5DECA

Crystal structure of the small alarmone synthetase 1 from bacillus subtilis
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
195
structure length
188
Chain Sequence
DDKWERFLVPYRQAVEELKVKLKGIRTLYEDDHSPIEFVTGRVKPVASILEKARRKSIPLHEIETMQDIAGLRIMCQFVDDIQIVKEMLFARKDFTVVDQRDYIAGYRSYHLVVLYPLQTVSGEKHVLVEIQIRTLAMNFWATIEHSLNYKYSGNIPEKVKLRLQRASEAASRLDEEMSEIRGEVQEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP pyrophosphokinase YjbM
publication title Catalytic mechanism and allosteric regulation of an oligomeric (p)ppGpp synthetase by an alarmone.
pubmed doi rcsb
source organism Bacillus subtilis (strain 168)
molecule tags Transferase
total genus 64
structure length 188
sequence length 195
chains with identical sequence B, C, D
ec nomenclature ec 2.7.6.5: GTP diphosphokinase.
pdb deposition date 2015-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04607 RelA_SpoT Region found in RelA / SpoT proteins
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.860 Mainly Alpha Orthogonal Bundle Helix Hairpins Nucleotidyltransferase 5decA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5decA01
4LVSA 8ICHA 4AT8A 4WC0A 1ZQXA 3WFPA 4WBYA 2BPCA 1ZQPA 5HRBA 8ICGA 4I2FA 3MBYA 2FMQA 2ZH3A 4RWOA 5DBCA 9ICTA 5DBAA 9ICPA 3UPSA 5IIIA 3V7JA 1HUOA 3OUYA 5CHGA 1NO5A 3UQ2A 4FO6A 4ATBA 4UAWA 4F5QA 5HRGA 3RJHA 3LQCB 5D49A 7ICUA 4P4PA 5D46A 9ICHA 5J0XA 4JWNA 4RQ7A 2FMSA 3WFRE 4NLNA 4I2DA 4WC5A 4KLDA 4LT6A 3OVSA 4NLKA 4P4MA 4XUSA 8ICBA 1VJ7A 9ICXA 2M2TA 4RWQA 7ICJA 7ICVA 3NYBA 3JPTA 5IIMA 1BPBA 4PGQA 1Q79A 5CA7A 5J2JA 4RT2A 1ZQOA 4M47A 4K4HA 5CB1A 3C5FA 3JZ0A 4NKTA 3UPQA 4NXZA 4UAYA 5HRDA 1BPXA 9ICJA 4I29A 3RJFA 5HRFA 1ZQAA 4QZEA 4R64A 5HHIA 5J2CA 3AQKA 2RFFA 1ZJMA 5IIJA 3AUOA 1XSPA 5J2DA 7ICQA 4AT9A 4IQUA 1JAJA 5IINA 2BCVA 1UEUA 3JPOA 2Q66A 4QZ8A 4QZAA 4MF8A 1ZQNA 4K4GA 2PBEA 3UQ0A 3TFSA 1BPDA 4FHPA 5IIKA 4X0AA 3JPRA 2VANA 