R A;  1ZQP A;  7ICI A;  2FPL A;  9ICB A;  3PX0 A;  9ICE A;  5KFJ A;  2DVI A;  4KLH A;  1K1S A;  4M9N A;  8ICW A;  2HW3 A;  1N56 A;  1XS9 D;  9ICN A;  4ECR A;  4F5Q A;  3MR5 A;  5D4B A;  1WCN A;  3UQ2 A;  1UA0 A;  4WC7 A;  5HRG A;  9ICJ A;  1DK2 A;  5KFR A;  5J0U A;  4QWD A;  1TK5 A;  3GQC A;  5DQI A;  1ZQS A;  3ZDD A;  5KG2 A;  2BKE A;  2HHX A;  2ALZ A;  2HHQ A;  3BJY A;  5DEC A;  4F2S A;  2IA6 A;  1ZQF A;  5DBC A;  4RUC A;  2VA2 A;  3OJS A;  1JIH A;  1T4G A;  3C23 A;  4UBB A;  3H3A A;  2XO7 A;  3B0Y A;  4UB5 A;  1KDH A;  5KG4 A;  1ZQD A;  4YVZ A;  1NKC A;  3RJH A;  4QZH A;  4AT9 A;  4DFJ A;  4I2D A;  4E7X A;  2BGW A;  3PR5 B;  4RWO A;  2ZHB A;  3JPS A;  4DL7 A;  3KHH A;  9ICM A;  1NK7 A;  3UPQ A;  4GC7 A;  8ICE A;  3PMN A;  4GC6 A;  2VAN A;  2ZUD A;  1A77 A;  1ZQW A;  1Y88 A;  5DLG A;  3RH4 A;  4RNO A;  5CR0 A;  4EP7 A;  4FBT A;  2ZH6 A;  1BPE A;  4I28 A;  4O5E A;  4MFA A;  2KFN A;  7ICM A;  4GLX A;  4RQ0 A;  2C28 A;  5HHH A;  2ZTD A;  3RJE A;  1RZT A;  2KFZ A;  4BWJ A;  4ED8 A;  4I2E A;  2KTQ A;  1BNP A;  5F9L A;  3SZ2 A;  4YP3 A;  4WC1 A;  5L9X A;  3AU6 A;  2WTF A;  4JWN A;  3RJI A;  2BCQ A;  5KT6 A;  9ICS A;  4FO6 A;  3WFP A;  5KG3 A;  4UBC A;  3SYZ A;  8ICV A;  3RR8 A;  3EW9 A;  4BWM A;  2ZJ5 A;  4F4K A;  2BR0 A;  5KFZ A;  8ICH A;  3TAN A;  3V6K A;  1RYS A;  2W9A A;  4UAY A;  4ED2 A;  3KHL A;  8ICR A;  4K4I A;  3OVB A;  3RJJ A;  4FBU A;  3PW4 A;  4BDP A;  4EZ9 A;  4DS4 A;  4K4G A;  7ICV A;  5DQH A;  2NRX A;  4TUQ A;  3M9N B;  4DOB A;  7ICS A;  4BXO B;  5KT5 A;  2C2D A;  3HIY A;  4UAZ A;  5IIO A;  4DL3 A;  4TQR A;  1ZQZ A;  3RB0 A;  4AT8 A;  5J2F A;  4AT8 B;  4PHE A;  2RDI A;  4MEX A;  3HJ4 A;  4J9R A;  3OUY B;  4DQI A;  4AT7 A;  4LZD A;  5KG5 A;  3PO5 A;  4DSK A;  4Z6C A;  3JYY A;  3GDX A;  4EBJ A;  3PX6 A;  3G6X A;  3RJF A;  1KEJ A;  4J9L A;  1NJZ A;  4F8R A;  1VFG A;  4X4V A;  4IQT A;  4YD2 A;  4KTQ A;  3THV A;  4O3R A;  2XGQ A;  1U47 A;  4DF8 A;  4QW8 A;  4KLF A;  4DLE A;  4IRD A;  2F1I A;  4QZ9 A;  3RR7 A;  1N48 A;  4B9T A;  4DSI A;  1V4A A;  2BQU A;  1L3T A;  9ICF A;  4YD1 A;  7ICP A;  3PML A;  3JPO A;  2KZ3 A;  1D8L A;  7ICE A;  3C18 A;  3RH6 A;  4WC3 A;  2BDP A;  3IHQ B;  2FMP A;  4B9L A;  2NRT A;  4F5P A;  3FDS A;  4YMN A;  1X9W A;  7ICQ A;  4PPX A;  1IM4 A;  3KTQ A;  9ICW A;  4QW9 A;  4QWA A;  5J2E A;  3GV8 B;  2BCU A;  3RJK A;  1ZQJ A;  4B9V A;  1JQR A;  4MFF A;  2R8J A;  3PV8 A;  4IRC A;  5DGB A;  3PX4 A;  2ZH9 A;  4UB3 A;  4EZ6 A;  1HJP A;  4YR3 A;  1MSW D;  1KFT A;  4NM1 A;  5HHI A;  3LK9 A;  3C5F A;  3T5K A;  4DFM A;  1ZQT A;  4I2H A;  4NLG A;  1F5A A;  4QZG A;  5TZV A;  4DQQ A;  3K75 D;  5KFX A;  4YR0 A;  4DF4 A;  4XQ7 A;  3WFS C;  5KT3 A;  1UET A;  3PY8 A;  5EOZ A;  3H7I A;  2JEI A;  3G6V A;  3T3F A;  4KLI A;  4ECU A;  4KLS A;  5BOL A;  4F4X A;  3H39 A;  4GXJ A;  3RAQ A;  5F2V O;  3H8S A;  2C2E A;  1TFY A;  8ICS A;  4KLE A;  3C1Y A;  4RPY A;  3T5J A;  3RB4 A;  2P6R A;  4DEZ A;  4FHY A;  4F2R A;  3FYH A;  4F5N A;  5IIJ A;  3T5H A;  4FH3 A;  1A76 A;  4GXI A;  1C7Y A;  2MUT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...