5DECA

Crystal structure of the small alarmone synthetase 1 from bacillus subtilis
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
195
structure length
188
Chain Sequence
DDKWERFLVPYRQAVEELKVKLKGIRTLYEDDHSPIEFVTGRVKPVASILEKARRKSIPLHEIETMQDIAGLRIMCQFVDDIQIVKEMLFARKDFTVVDQRDYIAGYRSYHLVVLYPLQTVSGEKHVLVEIQIRTLAMNFWATIEHSLNYKYSGNIPEKVKLRLQRASEAASRLDEEMSEIRGEVQEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Catalytic mechanism and allosteric regulation of an oligomeric (p)ppGpp synthetase by an alarmone.
pubmed doi rcsb
source organism Bacillus subtilis (strain 168)
molecule tags Transferase
molecule keywords GTP pyrophosphokinase YjbM
total genus 64
structure length 188
sequence length 195
chains with identical sequence B, C, D
ec nomenclature ec 2.7.6.5: GTP diphosphokinase.
pdb deposition date 2015-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04607 RelA_SpoT Region found in RelA / SpoT proteins
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.860 Mainly Alpha Orthogonal Bundle Helix Hairpins Nucleotidyltransferase 5decA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5decA01
4P4OA 4UD5A 1ZQKA 2FMQA 2ZH6A 8ICXA 3PMLA 1R89A 4RQ1A 7ICRA 4I2DA 2FMPA 4M9NA 3H39A 9ICBA 4F5QA 3OV7A 3AQLA 3RJIA 2BCQA 4I2BA 4LT6A 4LVSA 4IQUA 2M2TA 4RQ2A 4RWNA 3JPOA 4E80A 1F5AA 3RH6A 9ICKA 2GWSA 4KLUA 1BPEA 2M2VA 5HC9A 4X4QA 4KLOA 1Q79A 4LZDA 1ZQJA 4WC1A 1ZJNA 4PGYA 9ICNA 5BOMA 1MQ3A 4MF2A 9ICAA 3UQ0A 1ZQSA 3MGHA 9ICEA 5J2CA 5HRDA 2BPGA 2ISPA 1BPXA 7ICTA 5IILA 4RWOA 5J2EA 4X4RA 4K4GA 2O1PA 1ZQVA 5HRLA 5CP2A 2ZH1A 4UB3A 4RQ8A 3C66A 2BE3A 3JZ0A 4X5VA 3H37A 1NO5A 4NLZA 5IIMA 4RQ3A 4KLDA 4F5PA 5HR9A 4M5DA 7ICFA 5J0RA 9ICFA 4I2FA 4NXZA 2DR7A 7ICMA 9ICVA 5CB1A 4I2IA 4PGXA 2BCSA 4I2GA 5EOZA 1BPDA 4E8FA 9ICCA 1YLQA 5J0XA 4QZDA 2HHPA 2VANA 5D4BA 3HX0A 3RJEA 4P2HA 7ICIA 1ZQQA 5J0SA 4X4PA 3RJGA 1KDHA 3WFRE 1MIWA 4RPZA 4JWNA 4F5NA 5J2DA 3JPPA 5IIKA 4DOCA 4TUPA 4XA5A 4NLKA 1R8CA 4WC5A 2O5AA 3RJJA 4LZGA 5DB7A 4QZBA 2RFFA 9ICPA 4R65A 1KNYA 5J0UA 1ZQPA 3HW8A 2PFQA 8ICAA 1ZQNA 5HRBA 5J2JA 4O5EA 4KLLA 5DB9A 3AQKA 4RQ4A 3OGUA 5J2IA 1TVAA 4NM1A 9ICOA 4AT9A 4O5KA 8ICJA 4E7XA 4XRHA 4KLSA 3UXPA 4UB4A 3HWTA 3B0XA 5J2HA 4UAWA 5DDMA 1BPYA 2ZH2A 4KLTA 4MFFA 3MDAA 4FH5A 5TZVA 4MFAA 4R64A 2M2WA 5DBCA 5IINA 8ICFA 1VFGA 5CWRA 4M0AA 4RPYA 3AU2A 4KLIA 4WC3A 2ZH7A 3WFSC 3AUOA 4FH3A 4TURA 4NKTA 4EP7A 4XQ8A 4M2YA 1NOMA 5J0YA 9ICIA 4TUQA 4IQTA 8ICRA 3LK9A 3K75D 2BPFA 8ICMA 4RQ0A 4PPXA 3UPSA 3AQMA 1ZJMA 4FHWA 4UD4A 4YN4A 3RH4A 9ICLA 5D46A 2I9GA 5IIJA 4O9MA 5J0PA 1ZQRA 7ICUA 2BCVA 1TV9A 1UEVA 4WBZA 5DEDA 3GDXA 4I28A 5CHGA 1ZQBA 4I2HA 3JYYA 4O5CA 1BPZA 3C2KA 4EBJA 3ISCA 3RJKA 4RT2A 5HRFA 5J0WA 4F5RA 2ZHAA 4UB1A 1BPBA 3UPQA 5IIIA 8ICZA 5DDYA 3UXOA 9ICHA 1WOTA 4R66A 7ICVA 4QZ8A 4QZGA 3NYBA 3C2LA 4FHYA 4FHPA 4YMOA 4AT9B 7ICPA 1ZQTA 8ICHA 4KLFA 7ICOA 5DECA 2PFOA 2ZHBA 4GXIA 4X0BA 2PBEA 7ICNA 2DR5A 1ZQHA 3OVBA 8ICGA 8ICUA 1VJ7A 2DR8A 8ICTA 5CR0A 5HRKA 4ATBA 7ICQA 9ICRA 4YMMA 2ZH3A 5HHHA 4WBYA 3RJHA 4WC6A 1HUOA 4PH5A 9ICWA 4X4SA 4GXJA 2FMSA 1TFYA 1XSLA 1Q78A 2DR9A 1R8BA 3V72A 1V4AA 8ICYA 4QZIA 3PMNA 4QZAA 2BCRA 2NRKA 8ICPA 7ICJA 9ICJA 3WFQE 1R8AA 3HJ4A 2IHMA 4Z6EA 3PNCA 4M9HA 4KLGA 4KLHA 3HJ1A 4XQ7A 4WC4A 4I29A 1JAJA 4RQ7A 7ICLA 1ZQUA 8ICLA 2ZH4A 3HIYA 1KEJA 5BPCA 4QZEA 4RQ6A 1ZQFA 4YD1A 2Q66A 8ICBA 1ZQCA 5J2FA 4NKUA 7ICSA 2ZH5A 4I2EA 1PX5A 3L9DA 2BCUA 4UAZA 3UXNA 4UB5A 1ZQLA 4RT3A 3LQCB 1JN3A 1HUZA 8ICVA 4NLNA 4IG8A 4QZCA 4YD2A 4QZHA 4P4PA 2ID1A 7ICHA 4AT7B 3WFPA 3MGIA 5J2GA 4KLQA 4P4MA 4DOAA 3WFOA 4M9LA 8ICIA 3RJFA 4X4UA 3ISBA 1MIYA 4I27A 7ICGA 4PHEA 2ZH9A 8ICCA 9ICMA 4Z6DA 2ISOA 4S3NA 4WCWA 4K4HA 4PHPA 4WC0A 5CA7A 4KLJA 5J2BA 1ZQIA 3OVSA 3JPQA 5BOLA 1OU5A 2DRBA 4XUSA 2PFNA 5DBBA 4JWMA 4YMNA 2W9MA 4PHAA 7ICKA 1UEUA 3OUYB 5J2AA 8ICKA 4TUSA 8ICOA 8ICEA 5IIOA 2PFPA 3JPTA 4UAYA 2ZH8A 1RPLA 3MBYA 5HREA 3ISDA 1ZQGA 2BPCA 4DOBA 1ZQXA 1ZQOA 4RWPA 3OVAA 5DBAA 3JPRA 3C2MA 3UQ2A 3TFSA 9ICSA 3C18A 4KLMA 4AT7A 4Z6FA 8ICWA 3JPNA 3AQNA 3RH5A 4Z6CA 3MDCA 4X4OA 4IQWA 1MQ2A 3V7JA 4UBCA 4X4TA 3OUYA 4I2CA 9ICQA 4X4NA 1ZQEA 8ICNA 4AT8B 4RPXA 3C5FA 4UB2A 2M2UA 4MF8A 4RQ5A 1JQRA 5J0OA 4R63A 4K4IA 5DB6A 1TFWA 4M04A 8ICSA 5J2KA 4WC2A 4I2AA 4X4VA 5DKWA 5J0QA 5D49A 4RWQA 4AT8A 3C5GA 4M47A 4IQVA 1XSNA 4QZFA 4PHDA 1ZQAA 4KLEA 4WC7A 1ZQYA 1JMSA 1ZQMA 3H38A 9ICTA 7ICEA 4EBKA 1ZQDA 3JPSA 4FO6A 5HRIA 1MIVA 2DRAA 4X0AA 4MFCA 5DB8A 2P66A 4NM2A 5F2VO 1FA0A 2DVIA 5HRGA 8ICQA 2PXIA 9ICGA 4DO9A 3V7LA 4PGQA 3V7KA 4QZ9A 4ATBB 4UBBA 4FHXA 5J0TA 3TFRA 3B0YA 4M9GA 4FHVA 3AU6A 4YCXA 9ICXA 1UETA 5CJ7A 5J29A 1RZTA 4M9JA 1XSPA 4GXKA 5HRHA 5HHIA 4I2JA 1ZQZA 1ZQWA 4NY8A 3H3AA 9ICUA 4F5OA
chains in the Genus database with same CATH superfamily
4LF8O 3PMLA 2QKSA 3JD1A 2KG7A 4JTCB 4DV1B 2FMPA 1J95A 1IBKB 5IJ0B 4LVSA 4LT6A 4IQUA 2QKAA 4B3TO 3A2FA 4K35A 5CBGA 2CGNA 2YDEA 3JPOA 1F5AA 2YIAA 4DV7B 2JEUA 3AG2C 4IHJB 2OTJV 4K97A 4GLXA 3OGCC 1Q79A 3W7SA 4K99A 4WC1A 3E86A 4N23A 4PGYA 1BMFG 2Q8VA 5EZYB 2IM9A 9ICNA 1MQ3A 1PL4A 9ICAA 1QHTA 4LF4O 2B56A 1XMQO 2XHBA 2PTMA 5GW7A 2BPGA 2ISPA 5BMVA 1H2MA 5HFLA 4KHPO 4JASA 1IXBA 4K4GA 4X4RA 2O1PA 2GAFD 2UXCO 3U11A 4JTAB 2QM7A 1AR5A 3CB2A 5CA3A 1N4CA 1NI8A 2ZH1A 4RQ8A 4DR7B 4L87A 4DV6O 1GPJA 3RN4A 1WN7A 5J2UA 1R1BA 1BS3A 4TUYA 4DUYB 3ZIAG 2OIEA 3SYQA 4DXWA 3OR6C 5J0RA 3W7XA 4DUYO 5L3DA 2NNUA 4DR1B 9ICFA 1M1KW 2DR7A 4LEWA 5BY1A 2QGNA 4PGXA 1TA8A 4G27B 2EILB 4CH3A 3HKEB 2R70A 2K1EA 1KD1W 5J0XA 1HWYA 4GZRB 3H01A 3CS5A 4DR4O 2VANA 2GHYA 2RN9A 3B40A 4P2HA 3WFRE 3IJ4A 3P30A 5EBWC 4LF6B 5J2DA 2CDYA 4TQDA 4DOCA 1YJ9V 3T4ZA 2HJDA 4WC5A 3CC4V 4LZGA 1PNKA 4NXXA 1NS1A 1NH2D 1M9NA 4PELA 1FPOA 4FMTA 4CH5A 5LMUO 1KKDA 2PFQA 4LF5O 2WA4A 8ICAA 1ZQNA 3CCSV 3MCRA 1W0JG 2FL4A 5B1NA 4RAIA 3J7AU 4R7CA 3ZRXA 3AQKA 4BAYA 5GTIZ 2F66C 5B1BC 4Z2WA 4LFBB 4K96A 1TVAA 4I7ZB 4B7EA 1SESA 1WB8A 2RCVA 4GT1A 4NM1A 2DYSB 3BY6A 2E76B 2XOKG 3JALA 3UXPA 3FB8C 4Q6GA 1A32A 4NVPA 1ZLZA 2BCCH 3I56V 1JVMA 1Q81W 5DDMA 4KLTA 2ZH2A 4MFFA 5CA1A 2XNDG 2JS5A 5DBCA 3FYEB 4DUZO 3ABLB 1ZL8A 5IYZA 3BVOA 1Y67A 4K8XA 1XMOB 4OPHA 4FLYA 3AU2A 4KUMA 4DYLA 3VQXA 1R73A 2EBOA 2MW2B 3NWIA 4FH3A 4NKTA 4B3SO 3RYFB 5D61A 1H38A 3K75D 1AJNA 2BPFA 8ICMA 4DRXA 2IBZH 2P90A 3QNEA 4KB6A 2EILC 4X1YA 3RH4A 4OPAA 9ICLA 1V54C 3L71H 3VOUA 3RYHA 4RWUA 3UT5B 7ICUA 1TV9A 4DW0A 5CHGA 2DN9A 4I2HA 3JYYA 4XDLA 1GN3A 2ETNA 3HKBA 3ISCA 3RJKA 4YJ2B 4RT2A 2CH7B 2F43G 4DR2B 3SR2C 3SYCA 3TK1A 2UXCB 2ZHAA 3K3WA 3UPQA 5IIIA 5DDYA 5HFMA 3WG7C 1Q86W 4WBNA 1VQMV 2AGAA 3T2MA 3EXAA 4X64O 3NYBA 3MDSA 4FHPA 4AT9B 2NN4A 4HNAB 3OUSA 3TXSA 7ICOA 3ZMSA 4JV5O 3BABA 5LMNO 2HHHB 1F51A 4WFFA 4X0BA 7ICNA 1U96A 4GX1A 5LOVB 1VARA 2XAFA 8ICGA 5LP6C 5LMNB 1FXVA 3T4DA 2YI8A 1N32B 3SPJA 3ABMC 5H2FZ 5HRKA 4ATBA 2UUAO 3K5LA 1YHQV 3RJHA 4WC6A 9ICWA 1TFYA 4GXJA 1LUVA 1XSLA 1AI6A 2ZT9B 1Q78A 2E75B 5CMUA 5EK0A 2BCRA 5IJ9A 2A0LA 7ICJA 4J10A 5EIBC 1THZA 5K1XA 4YIOA 2LW7A 2Y0IA 2ZQMA 1WP8A 4KLHA 2EINB 3HJ1A 4LEVA 1JAJA 3R66A 2QJ1A 3OMIB 1M4UA 3CRCA 2WPDG 2ZH4A 1GH6A 4FLTA 2NLJC 1SQPH 3HIYA 4RQ6A 4TV8B 1N34B 1TVKB 3CCVV 8ICBA 4NKUA 1VQ9V 2DMXA 2ZH5A 4I2EA 3IC7A 1KUQA 3L9DA 2BCUA 5JJJB 2X6BA 1WP7A 3OTOB 1TUBA 1V54B 3JSNA 1FFXA 8ICVA 4NLNA 3KCXA 1NZ6A 4QZCA 4YD2A 4P4PA 4H13B 