3B0YA 4M5DA 4PGYA 4I2EA 4EBJA 4DOBA 4M2YA 8ICJA 3V72A 4QZBA 3RJKA 4MFCA 4RQ0A 2DR8A 8ICKA 2ID1A 9ICVA 2PFPA 1MQ3A 4K4IA 5J29A 4KLOA 8ICMA 4E80A 1VFGA 4KLEA 4RPZA 4YMMA 2GWSA 2M2VA 4I2CA 3C2KA 3PMNA 2ZH6A 1OU5A 4M9JA 3H37A 4I28A 1ZQDA 4MFAA 2O1PA 1ZQVA 8ICVA 4LZGA 4KLHA 4X0BA 4YMNA 9ICEA 3L9DA 9ICMA 4RQ6A 3RJIA 1ZQZA 3H39A 2BE3A 4YCXA 5J2BA 7ICTA 7ICRA 8ICCA 4RWNA 7ICIA 2PFQA 3MGIA 2PFOA 5EOZA 4YMOA 5DB9A 7ICOA 9ICBA 1UETA 1UEVA 2ZHBA 5J2KA 1ZQUA 4WC1A 7ICFA 5CR0A 4FHVA 3JPPA 4QZFA 1ZQRA 4QZ9A 4WC2A 3JPSA 5HHHA 4Z6DA 1Q78A 1ZQQA 4P2HA 4KLGA 1FA0A 4UB2A 9ICCA 9ICWA 1V4AA 9ICUA 8ICZA 3OUYB 5J0QA 1R8BA 5BOLA 4QZIA 1HUZA 4MFFA 4WCWA 3AU6A 5HRKA 7ICPA 5HR9A 4KLQA 4XQ7A 5BOMA 2BPGA 1ZQKA 2ZHAA 5J2IA 3JPQA 5J2FA 2ZH2A 4Z6EA 4UD4A 2ZH4A 4R66A 3AU2A 8ICAA 3OVAA 3WFQE 1ZQHA 4TUQA 1XSNA 4F5NA 4YD2A 4FHXA 3JYYA 7ICNA 4IQTA 9ICQA 4PGXA 4QZGA 2BCQA 1KDHA 2IHMA 1TFWA 8ICYA 1R89A 4I2IA 4RT3A 5DEDA 4KLMA 5HRLA 4RQ4A 3MDCA 4QZHA 3PMLA 2HHPA 1JMSA 4KLUA 3OV7A 1ZQMA 8ICTA 4GXIA 1JQRA 4X4OA 3HX0A 3ISCA 2BCRA 4IG8A 3K75D 7ICGA 4TURA 2DR7A 4FH5A 3HJ1A 4I2JA 5CP2A 4KLIA 4X5VA 8ICXA 5IIOA 4X4QA 5J0RA 4Z6CA 1ZQJA 4UBCA 1JN3A 3WFOA 1ZQLA 4X4SA 5J2GA 1BPYA 4R65A 9ICIA 1BPZA 5J0TA 1MIVA 5DDYA 4KLSA 1F5AA 4XA5A 3MGHA 3HW8A 4I27A 4M9GA 2O5AA 8ICIA 1XSLA 4M9HA 5IILA 8ICOA 2ZH7A 1ZQWA 4UB1A 5DB7A 2BPFA 7ICHA 4P4OA 4NKUA 4O5EA 3H38A 5HRIA 4UAZA 3RJEA 7ICEA 4RWPA 4FHWA 2BCUA 5DDMA 4AT7B 3OGUA 8ICRA 5DECA 3RH6A 8ICSA 5J2EA 3PNCA 9ICFA 8ICFA 4WC3A 4R63A 2DR9A 4NY8A 9ICSA 4KLLA 1MIYA 4YD1A 4AT8B 4WC6A 3C5GA 7ICMA 8ICLA 5DB6A 9ICLA 4WBZA 9ICKA 2ZH9A 3RH4A 1TV9A 4UB3A 4WC7A 5J2HA 3GDXA 1ZQTA 8ICNA 1ZQIA 1ZJNA 4QZDA 3HWTA 4IQWA 3UXPA 3ISBA 4NM1A 1ZQFA 4I2AA 4KLFA 3WFSC 4ATBB 2PXIA 1R8CA 5DKWA 4I2GA 4DO9A 5D4BA 4EP7A 1TVAA 3HJ4A 4LZDA 4F5RA 3TFRA 4I2BA 4PHEA 3HIYA 1MIWA 3C66A 5HREA 2PFNA 2DRBA 4FH3A 5J0OA 2ZH1A 4M9LA 3C18A 5CWRA 1ZQBA 4XQ8A 5J0UA 4UBBA 4PHAA 5DBBA 4X4UA 4PHPA 4UB5A 1KNYA 9ICOA 4O9MA 4QZCA 1PX5A 1NOMA 4S3NA 4NM2A 4UB4A 5J0SA 4EBKA 3JPNA 1ZQGA 9ICRA 4RQ8A 1KEJA 4IQVA 4RPYA 8ICWA 4M9NA 4MF2A 2ZH5A 2DRAA 3RJJA 1TFYA 4UD5A 3AQLA 4PHDA 4Z6FA 5TZVA 4X4NA 2W9MA 1ZQYA 4RQ5A 5HC9A 1MQ2A 3V7KA 5J0PA 4M0AA 4DOCA 4M04A 4O5CA 4RQ1A 4AT9B 7ICSA 4KLTA 1R8AA 2BCSA 5DB8A 4X4PA 1BPEA 1YLQA 4PH5A 4RPXA 3AQNA 7ICKA 4RQ2A 3RJGA 4PPXA 9ICAA 1ZQSA 2DVIA 8ICPA 3V7LA 2M2UA 4X4RA 4FHYA 1ZQEA 3H3AA 3ISDA 4I2HA 4JWMA 4RQ3A 2FMPA 4NLZA 4O5KA 2ISPA 3OVBA 3RH5A 5J0YA 4F5PA 7ICLA 3MDAA 2I9GA 3LK9A 4TUPA 5CJ7A 5F2VO 1WOTA 4X4VA 2P66A 4TUSA 4F5OA 2ZH8A 5HRHA 4E8FA 2DR5A 3B0XA 8ICUA 5BPCA 4AT7A 4WC4A 4XRHA 5J2AA 3C2MA 4GXJA 2M2WA 4KLJA 4DOAA 1RPLA 3AQMA 5J0WA 3C2LA 9ICNA 8ICQA 1ZQCA 2ISOA 4X4TA 3UXNA 9ICGA 4GXKA 8ICEA 4YN4A 3UXOA 1RZTA 4E7XA 2NRKA
chains in the Genus database with same CATH superfamily
2IJJA 2LW1A 5LP6A 4LFBO 4PD4F 1LR1A 2P4KA 2YIBA 3OE7G 4MVMA 2ZKOA 3WFPA 4JI5O 2Q4PA 3CE2A 2BPCA 4WBYA 1ZQPA 3BAAA 5HRBA 4I2FA 4D6TH 4O6AA 3LDEA 4O4JB 1IVSA 5LHHA 5DBAA 9ICPA 3UPSA 5IIIA 2WSSG 1T5EA 1JA8A 2JEXA 4FLXA 5CHGA 5IYCO 4UUJC 4BW9A 1BGYH 2UUBB 2HEPA 4DRXA 4UAWA 2LW7A 1K3EA 2NLJC 4CS2A 1QQCA 5LGUA 3LQCB 3CX5F 4BR6A 2W6IG 5D49A 1B04A 5J0XA 4JWNA 2LFRA 1VQKV 4LEZA 2EIKC 2GSMB 2CTQA 3SJAC 3OUSA 3OVSA 3ABKC 4XUSA 4UVAA 3CCSV 4RWQA 7ICJA 4DW1A 7ICVA 2EIKB 4UB6Z 3CRAA 1FFXB 5IIMA 4JLXA 4IYHA 1BPBA 1OV9A 1Q79A 3THOA 1NZ6A 2CK3G 1YTFB 4M47A 4K4HA 1LUVA 2EIJB 3NWIA 4NKTA 4B7KA 4K0KO 5L3EA 4UAYA 1AR4A 4LF8B 4EFEA 4EEBA 4WH5A 2EIMC 2YXLA 2XNDG 3ZJZA 1VP7A 4XDJA 4R64A 5HHIA 2W6JG 1QU7A 2QKAA 2AZ2A 2RFFA 5IJ9A 3JASA 3NXSA 1FJGO 3K7DA 1XSPA 1PL4A 5J2DA 1G6UA 3DSQA 3ETQA 4GX5A 3B4SA 1ZUQA 2Q6AA 4O4HB 2BCVA 2YIAA 3JPOA 1PL0A 4QZ8A 2OIGA 1EFRG 4IGGA 4MF8A 1R3LC 2ZCEA 1M56B 4IT5A 4MVRA 4DUYB 1HP8A 3JPRA 3ZHQA 1KU9A 2P4VA 4F6RA 2WLIA 4BW5A 2RDCA 3ER8C 3V72A 1EM1A 4U7OA 3DTUB 2R9AA 2ID1A 1BSMA 