4AT7B 3MGIA 4KLQA 3LSQA 1AI5A 4X1KB 4FZ1A 4O4IA 1BQZA 1YEWA 3H1LH 5CB4B 4GCZA 1NR7A 4JI6B 5D62A 9ICMA 3SJBC 4TV9B 5LA6A 3FB5C 2ISOA 4AILC 3H1KH 1G8MA 4F6RA 3CCEV 4DR3O 4K4HA 1MG1A 1X59A 3ASOB 5J2BA 1K34A 1YVWA 3RBZA 3E22B 2PFNA 1SF9A 2EJ7A 1E79G 4YMNA 5JVDB 1OCCB 4PHAA 3CEIA 2P4VA 1XHZA 5J2AA 3ML0A 8ICEA 4ZOLA 2EZPA 4UV8A 1RPLA 1OCRC 1ZQGA 4MTOA 4DOBA 1M93A 3ZMUA 3JAMN 5DBAA 4RWPA 4DW1A 2ATKC 5DN6G 1XQ8A 3W7UA 4OAIZ 4I9QA 4H33A 3C2MA 5LGNA 4FIPC 9ICSA 5DM6V 3CRQA 4PJ0Z 2DW4A 4IT5A 2X6AA 3L70H 3CC2V 2QKCA 4Z6FA 2M6YA 3ZMTA 3RH5A 3MDCA 5FNVA 3SJQC 3PJSK 4X4OA 1MQ2A 1JQ0A 4U3JB 3V7JA 1GRJA 4UBCA 1OJHA 3CHXA 2IU3A 2YXYA 4TSFG 9ICQA 2IJIA 1GM7A 3U10A 2FB5A 8ICNA 2P22C 3ZEDA 4KM5A 2VQFO 5EYPB 1FS0G 5J0OA 1FXKB 2UUCO 2Q69A 5DB6A 1RPRA 4F6RB 3ABLC 5LYJB 4I2AA 4UVCA 2CTRA 3CPWU 4IQVA 1XSNA 1JCHA 4PHDA 2H94A 2GTAA 4B7KA 1KMIZ 2YEVB 2YIDA 3BA8A 4JI8O 1ZQYA 2ADPA 1ZQMA 3H38A 4X1KA 7ICEA 1ZQDA 3JAWA 4MVMA 1N36B 5HRIA 1HNZO 1M56B 4J7JA 2DRAA 2FTKA 5H6RA 2GDSA 1GMGA 2P66A 1TUBB 1JJ2U 5HRGA 4WQLA 4MW8A 1EFRG 3V7LA 2A3QA 2OCHA 3ABTA 4UBBA 4FHXA 4UVAA 1Y74B 2Q7GA 2EIKC 3K79A 4TV8A 4M9GA 3LDCA 3OD4A 3TJTA 3M7MX 1UETA 4PDMA 4IYIA 5J29A 4M9JA 2BBJA 1MABG 1MNGA 2LFSA 2YUAA 1YITV 2IUBA 4OX9B 4LCUC 2LP7A 1M5IA 4H37A 2OYQA 2BTQA 1Q6HA 2XT9A 2HLDG 5IY5B 4DV4B 1AILA 4DV7O 1SQGA 2HN1A 4UB6Z 5KHKA 3AQLA 4I2BA 4JAUA 4NYKA 4LF7O 2XTAA 2P4KA 2AXTZ 1SA0A 1JA8A 3CYOA 4KLUA 1BPEA 2M7WA 1K97A 5HC9A 4X4QA 1XOUA 1XL6A 4KLOA 2PY5A 1ZJNA 3D3IA 2EIMC 3DGEA 1MZFA 2V1DA 4DR6B 5BOMA 1R6TA 5L3FA 1IURA 3QF7A 2DQ0A 4DR1O 1HR0B 2DYRC 1HW7A 4MVUA 5J2CA 4XJEA 4O69A 3SYAA 1BPXA 4LP8A 7ICTA 5IILA 1I5YA 4EB6A 3CSXA 2CH7A 4IGGA 1H2NA 4MKPA 3HKBB 3CCQV 3JAKB 3H37A 3JATA 5LMUB 1J5EB 2EIJC 1F23A 3E8GA 2Y69B 3UT5A 1DTOA 4F5PA 5HR9A 3RYHB 4X8AA 2CK3G 1XUQA 4X1YB 2MK3A 3A0BZ 3UM7A 1GN2A 1ZSPA 2EWRA 4NXZA 2QM8A 4BWAA 7ICMA 1PP9H 4I2IA 4DRXB 2AZ0A 1AI7A 4EV6A 4NXMO 3THOA 3CCRV 4X1IA 1O9GA 1IBLO 2ZE7A 2ZR2A 1P4RA 5L3CA 1YXBA 3KCYA 4BW5A 3RYFA 2OWOA 3G4SV 3E8BA 3LDDA 1ZQQA 2QA4V 1FD9A 4X4PA 5JCOC 1AB3A 4GX2A 4B08A 4JWNA 4QE7A 5IYZB 1ORQC 3L72H 1RSOA 4TUPA 4NLKA 5KUMA 2O5AA 3RJJA 1KB9F 3OEEG 5AG2A 3SYPA 4QZBA 4EGWA 5ITZA 3D3QA 4UCSA 2N05A 3K08A 4X65O 3HW8A 4LFCB 4K0KB 5LGUA 4K98A 5HRBA 3GB7C 2ILMA 4LF7B 5FPOA 2Q68A 4RQEA 2UU9O 3OMAB 3N2GB 2OT5A 5J2IA 2UU9B 2ZKOA 9ICOA 4O5KA 1Q3EA 1SKVA 1DK1A 2JEXA 2ITCC 4B3TB 4IIJB 2WLIB 2O57A 3HWTA 3SDLA 3M8AA 3QVNA 4JAVA 1BPYA 4DV2B 2ZR3A 3FB6C 2P5OA 2EZOA 4DR2O 3ZRWB 3MHHC 2VWKA 3JD3A 5KAIZ 2M2WA 5IINA 2VRZA 4PDLA 4ABMA 1VFGA 3I5DA 4D7TA 3STLC 3H1IH 3T1HO 5B3SC 4KLIA 1KC8W 2ZH7A 3OWGA 4TURA 4EP7A 9ICIA 4LEYA 2LO1A 5J0YA 3JD4A 4JI0O 4IQTA 4I0XB 3ZHRA 8ICRA 5IDJA 3HKEA 1ZWIC 4QJFB 1XNRO 1YJNV 3T1YO 3JARB 4JI1O 4CC6A 4GKJO 4UD4A 1XNRB 2ZDIA 2QWRB 5EIBD 3P32A 4I0XA 2ZNJA 2F1MA 2I9GA 4J9YB 4UFZA 4FPPA 5J0PA 1OCZC 1IVSA 2BCVA 4TUYB 1UEVA 3K5NA 3GDXA 4I28A 4X9QA 1CEZA 1BPZA 2ITDC 1K5SA 5L3GA 3ER8C 4EBJA 2WA3A 2L35A 4X66B 2IH3C 3ZHSA 2CTQA 2JDIG 2FYUH 3ZRWA 4UB1A 1BPBA 1LNQA 2ZXWC 2UXXA 3BCCH 2YSUB 5BR8O 2WLNA 3AK1A 4QZ8A 2LGQA 4QZGA 4IIJA 2BOCC 3C2LA 5C93A 1F7YA 4YMOA 1VF6C 4WCEV 2BTQB 4J9ZB 7ICPA 4I9WA 4LEZA 8ICHA 2QWPB 5DECA 2ZHBA 2XAHA 3CCUV 4GXIA 3N2GA 2PBEA 2YICA 2Q0OC 1U97A 1KECA 1Y6XA 4RUEA 4JI2B 1SQBH 5EBMC 3WU2Z 5IWAB 1Y74A 4X62O 2WLMA 5CR0A 4JYBA 9ICRA 5E79Z 2LGWA 1TGOA 2ZH3A 3K57A 5ITZB 4WBYA 3OAAG 1HUOA 4QNHB 4PH5A 1VQKV 3LSSA 4LF5B 1R8BA 4JYCA 1W59A 5B5EZ 1RSOB 2YS8A 2OCCB 1M56C 4QZAA 1NR1A 2GSMB 4JZGA 1OCOB 9ICJA 1R8AA 1IDSA 2XAQA 2ZE8A 3JAWB 4G28B 3ZX6A 3PNCA 4YY3B 2HVKC 5L3BA 2YEVA 4XQ7A 2F4VO 1AVMA 2QEXV 4X1IB 4NB5A 3MAQA 1XMQB 1ZUQA 3T1HB 3K58A 1N8RW 1KEJA 5BPCA 4YD1A 4LNUA 7ICSA 3ZMZA 1XNQB 3GVMA 3ZN1A 4UAZA 3UXNA 2CGOA 1V9PA 3ERCC 4U3JA 3K9AA 1HUZA 4QGPA 3FKSG 4DR6O 4QZHA 2P67A 3JATB 3CXHF 3WB0A 2FCLA 4P2ZA 3JAKA 4PA6A 1FKAO 2X7RB 2F93B 3CK6A 4EB6B 4EFBA 3RJFA 4X4UA 3ISBA 1NTKH 4PHEA 1K8AW 4Q20A 3JCFA 1D5NA 4Z6DA 4WCWA 2A79B 4UV9A 5CA7A 5IT9N 1ZQIA 1S5HC 1OU5A 3ABUA 4QE9A 5DBBA 5JVDA 1SC5B 4JI5O 4YJ3B 1OHHG 1Q6UA 1VMGA 2HEPA 3NVOA 5IIOA 2PFPA 4GX0A 4UAYA 1SA0B 3UQ8A 3SPCA 1RPOA 2EX3A 3MBYA 2BPCA 1XEQA 4WFEA 4AQYO 1ZQOA 3F5WC 4FO1A 4BIZA 2JVDA 1SQFA 5CB4A 4I55B 4J7ZA 1FXHA 3K06A 1LR1A 5J9PC 1BCCH 4JI4O 3UQ2A 3TFSA 4X62B 2PGGA 3C18A 3A0RA 2GUZA 4AT7A 8ICWA 4B3RO 4MVSA 3JPNA 2Y69C 1OCOC 4YXWG 4Z6CA 3ER9B 3HB3B 5FL7G 4X4TA 1VF5B 1Q7YW 4WFHA 2PUSA 1YTFB 4O2AB 4O4JA 5LXTA 1ZTEA 3BPZA 1S76D 5FPRA 2R9AA 4AT8B 4RPXA 3C5FA 2HJFC 2Z0AA 2M2UA 3W7TA 3RYIA 1JQRA 3LDEA 2QTOA 4JAAA 5IYBO 1DLBA 1NQTA 5EC1C 4M04A 8ICSA 2R72A 4WC2A 4X4VA 1N33B 5J0QA 2W6IG 4MSWC 4RWQA 4AT8A 3C5GA 2F95B 2HKOA 2PYLA 4O4JB 4O2AA 5B3PA 2F23A 3ABKB 5B3SB 2Y4TA 2IU0A 4NXNB 3QTCA 4PA3A 4EBKA 3K9SA 2Q67A 1MIVA 4DV3O 1I5XA 3F7YC 4X0AA 4PA4A 4NM2A 4O6AA 4I55A 3E83A 1QVGU 1WPXA 4QZ9A 4ATBB 1FJGO 2WLKA 5LYJA 4JI6O 3TFRA 1S77D 1FXKA 5EYPA 4P9OA 2V7QG 4FHVA 3JSLA 4B3SB 5LOVA 1VIBA 4YJ3A 4GX5A 1RZTA 4GXKA 4NTXA 1VQ7V 1TAEA 3KG2A 3W7WA 1VF6A 4HNAA 1H8EG 4NY8A 5FNVB 1QNMA 3RH6A 4F5OA 4P4OA 1ZQKA 3G80A 2ZE6A 3SJAC 2RDCA 1N0NA 3O9OA 2UXNA 1R89A 7ICRA 3VBBA 5LHHA 1YJWV 3DC5A 3G71V 9ICBA 4F5QA 3OV7A 3RJIA 4JPRA 3CMEV 2M2TA 2RNBA 4OAFA 3OE7G 4RWNA 1R6NA 4QPJA 4E80A 2JGDA 4PV1B 3OT7A 1S5JA 3JYCA 2Z5UA 9ICKA 4H44B 4LH7A 5LP6B 2M2VA 3SGIA 4ZI7B 3N2KA 1ZQJA 3OMNB 2VS0A 1YSCA 3L73H 4Z1MG 4UCUA 4MF2A 3NXSA 3S3XA 4RO2A 3K0GA 2E5LB 1B06A 3UQ0A 4LNUB 4HX0A 1ZQSA 3MGHA 1UFIA 2IW5A 9ICEA 4K9BA 5H9CA 1KU9A 3OR7C 5LA6B 1QQCA 5HRDA 2UUCB 1KYOF 1JJOA 1YZBA 3X2QB 4UB8Z 4RWOA 4CC5A 3TGUH 2AW9A 5HRLA 3H9VA 2XAJA 3CC7V 4UB3A 3G6EV 5CFTA 1KP3A 4OAGA 3C66A 2BE3A 3JZ0A 2HN2A 2OTLV 1NO5A 4NLZA 1ZL8B 4J41A 3G6BA 1K5QA 3TCUA 2QDOA 1XILA 1IX9A 4MVOA 2ZXWB 4M5DA 1VEWA 2PZSA 4CH6A 1VQ5V 1GTOA 4JLZA 4NTYA 2DOSA 4I2FA 1AJQA 9ICVA 2B9ZA 5CB1A 2LJ2A 4I2GA 2BCSA 4HAMA 1Z2GA 1JR9A 3K7DA 1I08A 1YLQA 3AK2A 1KKCA 4FLWA 4BW9A 4O68A 5TISZ 2HHPA 4JYYA 1H2LA 1IBMO 3HX0A 3B2EE 5J0SA 3A8TA 4PHZA 4JI3O 1P7BA 2CTPA 2ZNIA 5IJ9B 1MSWD 3JPPA 1WNSA 3MD0A 2Q9LA 2V4DA 4XA5A 1Q6IA 1R8CA 1QU7A 3N27A 1G4YB 3ZBHA 3UKMA 2GV9A 4G2KA 5JTGA 1VQOV 3HPLC 3QO7A 3H1HH 1XHXA 2ZIOA 5J0UA 2QWQB 4TOIA 2L6LA 4U3FH 3OUFA 1VQPV 4DR7O 4GKJB 5J2JA 3FFQA 4O5EA 4LFAO 2YIBA 2Y0PA 3OM3B 1Z5WA 1GN4A 4R8CA 1RM1B 4RQ4A 2GBOA 5CBFA 2PI5A 1LUWA 3S3WA 5A9GA 1S5LZ 4JI0B 1V55C 4AT9A 3Q4HB 4E7XA 2UXDB 2ODMA 3JARA 4XRHA 4KLSA 1QR9A 1S3JA 5B1OA 2BTOA 4JF3A 4WBNB 4KXRA 5LHGA 4UAWA 4PA7A 2QSAA 1XDCA 3KKYA 2DE0X 2AHYA 5TZVA 4R64A 4MFAA 3CRRA 4AI8A 1QBZA 4X64B 1EM1A 4DR4B 3L74H 2HR3A 1M90W 5CWRA 2Y4UA 4M0AA 5GONA 2N74A 1NVPD 2X6CA 4WC3A 1WB7A 1WLEA 2EIKB 4DV0O 4LWSA 4UUJC 4LF9B 4IYHA 5JQGB 1Y4MA 3K04A 3LK9A 4UCVA 5EBLC 3VQYA 2WLIA 3ABKC 3JD2A 4PPXA 3ZHVA 1SERA 1ZJMA 3AQMA 3CRAA 3SPIA 2W0XA 1O9HA 1P7GA 4FHWA 2HVJC 4YN4A 5B1AC 1OCCC 2JIZG 4I0UA 2IH1C 5B66Z 5IYCO 5D46A 3BRCA 4CH4A 5KHHA 4O9MA 3G67A 4NXWA 5DEDA 2YIBD 4FM0A 4IHJA 1OCRB 1ZQBA 3WB1A 4O5CA 3C3SA 4WH5A 4JI2O 4NTWA 3ZHQA 1FYJA 3EF2A 5IJ0A 2C2AA 4JI7O 1QLEB 1CP9A 5CA1B 1P49A 1QR8A 3UXOA 4MW3A 9ICHA 4DR5B 4JI3B 4R66A 4GUNA 1UJWB 1MOFA 2UUBB 1NH2B 1YF2A 2QTSA 1BHAA 2EIMB 3JALB 4FHYA 2P06A 4NR1A 2E74B 3R65A 1XMOO 2UUBO 5GTHZ 2DYRB 4KLFA 1D5AA 1HNXB 4WF9V 2PFOA 5IY5C 2DR5A 1ZQHA 1X4TA 1DF4A 