4K4IA 4H33A 1L0NH 5B66Z 2UUCB 5CA3A 4KLOA 2HJFC 4E80A 1D5NA 1HNZO 1VFGA 4OPHA 1IBMB 2M2VA 4PA6A 1VMGA 4I2CA 4NXMB 4B3TB 1GN2A 2HR3A 3BABA 1DF5A 2X6BA 4LEVA 3CYOA 4M9JA 3H37A 1R6KA 2DOSA 2O1PA 2X0LA 2VQEB 1ZQVA 3K57A 3TCUA 3W7WA 3E8HA 1F4MA 9ICEA 2ZM6O 3CD6V 1Z5VA 2AGAA 4K98A 3RJIA 4DO2A 4DXWA 4UCUA 1DLBA 4I0XB 5J2BA 7ICRA 3ICXA 7ICIA 5DM6V 2HFEC 1I94B 3KG2A 4XDLA 2ZQMA 4X89A 3L74H 4X66O 1F23A 2EZOA 1UEVA 4QZFA 2K1EA 2YUAA 2ZXWB 4FM1A 4LF4O 2OWOA 1P7BA 4JI3B 2B9ZA 3SPGA 9ICUA 1R8BA 3NKUA 3OMAB 4NXUA 4WCWA 4HYOA 3AG1C 5HRKA 1ORQC 2PTMA 7ICPA 1EBOA 5BOMA 2BPGA 1ZQKA 1RFYA 2OCHA 2P5OA 4Z6EA 2CGNA 1N4CA 3H1LH 1KD1W 3OVAA 1J5EO 2DWEC 1XSNA 2HN1A 4F5NA 4FHXA 1GH6A 4IQTA 4PGXA 1RSOB 1WA8B 1Q6IA 2X6AA 3UM7A 3P30A 1TFWA 8ICYA 1QHTA 4I2IA 3ZHSA 5DEDA 2QE7G 3IJ4A 1JOYA 5KUKA 5H9CA 1VIBA 1MOFA 2WLJA 5J9PC 4WQKA 4KLUA 3O9OA 4JI8B 4HX0A 3LSSA 4WQLA 2BCRA 1GN3A 2ILMA 7ICGA 1XEQA 4MTOA 2UUBO 1TUEB 1GTOA 1UFIA 2QWQB 1GM8A 4X5VA 2Q7HA 2NR5A 3JARB 3CPWU 3J7AU 5JH7B 3CCVV 4O4HA 1VQ4V 3K5OA 4DW0A 1Y4MA 4YJ3B 3SYAA 4UBCA 2B56A 3MAQA 3HKBB 9ICIA 2DQ0A 3H1JH 4KFMA 1BPZA 3H9VA 2UUAB 2B1IA 3JSNA 4XA5A 4K8XA 4RUFA 5D5QA 1N36O 5B1BB 3W7SA 4LF6B 4M9GA 5KA5A 1N8RW 1K5QA 3AK3A 4X1YB 1QVFU 1JPXA 2BTQB 3VQYA 2VS0A 2HP8A 2ZH7A 4QPJA 1AR1B 2ZNIA 1ZQWA 7ICHA 4LF8O 1IZ3A 1SESA 3L73H 3H38A 4I55A 3W7XA 3ZMUA 3PJSK 3RJEA 4B7EA 1FKAO 2KKWA 3RT3C 4FHWA 4DV7B 5DDMA 3J80N 4B3RB 5DECA 4W4LA 2ARHA 2G38A 8ICFA 2E74B 4I0XA 5CBHA 2RN9A 1JJ2U 4MW3A 4KLLA 3QTCA 3A8TA 1TAEA 1MSWD 3C5GA 5DB6A 1JFFB 2EJRA 4ZOLB 3QO8A 4FLWA 1XNQB 3K5NA 2MK3A 3BA9A 2EINC 4LFAB 1ZQIA 1ZJNA 3E8BA 3G6BA 5KHGA 4QZDA 2IM9A 1WNSA 1ZQFA 3CEIA 3SYQA 4ATBB 1SQQH 4MS2A 2XHBA 5D4BA 1Q5OA 4NXMO 4B3TO 3OEHG 4ABMA 4I2BA 4QJFB 1MIWA 2CTPA 3OD4A 2W0XA 2VQEO 2ZH1A 1TA8A 2JGUA 4XQ8A 1RSOA 3BRCA 1WA8A 4PHPA 1KNYA 5J2TB 4OX9B 5K1XA 2ZDIA 4X62B 4H13B 5HFMA 1YF2A 1YJ9V 4CBCA 1I94O 4FJCC 4ZI7A 4J7ZA 5LYJB 4UB4A 5E79Z 1H8HG 4HAMA 1ZQGA 3UO2A 5E1AC 4MTFA 4H37A 1FD9A 5GTHZ 4M9NA 4MF2A 2DRAA 3RJJA 1NTMH 3A0HZ 3CCRV 4UCSA 3K79A 3ZRWA 3OR6C 4JYYA 5H6RA 3K06A 4WFEA 2W9MA 1SQVH 5IWAB 2EZPA 4LP8A 1HNXO 4JZ2A 3F5TA 5LXTB 2UXDO 3E35A 1WLEA 4K3AA 3CCEV 3CRMA 2YI8A 4DOCA 1HW7A 5CBFA 4O5CA 1SRYA 5JH7A 4RQ1A 4AT9B 4KLTA 1R8AA 3ZHUA 4L87A 5JCOA 4DR6B 2RNBA 2Y4UA 4XBFA 1NKDA 1W0JG 1Q81W 3HKBA 4BIOA 4RQ2A 4I9WA 4MW8A 1FXKA 2A7WA 2RCVA 4YJ2B 4X4RA 1ZWIC 1F7YA 4K99A 3JAWA 5IE9A 2FMPA 4O5KA 1PV0A 4P30A 3VOUA 2ISPA 3AG4B 2P22C 2F95B 4WFHA 3CMAV 3KCYA 1B6QA 2WAMA 2E76B 4JI8O 1VF5B 2FTKA 3D36C 4WOYA 5F2VO 2P66A 2ZH8A 1AI6A 3T1YB 3CRCA 2M7WA 5IY5C 2HG5C 3RGBA 3HPLC 4XRHA 2IUBA 1YXBA 2EJ7A 3RFRA 2GDSA 2N04A 2IJKA 1OCOC 2IHOA 4FO1A 1ZQCA 2MW2B 2CH7B 4X4TA 4GXKA 8ICEA 3UXOA 1RZTA 2IU3A 4JI6O 1Y66A 5B3SC 3GWOA 3IC9A 2AXTZ 2Q8VA 1JFFA 3JCUZ 4NB5A 4J41A 8ICGA 2FMQA 4RWOA 4FIPC 1UPGA 5B3SB 4LF6O 4TV9A 4EKWA 4I4TA 5B1AB 3OUYA 2QWRB 5KUMA 1P84F 4FO6A 1V9PA 4ATBA 1FJGB 4O4LB 2BBJA 2WA4A 3WB0A 1AVMA 7ICUA 1YCIA 5D46A 2V7QG 5GTIZ 3SPCA 1DGSA 1MA1A 3WFRE 2Q9LA 4B3RO 1YSCA 1K4DC 5DN6G 4UVBA 1GM9A 1JCHA 4X1IA 5J2UB 4WC5A 4KLDA 4LT6A 2YEVA 5C93A 1QLEC 3CXHF 4JI0B 4DV4O 4FK5C 5J2TA 2UXCB 1S0VA 1AB3A 2OYQA 3OEEG 1NI8A 3LSUA 4JGSA 5EYPA 1Y74B 5CA7A 4DUZO 1HNZB 4JI4B 1XNRB 1SQPH 4N21A 4PDVA 3QO7A 2UXBO 4DV6O 1R73A 4CS3A 1M57B 5EBLC 4NXZA 5HRDA 2PZSA 4O68A 3RYCB 3C3TA 4I29A 3CSXA 4K35A 2EILC 5IYDO 1VQ5V 3RJFA 5J2CA 5LXTA 1AROP 1OCCB 3OFNG 3TXSA 3BPZA 3K03A 1ZSPA 4RO2A 4JI2B 3K9AA 4AT9A 1JAJA 2Y0PA 3OUFA 4CH3A 3K3WA 4QZAA 2IH3C 1ZQNA 3AEIA 3UQ0A 4IYIA 1AI7A 3RVZA 5IIKA 4X0AA 3TGUH 3P3NA 3B0YA 4M5DA 4JAUA 4I2EA 3ZCCA 3PHZA 1N34B 2ETNA 4EBJA 1NU1H 3LDDA 3RJKA 3BA8A 1XOUA 8ICKA 3CK6A 2Y69B 9ICVA 3ZRSA 5D63A 2LJ2A 4MT8A 2PFPA 5J29A 2H94A 4LEWA 1NH2D 3VBBA 8ICMA 3M8AA 4DR3B 4RPZA 4FVMA 2QA4V 4DV2B 2XASA 5KMGB 1S5HC 1VQPV 2QSAA 2RMKB 4HNAB 3IFXA 3PMNA 2ZH6A 