3WFVA 1FAFA 4K8VA 1SRYA 8ICUA 1VJ7A 3EFFK 3B77A 7ICQA 4DV6B 1JMKC 1JFFB 5HHHA 2E3CA 1FFTB 1HR0O 2DR9A 1PM9A 4TWKA 3V72A 1V4AA 2A9HA 3JASA 1KP2A 4QZIA 3PMNA 2PYJA 2JRIA 4PD4F 2A06H 3SPGA 2NRKA 2HP8A 8ICPA 5KX5A 4UCOA 2LFRA 3DXRB 4DV4O 1L8DA 1JOYA 1L1FA 4Z6EA 5CBHA 4M9HA 4YIPA 3I55V 5KHGA 2JJ1G 4MVQA 1ZX3A 1PKXA 1ZQUA 3AG2B 4DV2O 4QZEA 4D6TH 5KAFZ 3D36A 1PX5A 4R6ZA 1EZVH 4D7SA 5L3EA 2OIGA 4UB5A 4O4HB 2JK5C 3E8FA 5C8YB 1K3EA 4RT3A 1H8HG 3LNNA 4HZ3A 4ICGA 1JN3A 1GN6A 1J5EO 5J2UB 4I4TA 4CS3A 2ID1A 1K4DC 4FLZA 2ZINA 3E35A 4DOAA 2Q6AA 2Z3YA 2CTWA 3TXQA 4M9LA 2WLJA 4KL1A 1MIYA 4JLXA 2ZH9A 8ICCA 2PF4E 2AZ2A 5BMVB 3HKDA 3IGAC 3QG5A 2QWOB 5KUKA 4X20A 4ZIBA 1GM8A 1K4CC 4PHPA 2K9PA 1IBKO 3FB7C 3ICXA 4PA9A 1US6A 3IFXA 5BOLA 4UCTA 4XUSA 5JWPA 3CRMA 2W9MA 4N21A 1UEUA 3AK3A 3OUYB 2YXHA 1EN6A 3CCMV 3HKCB 2ZH8A 1N34O 5HREA 3ISDA 4MS2A 1M57C 1ZQXA 4PI2A 3OVAA 3JPRA 2ARHA 4DK0A 1BGYH 5J2TA 1L0LH 3K5OA 4ZBMA 3VQVA 4DV1O 2JJ2G 1URFA 3GWKC 2RQ6A 2KG7B 1RM1C 1N36O 4KLMA 4P30A 1BT8A 4NXVA 4R50A 3HKCA 3K59A 4EEBA 1V55B 1IZ3A 3B8MA 3UCSC 5A2QN 3FX7A 4XBFA 4ASUG 2P6JA 5KLVH 3OUYA 4I2CA 3B09A 3O65A 4MTGA 4ZHQA 1N33O 3C90A 4NKGB 3BAAA 4MTFA 1PPJH 2F4VB 4RQ5A 5JH7B 3ASNB 1I94B 4K4IA 1OCZB 1TFWA 1GAXA 1FJGB 4O67A 4FFBB 3E8HA 1HNWO 5DKWA 4EFEA 3HKDB 4M47A 5B1BB 1NJIW 2CE4A 3CJHB 1ZQAA 4WC7A 4DO2A 1PV0A 4YHHO 1JMSA 3CX5F 9ICTA 2A7WA 3AG7A 1WAZA 4PDVA 3JPSA 4FO6A 1DGSA 2P7TC 4LR3A 1NVPB 1QVFU 3LUTB 1E1RG 4I4TB 4WFGA 5H6QA 1R6KA 5DB8A 4L8JA 2DVIA 5D5PA 2PXIA 4QPKA 9ICGA 1GM9A 4O4HA 4JI1B 3V7KA 3B4SA 4B3MB 4JYAO 4X66O 3CMAV 4A5UB 4EEDA 2BOBC 5J0TA 4IL6Z 1BQ0A 2VQFB 4UCRA 3AG1C 3B0YA 4K3AA 4UVBA 4ZOLB 1N32O 4XDKA 4B3MO 4JYAB 4JI5B 4BR6A 4EKWA 2YI9A 2UXBB 3AU6A 5CA0B 1Q5OA 5CJ7A 3DSQA 3WG7B 4J7KA 5BR8B 1XSPA 2JGUA 4O4LA 3APQA 5HHIA 4CS4A 4BIOA 4I2JA 1ZQZA 3E22A 3K03A 2B5UA 4EEQA 1ZQWA 4J11A 1AP5A 1NBMG 9ICUA 4UD5A 2FMQA 2ZH6A 1H2SB 3B8NA 8ICXA 5KX5B 1HP8A 4RQ1A 2QWNB 4TV9A 4I2DA 4LFBO 2IJHA 3JASB 3ZMVA 1SQQH 2ZM6B 3H39A 4M9NA 4JTDB 2HG5C 3CWBH 2BCQA 4AQYB 5KA5A 4O4IB 1AP6A 1Q90D 4RQ2A 1JFFA 3CCLV 1YCIA 2HHHO 4JI4B 2GWSA 4RUFA 4W4LA 1I7FA 1FFXB 4O2BB 4DUZB 5CFUA 3E2EA 1RP3B 4LZDA 5IYDO 1PNMA 3RYCB 5JJNB 4GKKB 1WPBA 3T1CA 4MVRA 1NU1H 3IC9A 4DR5O 3ZRSA 2B4VA 1TVKA 3JCUZ 3K5MA 3RFRA 5H5NA 4NXNO 1GO3F 5J2EA 1ZQVA 2NR5A 1Q8IA 5CP2A 4DV5O 1NTMH 3ZRVA 2EULA 1G1XB 3CD6V 4LFCO 4K0KO 4X5VA 4RQFA 1EBOA 1F4NA 5IIMA 3OTFA 3FAVB 4MVZA 4RQ3A 4KLDA 1F4MA 2VWJA 1R3LC 2Q5ZA 2FKXA 7ICFA 3CXCU 1NKDA 2Q4PA 3UO2A 5KMGA 2FMLA 2B1IA 4LF4B 4CS2A 3CP1A 2PI4A 2WLLB 5EOZA 1BPDA 4E8FA 1JPXA 3KZIZ 1IBMB 9ICCA 2LW1A 3ETDA 2KKWA 4I50A 2QE7G 1JX9A 1R3JC 3OEHG 1SZXA 4C7UA 2VQEB 4PI0A 5JQGA 4QZDA 4LBEC 4LWSB 3D8CA 4WFAV 3ASOC 5D5QA 5D4BA 3RJEA 5KHJA 7ICIA 5GONB 5KA6A 3RJGA 1XNQO 1KDHA 1MIWA 4RPZA 4F5NA 3BEHA 1ZAUA 2Q7EA 5IIKA 4U7NA 5LHIA 2YC0A 4TQFA 4FFKA 3ZHUA 4FZ0A 5DB7A 2OCCC 2RFFA 4K8ZA 3BFRA 4YJ2A 1OV9A 9ICPA 4R65A 1KNYA 1XREA 3LNMB 2B1GA 3RVZA 3QO5A 1ZQPA 1P84F 1WJZA 1MMMA 2CAZC 1Y76B 3Q4HA 1BHBA 1FXKC 3JD0A 3APOA 4KLLA 3F7VC 5DB9A 1S0VA 1BL8A 3OFNG 1DF5A 3OGUA 3IAYA 2Q0AA 3F5TA 1XBLA 1PL0A 8ICJA 1S72V 2WLLA 4HBNA 1GKFA 4UB4A 4X89A 1Q82W 4MTXA 2BSKB 4JZ2A 2E5LO 2Y48A 3VQWA 3B0XA 2WAMA 3ZHTA 5KMGB 5J2HA 2KQXA 3EHBB 3MDAA 4FH5A 3SPHA 4B3RB 2UUAB 2W6JG 4FK5C 8ICFA 3RVYA 4CBCA 1Y66A 3P3NA 4RPYA 1K73W 5CN0A 3HR0A 3WFSC 3AUOA 5E1AC 4DV5B 4XQ8A 4M2YA 1NOMA 2XASA 4TUQA 3NKUA 3K0DA 1W2BU 1BE3H 3AG3B 4DV3B 2ZE5A 5B3QA 4RQ0A 1GK9A 3UPSA 3ETQA 1H2KA 3ZJZA 1SQVH 1CPYA 3STZC 1VF7A 2IHOA 2W0FC 2LQTA 5JJEB 3RYCA 2ADQB 4GKKO 4E2LA 5IIJA 4DR3B 4FJCC 3TETA 5BXZA 1ZQRA 4O2BA 1YDXA 4WBZA 4HYOA 2KSDA 3SJCC 5KHIA 1I94O 4WOYA 4FLXA 3BHPA 2VQEO 3C2KA 5LGTA 1OZ0A 2R9IA 2AHZA 4U7OA 3J81N 5HRFA 5J0WA 3A0HZ 1NTZH 2WWWA 4F5RA 3DTUB 4OXSA 4WQKA 3PHZA 8ICZA 4N7RA 1Z5VA 5EC2C 4TT3G 1AR4A 1WOTA 2CUGA 2BSKA 1HDJA 3AEIA 7ICVA 1AJPA 2B51A 3T1YB 1VQNV 4FLUA 1IXMA 4FM1A 1ZQTA 4OX9O 3RWRD 2Q7HA 4KHPB 2R9RB 4F6EA 5D63A 4LFAB 3N2KB 3H1JH 5CA0A 1PNLA 3OW2U 4ZI7A 3X2QC 3OVBA 1EZJA 3NR7A 5LP6A 1MZEA 1Y76A 1ENVA 2DR8A 4JV5B 8ICTA 4H0LB 1R3KC 2DYSC 4W4KA 1M57B 4GYCB 2JGDB 2YXLA 3BA9A 1AROP 4YMMA 3E89A 4X4SA 2FMSA 4OGQB 4J42A 3RGBA 2EIJB 8ICYA 3RT3C 3OGIB 2N04A 4DV0B 3WFQE 3FYIB 2QR4A 3HJ4A 3WB2A 2IHMA 5JCOA 3AG4B 2IJKA 4E4EA 4Z1VA 1YTFD 4KLGA 2XUMA 4ZKIA 4WC4A 2H8PC 4I29A 4NXMB 4FM2A 4RQ7A 4WFBV 3ETEA 1BSMA 3CJHA 1PD3A 1BZKA 4I50B 7ICLA 3CE2A 3ASNC 8ICLA 2WSSG 3GWOA 4FFBA 4I5SA 3AG3C 1ZQFA 2Q66A 1ZQCA 5J2FA 5JH7A 4LF6O 1K7DA 3PN1A 1KQSU 2ZM6O 1G6UA 5EZYA 1VQLV 2RMKB 1ZQLA 2ZDIC 1COWG 1L0NH 3D36C 1VQ4V 2GA9D 3LQCB 5BZBA 1IBLB 1XL4A 3FAVA 4IG8A 1UPGA 4LF9O 5FLXN 4JI8B 4DK1A 7ICHA 5IE9A 3WFPA 1AI4A 4JI7B 5J2GA 4P4MA 3OTOO 4X65B 2DWDC 4QIWF 1SQXH 1AR1B 3WFOA 8ICIA 4JGSA 4AHCA 4I27A 7ICGA 5J2TB 1MSDA 3ZCCA 4CZZA 3M99B 2D2CB 3JCZA 3AG1B 1W0KG 4S3NA 1H2GA 4WC0A 4KLJA 3RYIB 2DWEC 2BBHA 3OVSA 3JPQA 1R3IC 2DRBA 4JWMA 4NXUA 4YY3O 4LF8B 1KBHA 5LXTB 5CHEA 4NXTA 4UXNA 7ICKA 1B6QA 3ZN0A 4K9AA 8ICKA 4TUSA 2X0LA 8ICOA 3LSUA 1MA1A 4J80A 1QCEA 3JPTA 2ZIMA 1K9MW 4X20B 2GUZB 3ABMB 4FVMA 2H3OA 3FD9A 1HNWB 4MT8A 5LL6Y 2WLHA 1N0JA 4LC1A 1VQ8V 3C3TA 2DJVA 1HNXO 1VQ6V 1T5EA 3MHSC 2GTSA 1NT2B 3AQNA 4OAHA 2HFEC 3U0ZA 4IQWA 1WA8B 2Q73A 3ZS8C 5CFSA 3AG4C 4XDJA 4O4LB 2G38A 5C8YA 2EINC 4P9PA 4X4NA 2UXDO 2DQ3A 1ZQEA 4UB2A 4KP4A 1E1QG 4MF8A 1Q43A 3QO8A 2ZCEA 4R63A 4YHHB 3DC6A 4LH6A 3UO3A 5J2KA 3P3PA 1CXZB 4KFMA 5D49A 1EN4A 4X88A 4QZFA 2UXBO 4KLEA 1RFYA 1ROPA 1VP7A 2ZD9A 1SS3A 1WA8A 5K1PA 2JS3A 1QLNA 4F4LA 1XI1A 1QLEC 1K92A 1B04A 1D2DA 3DXRA 4FLVA 2KB1A 2XAGA 3SYOA 3L75H 4MFCA 1EN5A 4BIUA 5F2VO 1FA0A 8ICQA 1K33A 1I0HA 5B1AB 1HNZB 4DO9A 1YIJV 4PGQA 1SETA 1TUEB 2D3OW 3J80N 3ETGA 5IWAO 4YCXA 2EJRA 9ICXA 4ZHQB 1YI2V 3EVKA 2QM4A 3CCJV 5HRHA 2IJJA 5LBQA 1SZTA 2RJZA 1B3QA 3RW0A 3H3AA 4PDRA
chains in the Genus database with same CATH topology
4P4OA 4UD5A 1ZQKA 2FMQA 2ZH6A 8ICXA 3PMLA 1R89A 4RQ1A 7ICRA 4I2DA 2FMPA 4M9NA 3H39A 9ICBA 4F5QA 3OV7A 3AQLA 3RJIA 2BCQA 4I2BA 4LT6A 4LVSA 4IQUA 2M2TA 4RQ2A 4RWNA 3JPOA 4E80A 1F5AA 3RH6A 9ICKA 2GWSA 4KLUA 1BPEA 2M2VA 5HC9A 4X4QA 4KLOA 1Q79A 4LZDA 1ZQJA 4WC1A 1ZJNA 4PGYA 9ICNA 5BOMA 1MQ3A 4MF2A 9ICAA 3UQ0A 1ZQSA 3MGHA 9ICEA 5J2CA 5HRDA 2BPGA 2ISPA 1BPXA 7ICTA 5IILA 4RWOA 5J2EA 4X4RA 4K4GA 2O1PA 1ZQVA 5HRLA 5CP2A 2ZH1A 4UB3A 4RQ8A 3C66A 2BE3A 3JZ0A 4X5VA 3H37A 1NO5A 4NLZA 5IIMA 4RQ3A 4KLDA 4F5PA 5HR9A 4M5DA 7ICFA 5J0RA 9ICFA 4I2FA 4NXZA 2DR7A 7ICMA 9ICVA 5CB1A 4I2IA 4PGXA 2BCSA 4I2GA 5EOZA 1BPDA 4E8FA 9ICCA 1YLQA 5J0XA 4QZDA 2HHPA 2VANA 5D4BA 3HX0A 3RJEA 4P2HA 7ICIA 1ZQQA 5J0SA 4X4PA 3RJGA 1KDHA 3WFRE 1MIWA 4RPZA 4JWNA 4F5NA 5J2DA 3JPPA 5IIKA 4DOCA 4TUPA 4XA5A 4NLKA 1R8CA 4WC5A 2O5AA 3RJJA 4LZGA 5DB7A 4QZBA 2RFFA 9ICPA 4R65A 1KNYA 5J0UA 1ZQPA 3HW8A 2PFQA 8ICAA 1ZQNA 5HRBA 5J2JA 4O5EA 4KLLA 5DB9A 3AQKA 4RQ4A 3OGUA 5J2IA 1TVAA 4NM1A 9ICOA 4AT9A 4O5KA 8ICJA 4E7XA 4XRHA 4KLSA 3UXPA 4UB4A 3HWTA 3B0XA 5J2HA 4UAWA 5DDMA 1BPYA 2ZH2A 4KLTA 4MFFA 3MDAA 4FH5A 5TZVA 4MFAA 4R64A 2M2WA 5DBCA 5IINA 8ICFA 1VFGA 5CWRA 4M0AA 4RPYA 3AU2A 4KLIA 4WC3A 2ZH7A 3WFSC 3AUOA 4FH3A 4TURA 4NKTA 4EP7A 4XQ8A 4M2YA 1NOMA 5J0YA 9ICIA 4TUQA 4IQTA 8ICRA 3LK9A 3K75D 2BPFA 8ICMA 4RQ0A 4PPXA 3UPSA 3AQMA 1ZJMA 4FHWA 4UD4A 4YN4A 3RH4A 9ICLA 5D46A 