4X1KB 1F51A 1V54C 1J95A 1OU5A 5IWAO 4OPAA 1KUQA 4H44B 4FMTA 1LUWA 1R6NA 2HKOA 4O2BB 2BSKB 2E3CA 2V4DA 3STLC 1SA0B 2CUGA 3FAVB 1V54B 1KP2A 3JATB 4GT1A 4DR6O 3CCUV 4ZHQB 3WB1A 1ZQZA 2BE3A 3EFFK 3K9SA 4YCXA 1VQMV 1PNLA 2FL4A 1BT8A 2P7TC 1OCZB 2VWKA 1R3IC 2ZE5A 3MGIA 4GKKB 5CFSA 2QR4A 1Q6UA 3L75H 1JQ0A 3DXRB 9ICBA 4PA9A 3B8NA 2IW5A 1TGOA 1IBKB 2CTRA 4LF9B 1YJWV 2Q7GA 1H2NA 1E1QG 4WC1A 4DYLA 4J9ZB 4D7TA 4JASA 3JPSA 1X59A 2JVDA 2B5UA 2X7RB 1KB9F 4EEQA 4EGWA 4P2HA 9ICCA 3BFRA 9ICWA 4O4LA 2PF4E 5J0QA 3K5LA 4QZIA 3T1YO 4MFFA 2DYRC 1IX9A 2O57A 3CB2A 3AU6A 4UCVA 3M99B 3K08A 4XQ7A 3ZIAG 1I5YA 3S3XA 2ZHAA 3H1KH 5J2IA 4E4EA 4UD4A 3D3IA 1AP5A 3AU2A 4FM2A 5J2UA 4LF5B 2DYRB 4PJ0Z 4FLZA 1FAFA 2XT9A 3QVNA 3JYYA 7ICNA 4JYAO 5L3CA 1GAXA 1SQFA 2ZE8A 3X2QC 2XAFA 3ABKB 1N36B 4CC5A 1R89A 4AILC 4MKPA 4KLMA 4FLUA 1Y74A 3SPIA 1KYOF 2EBOA 1YEWA 5BZBA 3X2QB 3PMLA 2GUZA 2KSDA 3B09A 2XOKG 1NS1A 3T2MA 3NR7A 3OV7A 1ZQMA 1WAZA 4H0LB 4GXIA 1JQRA 4X4OA 1VF6C 3HX0A 1MZEA 4IG8A 3K75D 4TURA 3HJ1A 3RW0A 1PM9A 2EIMB 4AI8A 4KLIA 1NBMG 4KP4A 3F7YC 2QKCA 4B08A 8ICXA 3O65A 5IIOA 3FD9A 4J80A 4Z6CA 4G28B 1ZQJA 4K97A 2V1DA 3ABLC 5J2GA 4R65A 3A0BZ 1PKXA 4JI0O 5J0TA 2LGWA 2UXCO 2EWRA 1F5AA 1YVWA 5B1NA 1M1KW 3ABLB 4LNUA 3HW8A 4JI4O 4I27A 1XNRO 8ICIA 4M9HA 1H38A 4UB1A 5DB7A 2FMLA 4P4OA 2Z3YA 2UU9B 5KHKA 5LA6B 2YIDA 3G80A 3ASOC 4O2BA 2BSKA 1K8AW 3OMIB 1ZTEA 2GTAA 4JI2O 4FZ1A 8ICSA 3RWRD 5LGNA 1FYJA 5CA0B 4ZHQA 9ICFA 1IXMA 4I50B 4PA4A 4QGPA 1MIYA 4ASUG 4O4JA 4AT8B 3GWKC 3RBZA 2A06H 3DXRA 4WC6A 1N34O 3L72H 3FB8C 3MDSA 9ICLA 4UB8Z 4WBZA 9ICKA 4JI7B 5GONB 5D61A 1BCCH 2JDIG 3GDXA 1ZQTA 2ADPA 5B3PA 1FXVA 4TUYB 1HNXB 4PA3A 2UXDB 4D7SA 4NM1A 4NTWA 4DR3O 4I2AA 4KM5A 1SZXA 4DV2O 1R8CA 5DKWA 3J81N 1TVAA 2RQ6A 3TFRA 5BMVB 3CCLV 3HIYA 1BQZA 4U7NA 3LNNA 3AG1B 3C66A 4YHHB 5HREA 2PFNA 5J0OA 1IXBA 1KECA 1PPJH 4M9LA 4WFAV 3C18A 1ZLZA 1ZQBA 1FFXA 5FLXN 4PHAA 1NH2B 2BOCC 4O9MA 2QM7A 4QZCA 2PGGA 1K4CC 4S3NA 2GHYA 4GKKO 1FS0G 1SZTA 1IURA 4RQ8A 1PNMA 4J10A 4Q20A 1IBKO 4LF9O 5L3FA 3N27A 4RPYA 3TXQA 8ICWA 3E2EA 2DYSC 3K0GA 2AZ0A 4I9QA 3G71V 2HN2A 2K9PA 4JTAB 1TFYA 1PNKA 3UCSC 4FFKA 5FPRA 3AQLA 4X4NA 2DYSB 1Y67A 4IHJB 1MQ2A 2YIBD 2ITDC 3V7KA 5CFTA 4JI6B 7ICSA 2BCSA 4RAIA 1BPEA 2JK5C 4LF5O 1YLQA 3JD3A 3RYHB 2LGQA 1TVKB 1KKDA 3RJGA 2Q69A 9ICAA 2DVIA 2M2UA 4FHYA 3H3AA 2KQXA 1Q8IA 1EZVH 1KKCA 4RQ3A 5EIBC 3B8MA 2ZD9A 1Z2GA 3D8CA 4WBNB 3CXCU 3B77A 4F5PA 1NJIW 2VQFO 3MDAA 3CC4V 1HR0O 4TUSA 2BOBC 3ZMSA 4X20B 4BAYA 2YC0A 5KX5B 3W7UA 1U96A 2QDOA 4E8FA 2BCCH 3B0XA 8ICUA 4KUMA 1I08A 4WC4A 3ABMC 4WFBV 3HR0A 4DV4B 2HVKC 2XAJA 3JYCA 1VQ9V 3C2LA 3F5WC 1GM7A 8ICQA 1CEZA 3CHXA 2ISOA 3P32A 4DV0B 4E7XA 4KHPB 1PP9H 4DUZB 2CGOA 4CH6A 4LVSA 1CXZB 3ETDA 4AT8A 1HWYA 4WC0A 4G27B 4LH7A 2UXBB 4DV6B 5EBWC 2QM8A 4CH4A 5GONA 3C90A 1KP3A 2N05A 2PI5A 1MNGA 2B1GA 1B3QA 3FYEB 4N7RA 3OT7A 1BZKA 1HUOA 3OR7C 4TUYA 1NO5A 2EINB 3UQ2A 1W59A 4LF7B 5HRGA 3E89A 2UU9O 4P9OA 2CTWA 2PI4A 2XAGA 4DV5O 4P4PA 2Q5ZA 4NXTA 3MCRA 1DF4A 1Q7YW 1WP7A 5JVDB 4RQ7A 2FMSA 1H2KA 1M4UA 2WWWA 3UKMA 4EV6A 4NLNA 4GX2A 4I2DA 1WN7A 3E8FA 1PD3A 3ZX6A 4UFZA 4P4MA 4J11A 8ICBA 2M2TA 1D5AA 2ZR2A 3NYBA 1KQSU 3T1HO 1YDXA 3HKDB 4OXSA 1ZQOA 1QNMA 3Q4HB 3FB7C 1SKVA 5EK0A 4F4LA 1P7GA 3BVOA 4ZBMA 4JI7O 3JZ0A 3C5FA 1XUQA 3UPQA 1BL8A 3ZN1A 1WPBA 1RM1C 2BTOA 4O69A 1BPXA 2D3OW 1ZX3A 4FFBB 3JARA 3TETA 4W4KA 1ZQAA 4JF3A 1VQ7V 4QZEA 2JS5A 3T4DA 1WB8A 4TQFA 4CS4A 4YJ3A 3QNEA 1ZJMA 3AUOA 5GW7A 4IQUA 3WG7C 3WFVA 1HNWO 4YHHO 3RYFB 4LC1A 3DC5A 3RYHA 1XBLA 2UXXA 3QO5A 2PBEA 3TFSA 1TVKA 4FHPA 2UXNA 5EBMC 2VANA 5TISZ 3MHSC 5B3QA 4PGYA 4M2YA 4X1YA 4UCTA 2YICA 2BTQA 4QZBA 4MFCA 1JJOA 5KHHA 5JJJB 3DGEA 2DQ3A 1N32B 1OCRC 4NYKA 3ZN0A 4FLTA 5LL6Y 4NR1A 4BIZA 1GPJA 1WP8A 4YY3B 4KLEA 2GWSA 2OIEA 4P9PA 1F4NA 3D3QA 4X20A 3N2KB 1OCRB 1AILA 3K58A 4QNHB 4MVQA 4P2ZA 1UJWB 1P49A 4NXVA 2R72A 3ASNC 4MSWC 