2I9GA 5IIJA 4O9MA 5J0PA 1ZQRA 7ICUA 2BCVA 1TV9A 1UEVA 4WBZA 5DEDA 3GDXA 4I28A 5CHGA 1ZQBA 4I2HA 3JYYA 4O5CA 1BPZA 3C2KA 4EBJA 3ISCA 3RJKA 4RT2A 5HRFA 5J0WA 4F5RA 2ZHAA 4UB1A 1BPBA 3UPQA 5IIIA 8ICZA 5DDYA 3UXOA 9ICHA 1WOTA 4R66A 7ICVA 4QZ8A 4QZGA 3NYBA 3C2LA 4FHYA 4FHPA 4YMOA 4AT9B 7ICPA 1ZQTA 8ICHA 4KLFA 7ICOA 5DECA 2PFOA 2ZHBA 4GXIA 4X0BA 2PBEA 7ICNA 2DR5A 1ZQHA 3OVBA 8ICGA 8ICUA 1VJ7A 2DR8A 8ICTA 5CR0A 5HRKA 4ATBA 7ICQA 9ICRA 4YMMA 2ZH3A 5HHHA 4WBYA 3RJHA 4WC6A 1HUOA 4PH5A 9ICWA 4X4SA 4GXJA 2FMSA 1TFYA 1XSLA 1Q78A 2DR9A 1R8BA 3V72A 1V4AA 8ICYA 4QZIA 3PMNA 4QZAA 2BCRA 2NRKA 8ICPA 7ICJA 9ICJA 3WFQE 1R8AA 3HJ4A 2IHMA 4Z6EA 3PNCA 4M9HA 4KLGA 4KLHA 3HJ1A 4XQ7A 4WC4A 4I29A 1JAJA 4RQ7A 7ICLA 1ZQUA 8ICLA 2ZH4A 3HIYA 1KEJA 5BPCA 4QZEA 4RQ6A 1ZQFA 4YD1A 2Q66A 8ICBA 1ZQCA 5J2FA 4NKUA 7ICSA 2ZH5A 4I2EA 1PX5A 3L9DA 2BCUA 4UAZA 3UXNA 4UB5A 1ZQLA 4RT3A 3LQCB 1JN3A 1HUZA 8ICVA 4NLNA 4IG8A 4QZCA 4YD2A 4QZHA 4P4PA 2ID1A 7ICHA 4AT7B 3WFPA 3MGIA 5J2GA 4KLQA 4P4MA 4DOAA 3WFOA 4M9LA 8ICIA 3RJFA 4X4UA 3ISBA 1MIYA 4I27A 7ICGA 4PHEA 2ZH9A 8ICCA 9ICMA 4Z6DA 2ISOA 4S3NA 4WCWA 4K4HA 4PHPA 4WC0A 5CA7A 4KLJA 5J2BA 1ZQIA 3OVSA 3JPQA 5BOLA 1OU5A 2DRBA 4XUSA 2PFNA 5DBBA 4JWMA 4YMNA 2W9MA 4PHAA 7ICKA 1UEUA 3OUYB 5J2AA 8ICKA 4TUSA 8ICOA 8ICEA 5IIOA 2PFPA 3JPTA 4UAYA 2ZH8A 1RPLA 3MBYA 5HREA 3ISDA 1ZQGA 2BPCA 4DOBA 1ZQXA 1ZQOA 4RWPA 3OVAA 5DBAA 3JPRA 3C2MA 3UQ2A 3TFSA 9ICSA 3C18A 4KLMA 4AT7A 4Z6FA 8ICWA 3JPNA 3AQNA 3RH5A 4Z6CA 3MDCA 4X4OA 4IQWA 1MQ2A 3V7JA 4UBCA 4X4TA 3OUYA 4I2CA 9ICQA 4X4NA 1ZQEA 8ICNA 4AT8B 4RPXA 3C5FA 4UB2A 2M2UA 4MF8A 4RQ5A 1JQRA 5J0OA 4R63A 4K4IA 5DB6A 1TFWA 4M04A 8ICSA 5J2KA 4WC2A 4I2AA 4X4VA 5DKWA 5J0QA 5D49A 4RWQA 4AT8A 3C5GA 4M47A 4IQVA 1XSNA 4QZFA 4PHDA 1ZQAA 4KLEA 4WC7A 1ZQYA 1JMSA 1ZQMA 3H38A 9ICTA 7ICEA 4EBKA 1ZQDA 3JPSA 4FO6A 5HRIA 1MIVA 2DRAA 4X0AA 4MFCA 5DB8A 2P66A 4NM2A 5F2VO 1FA0A 2DVIA 5HRGA 8ICQA 2PXIA 9ICGA 4DO9A 3V7LA 4PGQA 3V7KA 4QZ9A 4ATBB 4UBBA 4FHXA 5J0TA 3TFRA 3B0YA 4M9GA 4FHVA 3AU6A 4YCXA 9ICXA 1UETA 5CJ7A 5J29A 1RZTA 4M9JA 1XSPA 4GXKA 5HRHA 5HHIA 4I2JA 1ZQZA 1ZQWA 4NY8A 3H3AA 9ICUA 4F5OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P4O A;  4UD5 A;  1ZQK A;  2FMQ A;  2ZH6 A;  8ICX A;  3PML A;  1R89 A;  4RQ1 A;  7ICR A;  4I2D A;  2FMP A;  4M9N A;  3H39 A;  9ICB A;  4F5Q A;  3OV7 A;  3AQL A;  3RJI A;  2BCQ A;  4I2B A;  4LT6 A;  4LVS A;  4IQU A;  2M2T A;  4RQ2 A;  4RWN A;  3JPO A;  4E80 A;  1F5A A;  3RH6 A;  9ICK A;  2GWS A;  4KLU A;  1BPE A;  2M2V A;  5HC9 A;  4X4Q A;  4KLO A;  1Q79 A;  4LZD A;  1ZQJ A;  4WC1 A;  1ZJN A;  4PGY A;  9ICN A;  5BOM A;  1MQ3 A;  4MF2 A;  9ICA A;  3UQ0 A;  1ZQS A;  3MGH A;  9ICE A;  5J2C A;  5HRD A;  2BPG A;  2ISP A;  1BPX A;  7ICT A;  5IIL A;  4RWO A;  5J2E A;  4X4R A;  4K4G A;  2O1P A;  1ZQV A;  5HRL A;  5CP2 A;  2ZH1 A;  4UB3 A;  4RQ8 A;  3C66 A;  2BE3 A;  3JZ0 A;  4X5V A;  3H37 A;  1NO5 A;  4NLZ A;  5IIM A;  4RQ3 A;  4KLD A;  4F5P A;  5HR9 A;  4M5D A;  7ICF A;  5J0R A;  9ICF A;  4I2F A;  4NXZ A;  2DR7 A;  7ICM A;  9ICV A;  5CB1 A;  4I2I A;  4PGX A;  2BCS A;  4I2G A;  5EOZ A;  1BPD A;  4E8F A;  9ICC A;  1YLQ A;  5J0X A;  4QZD A;  2HHP A;  2VAN A;  5D4B A;  3HX0 A;  3RJE A;  4P2H A;  7ICI A;  1ZQQ A;  5J0S A;  4X4P A;  3RJG A;  1KDH A;  3WFR E;  1MIW A;  4RPZ A;  4JWN A;  4F5N A;  5J2D A;  3JPP A;  5IIK A;  4DOC A;  4TUP A;  4XA5 A;  4NLK A;  1R8C A;  4WC5 A;  2O5A A;  3RJJ A;  4LZG A;  5DB7 A;  4QZB A;  2RFF A;  9ICP A;  4R65 A;  1KNY A;  5J0U A;  1ZQP A;  3HW8 A;  2PFQ A;  8ICA A;  1ZQN A;  5HRB A;  5J2J A;  4O5E A;  4KLL A;  5DB9 A;  3AQK A;  4RQ4 A;  3OGU A;  5J2I A;  1TVA A;  4NM1 A;  9ICO A;  4AT9 A;  4O5K A;  8ICJ A;  4E7X A;  4XRH A;  4KLS A;  3UXP A;  4UB4 A;  3HWT A;  3B0X A;  5J2H A;  4UAW A;  5DDM A;  1BPY A;  2ZH2 A;  4KLT A;  4MFF A;  3MDA A;  4FH5 A;  5TZV A;  4MFA A;  4R64 A;  2M2W A;  5DBC A;  5IIN A;  8ICF A;  1VFG A;  5CWR A;  4M0A A;  4RPY A;  3AU2 A;  4KLI A;  4WC3 A;  2ZH7 A;  3WFS C;  3AUO A;  4FH3 A;  4TUR A;  4NKT A;  4EP7 A;  4XQ8 A;  4M2Y A;  1NOM A;  5J0Y A;  9ICI A;  4TUQ A;  4IQT A;  8ICR A;  3LK9 A;  3K75 D;  2BPF A;  8ICM A;  4RQ0 A;  4PPX A;  3UPS A;  3AQM A;  1ZJM A;  4FHW A;  4UD4 A;  4YN4 A;  3RH4 A;  9ICL A;  5D46 A;  2I9G A;  5IIJ A;  4O9M A;  5J0P A;  1ZQR A;  7ICU A;  2BCV A;  1TV9 A;  1UEV A;  4WBZ A;  5DED A;  3GDX A;  4I28 A;  5CHG A;  1ZQB A;  4I2H A;  3JYY A;  4O5C A;  1BPZ A;  3C2K A;  4EBJ A;  3ISC A;  3RJK A;  4RT2 A;  5HRF A;  5J0W A;  4F5R A;  2ZHA A;  4UB1 A;  1BPB A;  3UPQ A;  5III A;  8ICZ A;  5DDY A;  3UXO A;  9ICH A;  1WOT A;  4R66 A;  7ICV A;  4QZ8 A;  4QZG A;  3NYB A;  3C2L A;  4FHY A;  4FHP A;  4YMO A;  4AT9 B;  7ICP A;  1ZQT A;  8ICH A;  4KLF A;  7ICO A;  5DEC A;  2PFO A;  2ZHB A;  4GXI A;  4X0B A;  2PBE A;  7ICN A;  2DR5 A;  1ZQH A;  3OVB A;  8ICG A;  8ICU A;  1VJ7 A;  2DR8 A;  8ICT A;  5CR0 A;  5HRK A;  4ATB A;  7ICQ A;  9ICR A;  4YMM A;  2ZH3 A;  5HHH A;  4WBY A;  3RJH A;  4WC6 A;  1HUO A;  4PH5 A;  9ICW A;  4X4S A;  4GXJ A;  2FMS A;  1TFY A;  1XSL A;  1Q78 A;  2DR9 A;  1R8B A;  3V72 A;  1V4A A;  8ICY A;  4QZI A;  3PMN A;  4QZA A;  2BCR A;  2NRK A;  8ICP A;  7ICJ A;  9ICJ A;  3WFQ E;  1R8A A;  3HJ4 A;  2IHM A;  4Z6E A;  3PNC A;  4M9H A;  4KLG A;  4KLH A;  3HJ1 A;  4XQ7 A;  4WC4 A;  4I29 A;  1JAJ A;  4RQ7 A;  7ICL A;  1ZQU A;  8ICL A;  2ZH4 A;  3HIY A;  1KEJ A;  5BPC A;  4QZE A;  4RQ6 A;  1ZQF A;  4YD1 A;  2Q66 A;  8ICB A;  1ZQC A;  5J2F A;  4NKU A;  7ICS A;  2ZH5 A;  4I2E A;  1PX5 A;  3L9D A;  2BCU A;  4UAZ A;  3UXN A;  4UB5 A;  1ZQL A;  4RT3 A;  3LQC B;  1JN3 A;  1HUZ A;  8ICV A;  4NLN A;  4IG8 A;  4QZC A;  4YD2 A;  4QZH A;  4P4P A;  2ID1 A;  7ICH A;  4AT7 B;  3WFP A;  3MGI A;  5J2G A;  4KLQ A;  4P4M A;  4DOA A;  3WFO A;  4M9L A;  8ICI A;  3RJF A;  4X4U A;  3ISB A;  1MIY A;  4I27 A;  7ICG A;  4PHE A;  2ZH9 A;  8ICC A;  9ICM A;  4Z6D A;  2ISO A;  4S3N A;  4WCW A;  4K4H A;  4PHP A;  4WC0 A;  5CA7 A;  4KLJ A;  5J2B A;  1ZQI A;  3OVS A;  3JPQ A;  5BOL A;  1OU5 A;  2DRB A;  4XUS A;  2PFN A;  5DBB A;  4JWM A;  4YMN A;  2W9M A;  4PHA A;  7ICK A;  1UEU A;  3OUY B;  5J2A A;  8ICK A;  4TUS A;  8ICO A;  8ICE A;  5IIO A;  2PFP A;  3JPT A;  4UAY A;  2ZH8 A;  1RPL A;  3MBY A;  5HRE A;  3ISD A;  1ZQG A;  2BPC A;  4DOB A;  1ZQX A;  1ZQO A;  4RWP A;  3OVA A;  5DBA A;  3JPR A;  3C2M A;  3UQ2 A;  3TFS A;  9ICS A;  3C18 A;  4KLM A;  4AT7 A;  4Z6F A;  8ICW A;  3JPN A;  3AQN A;  3RH5 A;  4Z6C A;  3MDC A;  4X4O A;  4IQW A;  1MQ2 A;  3V7J A;  4UBC A;  4X4T A;  3OUY A;  4I2C A;  9ICQ A;  4X4N A;  1ZQE A;  8ICN A;  4AT8 B;  4RPX A;  3C5F A;  4UB2 A;  2M2U A;  4MF8 A;  4RQ5 A;  1JQR A;  5J0O A;  4R63 A;  4K4I A;  5DB6 A;  1TFW A;  4M04 A;  8ICS A;  5J2K A;  4WC2 A;  4I2A A;  4X4V A;  5DKW A;  5J0Q A;  5D49 A;  4RWQ A;  4AT8 A;  3C5G A;  4M47 A;  4IQV A;  1XSN A;  4QZF A;  4PHD A;  1ZQA A;  4KLE A;  4WC7 A;  1ZQY A;  1JMS A;  1ZQM A;  3H38 A;  9ICT A;  7ICE A;  4EBK A;  1ZQD A;  3JPS A;  4FO6 A;  5HRI A;  1MIV A;  2DRA A;  4X0A A;  4MFC A;  5DB8 A;  2P66 A;  4NM2 A;  5F2V O;  1FA0 A;  2DVI A;  5HRG A;  8ICQ A;  2PXI A;  9ICG A;  4DO9 A;  3V7L A;  4PGQ A;  3V7K A;  4QZ9 A;  4ATB B;  4UBB A;  4FHX A;  5J0T A;  3TFR A;  3B0Y A;  4M9G A;  4FHV A;  3AU6 A;  4YCX A;  9ICX A;  1UET A;  5CJ7 A;  5J29 A;  1RZT A;  4M9J A;  1XSP A;  4GXK A;  5HRH A;  5HHI A;  4I2J A;  1ZQZ A;  1ZQW A;  4NY8 A;  3H3A A;  9ICU A;  4F5O A; 
#chains in the Genus database with same CATH topology
 4LF8 O;  3PML A;  2QKS A;  3JD1 A;  2KG7 A;  4JTC B;  4DV1 B;  2FMP A;  1J95 A;  1IBK B;  5IJ0 B;  4LVS A;  4LT6 A;  4IQU A;  2QKA A;  4B3T O;  3A2F A;  4K35 A;  5CBG A;  2CGN A;  2YDE A;  3JPO A;  1F5A A;  2YIA A;  4DV7 B;  2JEU A;  3AG2 C;  4IHJ B;  2OTJ V;  4K97 A;  4GLX A;  3OGC C;  1Q79 A;  3W7S A;  4K99 A;  4WC1 A;  3E86 A;  4N23 A;  4PGY A;  1BMF G;  2Q8V A;  5EZY B;  2IM9 A;  9ICN A;  1MQ3 A;  1PL4 A;  9ICA A;  1QHT A;  4LF4 O;  2B56 A;  1XMQ O;  2XHB A;  2PTM A;  5GW7 A;  2BPG A;  2ISP A;  5BMV A;  1H2M A;  5HFL A;  4KHP O;  4JAS A;  1IXB A;  4K4G A;  4X4R A;  2O1P A;  2GAF D;  2UXC O;  3U11 A;  4JTA B;  2QM7 A;  1AR5 A;  3CB2 A;  5CA3 A;  1N4C A;  1NI8 A;  2ZH1 A;  4RQ8 A;  4DR7 B;  4L87 A;  4DV6 O;  1GPJ A;  3RN4 A;  1WN7 A;  5J2U A;  1R1B A;  1BS3 A;  4TUY A;  4DUY B;  3ZIA G;  2OIE A;  3SYQ A;  4DXW A;  3OR6 C;  5J0R A;  3W7X A;  4DUY O;  5L3D A;  2NNU A;  4DR1 B;  9ICF A;  1M1K W;  2DR7 A;  4LEW A;  5BY1 A;  2QGN A;  4PGX A;  1TA8 A;  4G27 B;  2EIL B;  4CH3 A;  3HKE B;  2R70 A;  2K1E A;  1KD1 W;  5J0X A;  1HWY A;  4GZR B;  3H01 A;  3CS5 A;  4DR4 O;  2VAN A;  2GHY A;  2RN9 A;  3B40 A;  4P2H A;  3WFR E;  3IJ4 A;  3P30 A;  5EBW C;  4LF6 B;  5J2D A;  2CDY A;  4TQD A;  4DOC A;  1YJ9 V;  3T4Z A;  2HJD A;  4WC5 A;  3CC4 V;  4LZG A;  1PNK A;  4NXX A;  1NS1 A;  1NH2 D;  1M9N A;  4PEL A;  1FPO A;  4FMT A;  4CH5 A;  5LMU O;  1KKD A;  2PFQ A;  4LF5 O;  2WA4 A;  8ICA A;  1ZQN A;  3CCS V;  3MCR A;  1W0J G;  2FL4 A;  5B1N A;  4RAI A;  3J7A U;  4R7C A;  3ZRX A;  3AQK A;  4BAY A;  5GTI Z;  2F66 C;  5B1B C;  4Z2W A;  4LFB B;  4K96 A;  1TVA A;  4I7Z B;  4B7E A;  1SES A;  1WB8 A;  2RCV A;  4GT1 A;  4NM1 A;  2DYS B;  3BY6 A;  2E76 B;  2XOK G;  3JAL A;  3UXP A;  3FB8 C;  4Q6G A;  1A32 A;  4NVP A;  1ZLZ A;  2BCC H;  3I56 V;  1JVM A;  1Q81 W;  5DDM A;  4KLT A;  2ZH2 A;  4MFF A;  5CA1 A;  2XND G;  2JS5 A;  5DBC A;  3FYE B;  4DUZ O;  3ABL B;  1ZL8 A;  5IYZ A;  3BVO A;  1Y67 A;  4K8X A;  1XMO B;  4OPH A;  4FLY A;  3AU2 A;  4KUM A;  4DYL A;  3VQX A;  1R73 A;  2EBO A;  2MW2 B;  3NWI A;  4FH3 A;  4NKT A;  4B3S O;  3RYF B;  5D61 A;  1H38 A;  3K75 D;  1AJN A;  2BPF A;  8ICM A;  4DRX A;  2IBZ H;  2P90 A;  3QNE A;  4KB6 A;  2EIL C;  4X1Y A;  3RH4 A;  4OPA A;  9ICL A;  1V54 C;  3L71 H;  3VOU A;  3RYH A;  4RWU A;  3UT5 B;  7ICU A;  1TV9 A;  4DW0 A;  5CHG A;  2DN9 A;  4I2H A;  3JYY A;  4XDL A;  1GN3 A;  2ETN A;  3HKB A;  3ISC A;  3RJK A;  4YJ2 B;  4RT2 A;  2CH7 B;  2F43 G;  4DR2 B;  3SR2 C;  3SYC A;  3TK1 A;  2UXC B;  2ZHA A;  3K3W A;  3UPQ A;  5III A;  5DDY A;  5HFM A;  3WG7 C;  1Q86 W;  4WBN A;  1VQM V;  2AGA A;  3T2M A;  3EXA A;  4X64 O;  3NYB A;  3MDS A;  4FHP A;  4AT9 B;  2NN4 A;  4HNA B;  3OUS A;  3TXS A;  7ICO A;  3ZMS A;  4JV5 O;  3BAB A;  5LMN O;  2HHH B;  1F51 A;  4WFF A;  4X0B A;  7ICN A;  1U96 A;  4GX1 A;  5LOV B;  1VAR A;  2XAF A;  8ICG A;  5LP6 C;  5LMN B;  1FXV A;  3T4D A;  2YI8 A;  1N32 B;  3SPJ A;  3ABM C;  5H2F Z;  5HRK A;  4ATB A;  2UUA O;  3K5L A;  1YHQ V;  3RJH A;  4WC6 A;  9ICW A;  1TFY A;  4GXJ A;  1LUV A;  1XSL A;  1AI6 A;  2ZT9 B;  1Q78 A;  2E75 B;  5CMU A;  5EK0 A;  2BCR A;  5IJ9 A;  2A0L A;  7ICJ A;  4J10 A;  5EIB C;  1THZ A;  5K1X A;  4YIO A;  2LW7 A;  2Y0I A;  2ZQM A;  1WP8 A;  4KLH A;  2EIN B;  3HJ1 A;  4LEV A;  1JAJ A;  3R66 A;  2QJ1 A;  3OMI B;  1M4U A;  3CRC A;  2WPD G;  2ZH4 A;  1GH6 A;  4FLT A;  2NLJ C;  1SQP H;  3HIY A;  4RQ6 A;  4TV8 B;  1N34 B;  1TVK B;  3CCV V;  8ICB A;  4NKU A;  1VQ9 V;  2DMX A;  2ZH5 A;  4I2E A;  3IC7 A;  1KUQ A;  3L9D A;  2BCU A;  5JJJ B;  2X6B A;  1WP7 A;  3OTO B;  1TUB A;  1V54 B;  3JSN A;  1FFX A;  8ICV A;  4NLN A;  3KCX A;  1NZ6 A;  4QZC A;  4YD2 A;  4P4P A;  4H13 B;  4AT7 B;  3MGI A;  4KLQ A;  3LSQ A;  1AI5 A;  4X1K B;  4FZ1 A;  4O4I A;  1BQZ A;  1YEW A;  3H1L H;  5CB4 B;  4GCZ A;  1NR7 A;  4JI6 B;  5D62 A;  9ICM A;  3SJB C;  4TV9 B;  5LA6 A;  3FB5 C;  2ISO A;  4AIL C;  3H1K H;  1G8M A;  4F6R A;  3CCE V;  4DR3 O;  4K4H A;  1MG1 A;  1X59 A;  3ASO B;  5J2B A;  1K34 A;  1YVW A;  3RBZ A;  3E22 B;  2PFN A;  1SF9 A;  2EJ7 A;  1E79 G;  4YMN A;  5JVD B;  1OCC B;  4PHA A;  3CEI A;  2P4V A;  1XHZ A;  5J2A A;  3ML0 A;  8ICE A;  4ZOL A;  2EZP A;  4UV8 A;  1RPL A;  1OCR C;  1ZQG A;  4MTO A;  4DOB A;  1M93 A;  3ZMU A;  3JAM N;  5DBA A;  4RWP A;  4DW1 A;  2ATK C;  5DN6 G;  1XQ8 A;  3W7U A;  4OAI Z;  4I9Q A;  4H33 A;  3C2M A;  5LGN A;  4FIP C;  9ICS A;  5DM6 V;  3CRQ A;  4PJ0 Z;  2DW4 A;  4IT5 A;  2X6A A;  3L70 H;  3CC2 V;  2QKC A;  4Z6F A;  2M6Y A;  3ZMT A;  3RH5 A;  3MDC A;  5FNV A;  3SJQ C;  3PJS K;  4X4O A;  1MQ2 A;  1JQ0 A;  4U3J B;  3V7J A;  1GRJ A;  4UBC A;  1OJH A;  3CHX A;  2IU3 A;  2YXY A;  4TSF G;  9ICQ A;  2IJI A;  1GM7 A;  3U10 A;  2FB5 A;  8ICN A;  2P22 C;  3ZED A;  4KM5 A;  2VQF O;  5EYP B;  1FS0 G;  5J0O A;  1FXK B;  2UUC O;  2Q69 A;  5DB6 A;  1RPR A;  4F6R B;  3ABL C;  5LYJ B;  4I2A A;  4UVC A;  2CTR A;  3CPW U;  4IQV A;  1XSN A;  1JCH A;  4PHD A;  2H94 A;  2GTA A;  4B7K A;  1KMI Z;  2YEV B;  2YID A;  3BA8 A;  4JI8 O;  1ZQY A;  2ADP A;  1ZQM A;  3H38 A;  4X1K A;  7ICE A;  1ZQD A;  3JAW A;  4MVM A;  1N36 B;  5HRI A;  1HNZ O;  1M56 B;  4J7J A;  2DRA A;  2FTK A;  5H6R A;  2GDS A;  1GMG A;  2P66 A;  1TUB B;  1JJ2 U;  5HRG A;  4WQL A;  4MW8 A;  1EFR G;  3V7L A;  2A3Q A;  2OCH A;  3ABT A;  4UBB A;  4FHX A;  4UVA A;  1Y74 B;  2Q7G A;  2EIK C;  3K79 A;  4TV8 A;  4M9G A;  3LDC A;  3OD4 A;  3TJT A;  3M7M X;  1UET A;  4PDM A;  4IYI A;  5J29 A;  4M9J A;  2BBJ A;  1MAB G;  1MNG A;  2LFS A;  2YUA A;  1YIT V;  2IUB A;  4OX9 B;  4LCU C;  2LP7 A;  1M5I A;  4H37 A;  2OYQ A;  2BTQ A;  1Q6H A;  2XT9 A;  2HLD G;  5IY5 B;  4DV4 B;  1AIL A;  4DV7 O;  1SQG A;  2HN1 A;  4UB6 Z;  5KHK A;  3AQL A;  4I2B A;  4JAU A;  4NYK A;  4LF7 O;  2XTA A;  2P4K A;  2AXT Z;  1SA0 A;  1JA8 A;  3CYO A;  4KLU A;  1BPE A;  2M7W A;  1K97 A;  5HC9 A;  4X4Q A;  1XOU A;  1XL6 A;  4KLO A;  2PY5 A;  1ZJN A;  3D3I A;  2EIM C;  3DGE A;  1MZF A;  2V1D A;  4DR6 B;  5BOM A;  1R6T A;  5L3F A;  1IUR A;  3QF7 A;  2DQ0 A;  4DR1 O;  1HR0 B;  2DYR C;  1HW7 A;  4MVU A;  5J2C A;  4XJE A;  4O69 A;  3SYA A;  1BPX A;  4LP8 A;  7ICT A;  5IIL A;  1I5Y A;  4EB6 A;  3CSX A;  2CH7 A;  4IGG A;  1H2N A;  4MKP A;  3HKB B;  3CCQ V;  3JAK B;  3H37 A;  3JAT A;  5LMU B;  1J5E B;  2EIJ C;  1F23 A;  3E8G A;  2Y69 B;  3UT5 A;  1DTO A;  4F5P A;  5HR9 A;  3RYH B;  4X8A A;  2CK3 G;  1XUQ A;  4X1Y B;  2MK3 A;  3A0B Z;  3UM7 A;  1GN2 A;  1ZSP A;  2EWR A;  4NXZ A;  2QM8 A;  4BWA A;  7ICM A;  1PP9 H;  4I2I A;  4DRX B;  2AZ0 A;  1AI7 A;  4EV6 A;  4NXM O;  3THO A;  3CCR V;  4X1I A;  1O9G A;  1IBL O;  2ZE7 A;  2ZR2 A;  1P4R A;  5L3C A;  1YXB A;  3KCY A;  4BW5 A;  3RYF A;  2OWO A;  3G4S V;  3E8B A;  3LDD A;  1ZQQ A;  2QA4 V;  1FD9 A;  4X4P A;  5JCO C;  1AB3 A;  4GX2 A;  4B08 A;  4JWN A;  4QE7 A;  5IYZ B;  1ORQ C;  3L72 H;  1RSO A;  4TUP A;  4NLK A;  5KUM A;  2O5A A;  3RJJ A;  1KB9 F;  3OEE G;  5AG2 A;  3SYP A;  4QZB A;  4EGW A;  5ITZ A;  3D3Q A;  4UCS A;  2N05 A;  3K08 A;  4X65 O;  3HW8 A;  4LFC B;  4K0K B;  5LGU A;  4K98 A;  5HRB A;  3GB7 C;  2ILM A;  4LF7 B;  5FPO A;  2Q68 A;  4RQE A;  2UU9 O;  3OMA B;  3N2G B;  2OT5 A;  5J2I A;  2UU9 B;  2ZKO A;  9ICO A;  4O5K A;  1Q3E A;  1SKV A;  1DK1 A;  2JEX A;  2ITC C;  4B3T B;  4IIJ B;  2WLI B;  2O57 A;  3HWT A;  3SDL A;  3M8A A;  3QVN A;  4JAV A;  1BPY A;  4DV2 B;  2ZR3 A;  3FB6 C;  2P5O A;  2EZO A;  4DR2 O;  3ZRW B;  3MHH C;  2VWK A;  3JD3 A;  5KAI Z;  2M2W A;  5IIN A;  2VRZ A;  4PDL A;  4ABM A;  1VFG A;  3I5D A;  4D7T A;  3STL C;  3H1I H;  3T1H O;  5B3S C;  4KLI A;  1KC8 W;  2ZH7 A;  3OWG A;  4TUR A;  4EP7 A;  9ICI A;  4LEY A;  2LO1 A;  5J0Y A;  3JD4 A;  4JI0 O;  4IQT A;  4I0X B;  3ZHR A;  8ICR A;  5IDJ A;  3HKE A;  1ZWI C;  4QJF B;  1XNR O;  1YJN V;  3T1Y O;  3JAR B;  4JI1 O;  4CC6 A;  4GKJ O;  4UD4 A;  1XNR B;  2ZDI A;  2QWR B;  5EIB D;  3P32 A;  4I0X A;  2ZNJ A;  2F1M A;  2I9G A;  4J9Y B;  4UFZ A;  4FPP A;  5J0P A;  1OCZ C;  1IVS A;  2BCV A;  4TUY B;  1UEV A;  3K5N A;  3GDX A;  4I28 A;  4X9Q A;  1CEZ A;  1BPZ A;  2ITD C;  1K5S A;  5L3G A;  3ER8 C;  4EBJ A;  2WA3 A;  2L35 A;  4X66 B;  2IH3 C;  3ZHS A;  2CTQ A;  2JDI G;  2FYU H;  3ZRW A;  4UB1 A;  1BPB A;  1LNQ A;  2ZXW C;  2UXX A;  3BCC H;  2YSU B;  5BR8 O;  2WLN A;  3AK1 A;  4QZ8 A;  2LGQ A;  4QZG A;  4IIJ A;  2BOC C;  3C2L A;  5C93 A;  1F7Y A;  4YMO A;  1VF6 C;  4WCE V;  2BTQ B;  4J9Z B;  7ICP A;  4I9W A;  4LEZ A;  8ICH A;  2QWP B;  5DEC A;  2ZHB A;  2XAH A;  3CCU V;  4GXI A;  3N2G A;  2PBE A;  2YIC A;  2Q0O C;  1U97 A;  1KEC A;  1Y6X A;  4RUE A;  4JI2 B;  1SQB H;  5EBM C;  3WU2 Z;  5IWA B;  1Y74 A;  4X62 O;  2WLM A;  5CR0 A;  4JYB A;  9ICR A;  5E79 Z;  2LGW A;  1TGO A;  2ZH3 A;  3K57 A;  5ITZ B;  4WBY A;  3OAA G;  1HUO A;  4QNH B;  4PH5 A;  1VQK V;  3LSS A;  4LF5 B;  1R8B A;  4JYC A;  1W59 A;  5B5E Z;  1RSO B;  2YS8 A;  2OCC B;  1M56 C;  4QZA A;  1NR1 A;  2GSM B;  4JZG A;  1OCO B;  9ICJ A;  1R8A A;  1IDS A;  2XAQ A;  2ZE8 A;  3JAW B;  4G28 B;  3ZX6 A;  3PNC A;  4YY3 B;  2HVK C;  5L3B A;  2YEV A;  4XQ7 A;  2F4V O;  1AVM A;  2QEX V;  4X1I B;  4NB5 A;  3MAQ A;  1XMQ B;  1ZUQ A;  3T1H B;  3K58 A;  1N8R W;  1KEJ A;  5BPC A;  4YD1 A;  4LNU A;  7ICS A;  3ZMZ A;  1XNQ B;  3GVM A;  3ZN1 A;  4UAZ A;  3UXN A;  2CGO A;  1V9P A;  3ERC C;  4U3J A;  3K9A A;  1HUZ A;  4QGP A;  3FKS G;  4DR6 O;  4QZH A;  2P67 A;  3JAT B;  3CXH F;  3WB0 A;  2FCL A;  4P2Z A;  3JAK A;  4PA6 A;  1FKA O;  2X7R B;  2F93 B;  3CK6 A;  4EB6 B;  4EFB A;  3RJF A;  4X4U A;  3ISB A;  1NTK H;  4PHE A;  1K8A W;  4Q20 A;  3JCF A;  1D5N A;  4Z6D A;  4WCW A;  2A79 B;  4UV9 A;  5CA7 A;  5IT9 N;  1ZQI A;  1S5H C;  1OU5 A;  3ABU A;  4QE9 A;  5DBB A;  5JVD A;  1SC5 B;  4JI5 O;  4YJ3 B;  1OHH G;  1Q6U A;  1VMG A;  2HEP A;  3NVO A;  5IIO A;  2PFP A;  4GX0 A;  4UAY A;  1SA0 B;  3UQ8 A;  3SPC A;  1RPO A;  2EX3 A;  3MBY A;  2BPC A;  1XEQ A;  4WFE A;  4AQY O;  1ZQO A;  3F5W C;  4FO1 A;  4BIZ A;  2JVD A;  1SQF A;  5CB4 A;  4I55 B;  4J7Z A;  1FXH A;  3K06 A;  1LR1 A;  5J9P C;  1BCC H;  4JI4 O;  3UQ2 A;  3TFS A;  4X62 B;  2PGG A;  3C18 A;  3A0R A;  2GUZ A;  4AT7 A;  8ICW A;  4B3R O;  4MVS A;  3JPN A;  2Y69 C;  1OCO C;  4YXW G;  4Z6C A;  3ER9 B;  3HB3 B;  5FL7 G;  4X4T A;  1VF5 B;  1Q7Y W;  4WFH A;  2PUS A;  1YTF B;  4O2A B;  4O4J A;  5LXT A;  1ZTE A;  3BPZ A;  1S76 D;  5FPR A;  2R9A A;  4AT8 B;  4RPX A;  3C5F A;  2HJF C;  2Z0A A;  2M2U A;  3W7T A;  3RYI A;  1JQR A;  3LDE A;  2QTO A;  4JAA A;  5IYB O;  1DLB A;  1NQT A;  5EC1 C;  4M04 A;  8ICS A;  2R72 A;  4WC2 A;  4X4V A;  1N33 B;  5J0Q A;  2W6I G;  4MSW C;  4RWQ A;  4AT8 A;  3C5G A;  2F95 B;  2HKO A;  2PYL A;  4O4J B;  4O2A A;  5B3P A;  2F23 A;  3ABK B;  5B3S B;  2Y4T A;  2IU0 A;  4NXN B;  3QTC A;  4PA3 A;  4EBK A;  3K9S A;  2Q67 A;  1MIV A;  4DV3 O;  1I5X A;  3F7Y C;  4X0A A;  4PA4 A;  4NM2 A;  4O6A A;  4I55 A;  3E83 A;  1QVG U;  1WPX A;  4QZ9 A;  4ATB B;  1FJG O;  2WLK A;  5LYJ A;  4JI6 O;  3TFR A;  1S77 D;  1FXK A;  5EYP A;  4P9O A;  2V7Q G;  4FHV A;  3JSL A;  4B3S B;  5LOV A;  1VIB A;  4YJ3 A;  4GX5 A;  1RZT A;  4GXK A;  4NTX A;  1VQ7 V;  1TAE A;  3KG2 A;  3W7W A;  1VF6 A;  4HNA A;  1H8E G;  4NY8 A;  5FNV B;  1QNM A;  3RH6 A;  4F5O A;  4P4O A;  1ZQK A;  3G80 A;  2ZE6 A;  3SJA C;  2RDC A;  1N0N A;  3O9O A;  2UXN A;  1R89 A;  7ICR A;  3VBB A;  5LHH A;  1YJW V;  3DC5 A;  3G71 V;  9ICB A;  4F5Q A;  3OV7 A;  3RJI A;  4JPR A;  3CME V;  2M2T A;  2RNB A;  4OAF A;  3OE7 G;  4RWN A;  1R6N A;  4QPJ A;  4E80 A;  2JGD A;  4PV1 B;  3OT7 A;  1S5J A;  3JYC A;  2Z5U A;  9ICK A;  4H44 B;  4LH7 A;  5LP6 B;  2M2V A;  3SGI A;  4ZI7 B;  3N2K A;  1ZQJ A;  3OMN B;  2VS0 A;  1YSC A;  3L73 H;  4Z1M G;  4UCU A;  4MF2 A;  3NXS A;  3S3X A;  4RO2 A;  3K0G A;  2E5L B;  1B06 A;  3UQ0 A;  4LNU B;  4HX0 A;  1ZQS A;  3MGH A;  1UFI A;  2IW5 A;  9ICE A;  4K9B A;  5H9C A;  1KU9 A;  3OR7 C;  5LA6 B;  1QQC A;  5HRD A;  2UUC B;  1KYO F;  1JJO A;  1YZB A;  3X2Q B;  4UB8 Z;  4RWO A;  4CC5 A;  3TGU H;  2AW9 A;  5HRL A;  3H9V A;  2XAJ A;  3CC7 V;  4UB3 A;  3G6E V;  5CFT A;  1KP3 A;  4OAG A;  3C66 A;  2BE3 A;  3JZ0 A;  2HN2 A;  2OTL V;  1NO5 A;  4NLZ A;  1ZL8 B;  4J41 A;  3G6B A;  1K5Q A;  3TCU A;  2QDO A;  1XIL A;  1IX9 A;  4MVO A;  2ZXW B;  4M5D A;  1VEW A;  2PZS A;  4CH6 A;  1VQ5 V;  1GTO A;  4JLZ A;  4NTY A;  2DOS A;  4I2F A;  1AJQ A;  9ICV A;  2B9Z A;  5CB1 A;  2LJ2 A;  4I2G A;  2BCS A;  4HAM A;  1Z2G A;  1JR9 A;  3K7D A;  1I08 A;  1YLQ A;  3AK2 A;  1KKC A;  4FLW A;  4BW9 A;  4O68 A;  5TIS Z;  2HHP A;  4JYY A;  1H2L A;  1IBM O;  3HX0 A;  3B2E E;  5J0S A;  3A8T A;  4PHZ A;  4JI3 O;  1P7B A;  2CTP A;  2ZNI A;  5IJ9 B;  1MSW D;  3JPP A;  1WNS A;  3MD0 A;  2Q9L A;  2V4D A;  4XA5 A;  1Q6I A;  1R8C A;  1QU7 A;  3N27 A;  1G4Y B;  3ZBH A;  3UKM A;  2GV9 A;  4G2K A;  5JTG A;  1VQO V;  3HPL C;  3QO7 A;  3H1H H;  1XHX A;  2ZIO A;  5J0U A;  2QWQ B;  4TOI A;  2L6L A;  4U3F H;  3OUF A;  1VQP V;  4DR7 O;  4GKJ B;  5J2J A;  3FFQ A;  4O5E A;  4LFA O;  2YIB A;  2Y0P A;  3OM3 B;  1Z5W A;  1GN4 A;  4R8C A;  1RM1 B;  4RQ4 A;  2GBO A;  5CBF A;  2PI5 A;  1LUW A;  3S3W A;  5A9G A;  1S5L Z;  4JI0 B;  1V55 C;  4AT9 A;  3Q4H B;  4E7X A;  2UXD B;  2ODM A;  3JAR A;  4XRH A;  4KLS A;  1QR9 A;  1S3J A;  5B1O A;  2BTO A;  4JF3 A;  4WBN B;  4KXR A;  5LHG A;  4UAW A;  4PA7 A;  2QSA A;  1XDC A;  3KKY A;  2DE0 X;  2AHY A;  5TZV A;  4R64 A;  4MFA A;  3CRR A;  4AI8 A;  1QBZ A;  4X64 B;  1EM1 A;  4DR4 B;  3L74 H;  2HR3 A;  1M90 W;  5CWR A;  2Y4U A;  4M0A A;  5GON A;  2N74 A;  1NVP D;  2X6C A;  4WC3 A;  1WB7 A;  1WLE A;  2EIK B;  4DV0 O;  4LWS A;  4UUJ C;  4LF9 B;  4IYH A;  5JQG B;  1Y4M A;  3K04 A;  3LK9 A;  4UCV A;  5EBL C;  3VQY A;  2WLI A;  3ABK C;  3JD2 A;  4PPX A;  3ZHV A;  1SER A;  1ZJM A;  3AQM A;  3CRA A;  3SPI A;  2W0X A;  1O9H A;  1P7G A;  4FHW A;  2HVJ C;  4YN4 A;  5B1A C;  1OCC C;  2JIZ G;  4I0U A;  2IH1 C;  5B66 Z;  5IYC O;  5D46 A;  3BRC A;  4CH4 A;  5KHH A;  4O9M A;  3G67 A;  4NXW A;  5DED A;  2YIB D;  4FM0 A;  4IHJ A;  1OCR B;  1ZQB A;  3WB1 A;  4O5C A;  3C3S A;  4WH5 A;  4JI2 O;  4NTW A;  3ZHQ A;  1FYJ A;  3EF2 A;  5IJ0 A;  2C2A A;  4JI7 O;  1QLE B;  1CP9 A;  5CA1 B;  1P49 A;  1QR8 A;  3UXO A;  4MW3 A;  9ICH A;  4DR5 B;  4JI3 B;  4R66 A;  4GUN A;  1UJW B;  1MOF A;  2UUB B;  1NH2 B;  1YF2 A;  2QTS A;  1BHA A;  2EIM B;  3JAL B;  4FHY A;  2P06 A;  4NR1 A;  2E74 B;  3R65 A;  1XMO O;  2UUB O;  5GTH Z;  2DYR B;  4KLF A;  1D5A A;  1HNX B;  4WF9 V;  2PFO A;  5IY5 C;  2DR5 A;  1ZQH A;  1X4T A;  1DF4 A;  3WFV A;  1FAF A;  4K8V A;  1SRY A;  8ICU A;  1VJ7 A;  3EFF K;  3B77 A;  7ICQ A;  4DV6 B;  1JMK C;  1JFF B;  5HHH A;  2E3C A;  1FFT B;  1HR0 O;  2DR9 A;  1PM9 A;  4TWK A;  3V72 A;  1V4A A;  2A9H A;  3JAS A;  1KP2 A;  4QZI A;  3PMN A;  2PYJ A;  2JRI A;  4PD4 F;  2A06 H;  3SPG A;  2NRK A;  2HP8 A;  8ICP A;  5KX5 A;  4UCO A;  2LFR A;  3DXR B;  4DV4 O;  1L8D A;  1JOY A;  1L1F A;  4Z6E A;  5CBH A;  4M9H A;  4YIP A;  3I55 V;  5KHG A;  2JJ1 G;  4MVQ A;  1ZX3 A;  1PKX A;  1ZQU A;  3AG2 B;  4DV2 O;  4QZE A;  4D6T H;  5KAF Z;  3D36 A;  1PX5 A;  4R6Z A;  1EZV H;  4D7S A;  5L3E A;  2OIG A;  4UB5 A;  4O4H B;  2JK5 C;  3E8F A;  5C8Y B;  1K3E A;  4RT3 A;  1H8H G;  3LNN A;  4HZ3 A;  4ICG A;  1JN3 A;  1GN6 A;  1J5E O;  5J2U B;  4I4T A;  4CS3 A;  2ID1 A;  1K4D C;  4FLZ A;  2ZIN A;  3E35 A;  4DOA A;  2Q6A A;  2Z3Y A;  2CTW A;  3TXQ A;  4M9L A;  2WLJ A;  4KL1 A;  1MIY A;  4JLX A;  2ZH9 A;  8ICC A;  2PF4 E;  2AZ2 A;  5BMV B;  3HKD A;  3IGA C;  3QG5 A;  2QWO B;  5KUK A;  4X20 A;  4ZIB A;  1GM8 A;  1K4C C;  4PHP A;  2K9P A;  1IBK O;  3FB7 C;  3ICX A;  4PA9 A;  1US6 A;  3IFX A;  5BOL A;  4UCT A;  4XUS A;  5JWP A;  3CRM A;  2W9M A;  4N21 A;  1UEU A;  3AK3 A;  3OUY B;  2YXH A;  1EN6 A;  3CCM V;  3HKC B;  2ZH8 A;  1N34 O;  5HRE A;  3ISD A;  4MS2 A;  1M57 C;  1ZQX A;  4PI2 A;  3OVA A;  3JPR A;  2ARH A;  4DK0 A;  1BGY H;  5J2T A;  1L0L H;  3K5O A;  4ZBM A;  3VQV A;  4DV1 O;  2JJ2 G;  1URF A;  3GWK C;  2RQ6 A;  2KG7 B;  1RM1 C;  1N36 O;  4KLM A;  4P30 A;  1BT8 A;  4NXV A;  4R50 A;  3HKC A;  3K59 A;  4EEB A;  1V55 B;  1IZ3 A;  3B8M A;  3UCS C;  5A2Q N;  3FX7 A;  4XBF A;  4ASU G;  2P6J A;  5KLV H;  3OUY A;  4I2C A;  3B09 A;  3O65 A;  4MTG A;  4ZHQ A;  1N33 O;  3C90 A;  4NKG B;  3BAA A;  4MTF A;  1PPJ H;  2F4V B;  4RQ5 A;  5JH7 B;  3ASN B;  1I94 B;  4K4I A;  1OCZ B;  1TFW A;  1GAX A;  1FJG B;  4O67 A;  4FFB B;  3E8H A;  1HNW O;  5DKW A;  4EFE A;  3HKD B;  4M47 A;  5B1B B;  1NJI W;  2CE4 A;  3CJH B;  1ZQA A;  4WC7 A;  4DO2 A;  1PV0 A;  4YHH O;  1JMS A;  3CX5 F;  9ICT A;  2A7W A;  3AG7 A;  1WAZ A;  4PDV A;  3JPS A;  4FO6 A;  1DGS A;  2P7T C;  4LR3 A;  1NVP B;  1QVF U;  3LUT B;  1E1R G;  4I4T B;  4WFG A;  5H6Q A;  1R6K A;  5DB8 A;  4L8J A;  2DVI A;  5D5P A;  2PXI A;  4QPK A;  9ICG A;  1GM9 A;  4O4H A;  4JI1 B;  3V7K A;  3B4S A;  4B3M B;  4JYA O;  4X66 O;  3CMA V;  4A5U B;  4EED A;  2BOB C;  5J0T A;  4IL6 Z;  1BQ0 A;  2VQF B;  4UCR A;  3AG1 C;  3B0Y A;  4K3A A;  4UVB A;  4ZOL B;  1N32 O;  4XDK A;  4B3M O;  4JYA B;  4JI5 B;  4BR6 A;  4EKW A;  2YI9 A;  2UXB B;  3AU6 A;  5CA0 B;  1Q5O A;  5CJ7 A;  3DSQ A;  3WG7 B;  4J7K A;  5BR8 B;  1XSP A;  2JGU A;  4O4L A;  3APQ A;  5HHI A;  4CS4 A;  4BIO A;  4I2J A;  1ZQZ A;  3E22 A;  3K03 A;  2B5U A;  4EEQ A;  1ZQW A;  4J11 A;  1AP5 A;  1NBM G;  9ICU A;  4UD5 A;  2FMQ A;  2ZH6 A;  1H2S B;  3B8N A;  8ICX A;  5KX5 B;  1HP8 A;  4RQ1 A;  2QWN B;  4TV9 A;  4I2D A;  4LFB O;  2IJH A;  3JAS B;  3ZMV A;  1SQQ H;  2ZM6 B;  3H39 A;  4M9N A;  4JTD B;  2HG5 C;  3CWB H;  2BCQ A;  4AQY B;  5KA5 A;  4O4I B;  1AP6 A;  1Q90 D;  4RQ2 A;  1JFF A;  3CCL V;  1YCI A;  2HHH O;  4JI4 B;  2GWS A;  4RUF A;  4W4L A;  1I7F A;  1FFX B;  4O2B B;  4DUZ B;  5CFU A;  3E2E A;  1RP3 B;  4LZD A;  5IYD O;  1PNM A;  3RYC B;  5JJN B;  4GKK B;  1WPB A;  3T1C A;  4MVR A;  1NU1 H;  3IC9 A;  4DR5 O;  3ZRS A;  2B4V A;  1TVK A;  3JCU Z;  3K5M A;  3RFR A;  5H5N A;  4NXN O;  1GO3 F;  5J2E A;  1ZQV A;  2NR5 A;  1Q8I A;  5CP2 A;  4DV5 O;  1NTM H;  3ZRV A;  2EUL A;  1G1X B;  3CD6 V;  4LFC O;  4K0K O;  4X5V A;  4RQF A;  1EBO A;  1F4N A;  5IIM A;  3OTF A;  3FAV B;  4MVZ A;  4RQ3 A;  4KLD A;  1F4M A;  2VWJ A;  1R3L C;  2Q5Z A;  2FKX A;  7ICF A;  3CXC U;  1NKD A;  2Q4P A;  3UO2 A;  5KMG A;  2FML A;  2B1I A;  4LF4 B;  4CS2 A;  3CP1 A;  2PI4 A;  2WLL B;  5EOZ A;  1BPD A;  4E8F A;  1JPX A;  3KZI Z;  1IBM B;  9ICC A;  2LW1 A;  3ETD A;  2KKW A;  4I50 A;  2QE7 G;  1JX9 A;  1R3J C;  3OEH G;  1SZX A;  4C7U A;  2VQE B;  4PI0 A;  5JQG A;  4QZD A;  4LBE C;  4LWS B;  3D8C A;  4WFA V;  3ASO C;  5D5Q A;  5D4B A;  3RJE A;  5KHJ A;  7ICI A;  5GON B;  5KA6 A;  3RJG A;  1XNQ O;  1KDH A;  1MIW A;  4RPZ A;  4F5N A;  3BEH A;  1ZAU A;  2Q7E A;  5IIK A;  4U7N A;  5LHI A;  2YC0 A;  4TQF A;  4FFK A;  3ZHU A;  4FZ0 A;  5DB7 A;  2OCC C;  2RFF A;  4K8Z A;  3BFR A;  4YJ2 A;  1OV9 A;  9ICP A;  4R65 A;  1KNY A;  1XRE A;  3LNM B;  2B1G A;  3RVZ A;  3QO5 A;  1ZQP A;  1P84 F;  1WJZ A;  1MMM A;  2CAZ C;  1Y76 B;  3Q4H A;  1BHB A;  1FXK C;  3JD0 A;  3APO A;  4KLL A;  3F7V C;  5DB9 A;  1S0V A;  1BL8 A;  3OFN G;  1DF5 A;  3OGU A;  3IAY A;  2Q0A A;  3F5T A;  1XBL A;  1PL0 A;  8ICJ A;  1S72 V;  2WLL A;  4HBN A;  1GKF A;  4UB4 A;  4X89 A;  1Q82 W;  4MTX A;  2BSK B;  4JZ2 A;  2E5L O;  2Y48 A;  3VQW A;  3B0X A;  2WAM A;  3ZHT A;  5KMG B;  5J2H A;  2KQX A;  3EHB B;  3MDA A;  4FH5 A;  3SPH A;  4B3R B;  2UUA B;  2W6J G;  4FK5 C;  8ICF A;  3RVY A;  4CBC A;  1Y66 A;  3P3N A;  4RPY A;  1K73 W;  5CN0 A;  3HR0 A;  3WFS C;  3AUO A;  5E1A C;  4DV5 B;  4XQ8 A;  4M2Y A;  1NOM A;  2XAS A;  4TUQ A;  3NKU A;  3K0D A;  1W2B U;  1BE3 H;  3AG3 B;  4DV3 B;  2ZE5 A;  5B3Q A;  4RQ0 A;  1GK9 A;  3UPS A;  3ETQ A;  1H2K A;  3ZJZ A;  1SQV H;  1CPY A;  3STZ C;  1VF7 A;  2IHO A;  2W0F C;  2LQT A;  5JJE B;  3RYC A;  2ADQ B;  4GKK O;  4E2L A;  5IIJ A;  4DR3 B;  4FJC C;  3TET A;  5BXZ A;  1ZQR A;  4O2B A;  1YDX A;  4WBZ A;  4HYO A;  2KSD A;  3SJC C;  5KHI A;  1I94 O;  4WOY A;  4FLX A;  3BHP A;  2VQE O;  3C2K A;  5LGT A;  1OZ0 A;  2R9I A;  2AHZ A;  4U7O A;  3J81 N;  5HRF A;  5J0W A;  3A0H Z;  1NTZ H;  2WWW A;  4F5R A;  3DTU B;  4OXS A;  4WQK A;  3PHZ A;  8ICZ A;  4N7R A;  1Z5V A;  5EC2 C;  4TT3 G;  1AR4 A;  1WOT A;  2CUG A;  2BSK A;  1HDJ A;  3AEI A;  7ICV A;  1AJP A;  2B51 A;  3T1Y B;  1VQN V;  4FLU A;  1IXM A;  4FM1 A;  1ZQT A;  4OX9 O;  3RWR D;  2Q7H A;  4KHP B;  2R9R B;  4F6E A;  5D63 A;  4LFA B;  3N2K B;  3H1J H;  5CA0 A;  1PNL A;  3OW2 U;  4ZI7 A;  3X2Q C;  3OVB A;  1EZJ A;  3NR7 A;  5LP6 A;  1MZE A;  1Y76 A;  1ENV A;  2DR8 A;  4JV5 B;  8ICT A;  4H0L B;  1R3K C;  2DYS C;  4W4K A;  1M57 B;  4GYC B;  2JGD B;  2YXL A;  3BA9 A;  1ARO P;  4YMM A;  3E89 A;  4X4S A;  2FMS A;  4OGQ B;  4J42 A;  3RGB A;  2EIJ B;  8ICY A;  3RT3 C;  3OGI B;  2N04 A;  4DV0 B;  3WFQ E;  3FYI B;  2QR4 A;  3HJ4 A;  3WB2 A;  2IHM A;  5JCO A;  3AG4 B;  2IJK A;  4E4E A;  4Z1V A;  1YTF D;  4KLG A;  2XUM A;  4ZKI A;  4WC4 A;  2H8P C;  4I29 A;  4NXM B;  4FM2 A;  4RQ7 A;  4WFB V;  3ETE A;  1BSM A;  3CJH A;  1PD3 A;  1BZK A;  4I50 B;  7ICL A;  3CE2 A;  3ASN C;  8ICL A;  2WSS G;  3GWO A;  4FFB A;  4I5S A;  3AG3 C;  1ZQF A;  2Q66 A;  1ZQC A;  5J2F A;  5JH7 A;  4LF6 O;  1K7D A;  3PN1 A;  1KQS U;  2ZM6 O;  1G6U A;  5EZY A;  1VQL V;  2RMK B;  1ZQL A;  2ZDI C;  1COW G;  1L0N H;  3D36 C;  1VQ4 V;  2GA9 D;  3LQC B;  5BZB A;  1IBL B;  1XL4 A;  3FAV A;  4IG8 A;  1UPG A;  4LF9 O;  5FLX N;  4JI8 B;  4DK1 A;  7ICH A;  5IE9 A;  3WFP A;  1AI4 A;  4JI7 B;  5J2G A;  4P4M A;  3OTO O;  4X65 B;  2DWD C;  4QIW F;  1SQX H;  1AR1 B;  3WFO A;  8ICI A;  4JGS A;  4AHC A;  4I27 A;  7ICG A;  5J2T B;  1MSD A;  3ZCC A;  4CZZ A;  3M99 B;  2D2C B;  3JCZ A;  3AG1 B;  1W0K G;  4S3N A;  1H2G A;  4WC0 A;  4KLJ A;  3RYI B;  2DWE C;  2BBH A;  3OVS A;  3JPQ A;  1R3I C;  2DRB A;  4JWM A;  4NXU A;  4YY3 O;  4LF8 B;  1KBH A;  5LXT B;  5CHE A;  4NXT A;  4UXN A;  7ICK A;  1B6Q A;  3ZN0 A;  4K9A A;  8ICK A;  4TUS A;  2X0L A;  8ICO A;  3LSU A;  1MA1 A;  4J80 A;  1QCE A;  3JPT A;  2ZIM A;  1K9M W;  4X20 B;  2GUZ B;  3ABM B;  4FVM A;  2H3O A;  3FD9 A;  1HNW B;  4MT8 A;  5LL6 Y;  2WLH A;  1N0J A;  4LC1 A;  1VQ8 V;  3C3T A;  2DJV A;  1HNX O;  1VQ6 V;  1T5E A;  3MHS C;  2GTS A;  1NT2 B;  3AQN A;  4OAH A;  2HFE C;  3U0Z A;  4IQW A;  1WA8 B;  2Q73 A;  3ZS8 C;  5CFS A;  3AG4 C;  4XDJ A;  4O4L B;  2G38 A;  5C8Y A;  2EIN C;  4P9P A;  4X4N A;  2UXD O;  2DQ3 A;  1ZQE A;  4UB2 A;  4KP4 A;  1E1Q G;  4MF8 A;  1Q43 A;  3QO8 A;  2ZCE A;  4R63 A;  4YHH B;  3DC6 A;  4LH6 A;  3UO3 A;  5J2K A;  3P3P A;  1CXZ B;  4KFM A;  5D49 A;  1EN4 A;  4X88 A;  4QZF A;  2UXB O;  4KLE A;  1RFY A;  1ROP A;  1VP7 A;  2ZD9 A;  1SS3 A;  1WA8 A;  5K1P A;  2JS3 A;  1QLN A;  4F4L A;  1XI1 A;  1QLE C;  1K92 A;  1B04 A;  1D2D A;  3DXR A;  4FLV A;  2KB1 A;  2XAG A;  3SYO A;  3L75 H;  4MFC A;  1EN5 A;  4BIU A;  5F2V O;  1FA0 A;  8ICQ A;  1K33 A;  1I0H A;  5B1A B;  1HNZ B;  4DO9 A;  1YIJ V;  4PGQ A;  1SET A;  1TUE B;  2D3O W;  3J80 N;  3ETG A;  5IWA O;  4YCX A;  2EJR A;  9ICX A;  4ZHQ B;  1YI2 V;  3EVK A;  2QM4 A;  3CCJ V;  5HRH A;  2IJJ A;  5LBQ A;  1SZT A;  2RJZ A;  1B3Q A;  3RW0 A;  3H3A A;  4PDR A; 
#chains in the Genus database with same CATH homology
 4P4O A;  4UD5 A;  1ZQK A;  2FMQ A;  2ZH6 A;  8ICX A;  3PML A;  1R89 A;  4RQ1 A;  7ICR A;  4I2D A;  2FMP A;  4M9N A;  3H39 A;  9ICB A;  4F5Q A;  3OV7 A;  3AQL A;  3RJI A;  2BCQ A;  4I2B A;  4LT6 A;  4LVS A;  4IQU A;  2M2T A;  4RQ2 A;  4RWN A;  3JPO A;  4E80 A;  1F5A A;  3RH6 A;  9ICK A;  2GWS A;  4KLU A;  1BPE A;  2M2V A;  5HC9 A;  4X4Q A;  4KLO A;  1Q79 A;  4LZD A;  1ZQJ A;  4WC1 A;  1ZJN A;  4PGY A;  9ICN A;  5BOM A;  1MQ3 A;  4MF2 A;  9ICA A;  3UQ0 A;  1ZQS A;  3MGH A;  9ICE A;  5J2C A;  5HRD A;  2BPG A;  2ISP A;  1BPX A;  7ICT A;  5IIL A;  4RWO A;  5J2E A;  4X4R A;  4K4G A;  2O1P A;  1ZQV A;  5HRL A;  5CP2 A;  2ZH1 A;  4UB3 A;  4RQ8 A;  3C66 A;  2BE3 A;  3JZ0 A;  4X5V A;  3H37 A;  1NO5 A;  4NLZ A;  5IIM A;  4RQ3 A;  4KLD A;  4F5P A;  5HR9 A;  4M5D A;  7ICF A;  5J0R A;  9ICF A;  4I2F A;  4NXZ A;  2DR7 A;  7ICM A;  9ICV A;  5CB1 A;  4I2I A;  4PGX A;  2BCS A;  4I2G A;  5EOZ A;  1BPD A;  4E8F A;  9ICC A;  1YLQ A;  5J0X A;  4QZD A;  2HHP A;  2VAN A;  5D4B A;  3HX0 A;  3RJE A;  4P2H A;  7ICI A;  1ZQQ A;  5J0S A;  4X4P A;  3RJG A;  1KDH A;  3WFR E;  1MIW A;  4RPZ A;  4JWN A;  4F5N A;  5J2D A;  3JPP A;  5IIK A;  4DOC A;  4TUP A;  4XA5 A;  4NLK A;  1R8C A;  4WC5 A;  2O5A A;  3RJJ A;  4LZG A;  5DB7 A;  4QZB A;  2RFF A;  9ICP A;  4R65 A;  1KNY A;  5J0U A;  1ZQP A;  3HW8 A;  2PFQ A;  8ICA A;  1ZQN A;  5HRB A;  5J2J A;  4O5E A;  4KLL A;  5DB9 A;  3AQK A;  4RQ4 A;  3OGU A;  5J2I A;  1TVA A;  4NM1 A;  9ICO A;  4AT9 A;  4O5K A;  8ICJ A;  4E7X A;  4XRH A;  4KLS A;  3UXP A;  4UB4 A;  3HWT A;  3B0X A;  5J2H A;  4UAW A;  5DDM A;  1BPY A;  2ZH2 A;  4KLT A;  4MFF A;  3MDA A;  4FH5 A;  5TZV A;  4MFA A;  4R64 A;  2M2W A;  5DBC A;  5IIN A;  8ICF A;  1VFG A;  5CWR A;  4M0A A;  4RPY A;  3AU2 A;  4KLI A;  4WC3 A;  2ZH7 A;  3WFS C;  3AUO A;  4FH3 A;  4TUR A;  4NKT A;  4EP7 A;  4XQ8 A;  4M2Y A;  1NOM A;  5J0Y A;  9ICI A;  4TUQ A;  4IQT A;  8ICR A;  3LK9 A;  3K75 D;  2BPF A;  8ICM A;  4RQ0 A;  4PPX A;  3UPS A;  3AQM A;  1ZJM A;  4FHW A;  4UD4 A;  4YN4 A;  3RH4 A;  9ICL A;  5D46 A;  2I9G A;  5IIJ A;  4O9M A;  5J0P A;  1ZQR A;  7ICU A;  2BCV A;  1TV9 A;  1UEV A;  4WBZ A;  5DED A;  3GDX A;  4I28 A;  5CHG A;  1ZQB A;  4I2H A;  3JYY A;  4O5C A;  1BPZ A;  3C2K A;  4EBJ A;  3ISC A;  3RJK A;  4RT2 A;  5HRF A;  5J0W A;  4F5R A;  2ZHA A;  4UB1 A;  1BPB A;  3UPQ A;  5III A;  8ICZ A;  5DDY A;  3UXO A;  9ICH A;  1WOT A;  4R66 A;  7ICV A;  4QZ8 A;  4QZG A;  3NYB A;  3C2L A;  4FHY A;  4FHP A;  4YMO A;  4AT9 B;  7ICP A;  1ZQT A;  8ICH A;  4KLF A;  7ICO A;  5DEC A;  2PFO A;  2ZHB A;  4GXI A;  4X0B A;  2PBE A;  7ICN A;  2DR5 A;  1ZQH A;  3OVB A;  8ICG A;  8ICU A;  1VJ7 A;  2DR8 A;  8ICT A;  5CR0 A;  5HRK A;  4ATB A;  7ICQ A;  9ICR A;  4YMM A;  2ZH3 A;  5HHH A;  4WBY A;  3RJH A;  4WC6 A;  1HUO A;  4PH5 A;  9ICW A;  4X4S A;  4GXJ A;  2FMS A;  1TFY A;  1XSL A;  1Q78 A;  2DR9 A;  1R8B A;  3V72 A;  1V4A A;  8ICY A;  4QZI A;  3PMN A;  4QZA A;  2BCR A;  2NRK A;  8ICP A;  7ICJ A;  9ICJ A;  3WFQ E;  1R8A A;  3HJ4 A;  2IHM A;  4Z6E A;  3PNC A;  4M9H A;  4KLG A;  4KLH A;  3HJ1 A;  4XQ7 A;  4WC4 A;  4I29 A;  1JAJ A;  4RQ7 A;  7ICL A;  1ZQU A;  8ICL A;  2ZH4 A;  3HIY A;  1KEJ A;  5BPC A;  4QZE A;  4RQ6 A;  1ZQF A;  4YD1 A;  2Q66 A;  8ICB A;  1ZQC A;  5J2F A;  4NKU A;  7ICS A;  2ZH5 A;  4I2E A;  1PX5 A;  3L9D A;  2BCU A;  4UAZ A;  3UXN A;  4UB5 A;  1ZQL A;  4RT3 A;  3LQC B;  1JN3 A;  1HUZ A;  8ICV A;  4NLN A;  4IG8 A;  4QZC A;  4YD2 A;  4QZH A;  4P4P A;  2ID1 A;  7ICH A;  4AT7 B;  3WFP A;  3MGI A;  5J2G A;  4KLQ A;  4P4M A;  4DOA A;  3WFO A;  4M9L A;  8ICI A;  3RJF A;  4X4U A;  3ISB A;  1MIY A;  4I27 A;  7ICG A;  4PHE A;  2ZH9 A;  8ICC A;  9ICM A;  4Z6D A;  2ISO A;  4S3N A;  4WCW A;  4K4H A;  4PHP A;  4WC0 A;  5CA7 A;  4KLJ A;  5J2B A;  1ZQI A;  3OVS A;  3JPQ A;  5BOL A;  1OU5 A;  2DRB A;  4XUS A;  2PFN A;  5DBB A;  4JWM A;  4YMN A;  2W9M A;  4PHA A;  7ICK A;  1UEU A;  3OUY B;  5J2A A;  8ICK A;  4TUS A;  8ICO A;  8ICE A;  5IIO A;  2PFP A;  3JPT A;  4UAY A;  2ZH8 A;  1RPL A;  3MBY A;  5HRE A;  3ISD A;  1ZQG A;  2BPC A;  4DOB A;  1ZQX A;  1ZQO A;  4RWP A;  3OVA A;  5DBA A;  3JPR A;  3C2M A;  3UQ2 A;  3TFS A;  9ICS A;  3C18 A;  4KLM A;  4AT7 A;  4Z6F A;  8ICW A;  3JPN A;  3AQN A;  3RH5 A;  4Z6C A;  3MDC A;  4X4O A;  4IQW A;  1MQ2 A;  3V7J A;  4UBC A;  4X4T A;  3OUY A;  4I2C A;  9ICQ A;  4X4N A;  1ZQE A;  8ICN A;  4AT8 B;  4RPX A;  3C5F A;  4UB2 A;  2M2U A;  4MF8 A;  4RQ5 A;  1JQR A;  5J0O A;  4R63 A;  4K4I A;  5DB6 A;  1TFW A;  4M04 A;  8ICS A;  5J2K A;  4WC2 A;  4I2A A;  4X4V A;  5DKW A;  5J0Q A;  5D49 A;  4RWQ A;  4AT8 A;  3C5G A;  4M47 A;  4IQV A;  1XSN A;  4QZF A;  4PHD A;  1ZQA A;  4KLE A;  4WC7 A;  1ZQY A;  1JMS A;  1ZQM A;  3H38 A;  9ICT A;  7ICE A;  4EBK A;  1ZQD A;  3JPS A;  4FO6 A;  5HRI A;  1MIV A;  2DRA A;  4X0A A;  4MFC A;  5DB8 A;  2P66 A;  4NM2 A;  5F2V O;  1FA0 A;  2DVI A;  5HRG A;  8ICQ A;  2PXI A;  9ICG A;  4DO9 A;  3V7L A;  4PGQ A;  3V7K A;  4QZ9 A;  4ATB B;  4UBB A;  4FHX A;  5J0T A;  3TFR A;  3B0Y A;  4M9G A;  4FHV A;  3AU6 A;  4YCX A;  9ICX A;  1UET A;  5CJ7 A;  5J29 A;  1RZT A;  4M9J A;  1XSP A;  4GXK A;  5HRH A;  5HHI A;  4I2J A;  1ZQZ A;  1ZQW A;  4NY8 A;  3H3A A;  9ICU A;  4F5O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...