5IY5B 4MFAA 4JYAB 8ICVA 3HKEB 1QR8A 4LCUC 4KLHA 4R50A 4X0BA 4JTDB 1RPOA 4YMNA 4CZZA 3L9DA 2RJZA 1H8EG 1GO3F 4WF9V 3KKYA 1BS3A 1V55C 1OCOB 4X88A 4J42A 4NVPA 5LP6C 4ZOLA 5LOVB 1W2BU 2PFQA 2PFOA 5EOZA 3ZRXA 4AHCA 4YMOA 5DB9A 7ICOA 3CJHB 3FX7A 1UETA 1N0JA 1W0KG 4ICGA 5J2KA 4ZIBA 7ICFA 1NTKH 4DK1A 2KG7B 5CR0A 4FHVA 2R9IA 3ER9B 4K96A 1XREA 1L1FA 1Y76B 3JPPA 3LSQA 5B1OA 3HKCB 5KHJA 5HHHA 3FKSG 1IBLB 4Z6DA 1WB7A 2GTSA 1K73W 3SJBC 4KLGA 1V4AA 1GN6A 1XL6A 2OCCC 2CDYA 5H2FZ 3VQVA 1VQ6V 1WJZA 2ZR3A 4I7ZB 3WB2A 1RPRA 4AQYB 5JVDA 3OWGA 2LFSA 3JPQA 5J2FA 2A9HA 2LQTA 2AW9A 2OCCB 5CMUA 2ZIOA 5IYBO 1VQOV 4R66A 4C7UA 2R70A 4TUQA 3FB6C 2PYLA 9ICQA 1YITV 4DV0O 4KHPO 1QLEB 5LYJA 2XUMA 4DR5B 3CRRA 1YIJV 3HKDA 3ZS8C 3H1IH 3SYPA 1BMFG 5HRLA 3CMEV 4PDMA 3MDCA 2EX3A 3G4SV 2HHPA 4KL1A 1JMSA 3SYOA 2A0LA 3JAMN 4B3SB 2Y4TA 8ICTA 1XDCA 4GYCB 3OM3B 4FFBA 4LF7O 1VQNV 5CP2A 2EILB 1ROPA 5LMNB 2H3OA 4JV5O 5J0RA 3RYFA 4LWSB 2A79B 4YJ2A 1NR1A 1JN3A 4R7CA 3GB7C 3JD1A 3WFOA 3EXAA 2BBHA 4NTYA 5H6QA 4F6EA 4LEYA 4PDLA 1MIVA 1OHHG 2LP7A 1R1BA 5CBGA 1S3JA 3CCQV 4GKJO 4KLSA 5JJNB 3CS5A 5LMUB 2NN4A 3MGHA 4Z1VA 1NVPD 5IDJA 2Q67A 3K04A 1XSLA 5IILA 8ICOA 5CHEA 3CP1A 3P3PA 3N2KA 3H01A 3D36A 4GCZA 4O5EA 4K8ZA 5HRIA 4MVUA 1YHQV 4UAZA 7ICEA 2JGDB 3JCFA 4RWPA 1AJPA 1IDSA 3WU2Z 2CH7A 5A9GA 2BCUA 2A3QA 3OGUA 3HKEA 4HBNA 1SS3A 3JSLA 3LUTB 3RH6A 1XMOB 1S76D 1GRJA 2N74A 3PNCA 4UV9A 3MHHC 2DR9A 5KLVH 5LOVA 3E83A 4YD1A 2JEUA 1VQLV 3AG7A 1AI5A 7ICMA 8ICLA 4RQEA 2ZH9A 4IIJB 2P06A 2ODMA 4KXRA 1Z5WA 2KG7A 1S5JA 3UO3A 1Y76A 2DJVA 4WC7A 3HKCA 5J2HA 1N32O 4MVSA 2P90A 8ICNA 3KZIZ 2W0FC 3OGCC 3EF2A 3UXPA 4IQWA 4KLFA 4YY3O 3WFSC 2PXIA 4DR2B 2QWPB 4DR4B 1QVGU 4I2GA 4DO9A 4L8JA 4DK0A 1BHBA 2GV9A 2YXYA 4J7KA 1XHXA 5EIBD 1URFA 1COWG 4FZ0A 3T4ZA 1LNQA 1A32A 5CA1B 4UBBA 4X4UA 2JS3A 9ICOA 1K97A 3AG3C 3GVMA 2VQFB 4NM2A 1AR5A 3FFQA 2EIJC 4YXWG 1HR0B 1QLNA 2F66C 2FB5A 3JPNA 9ICRA 5JWPA 3RYCA 4IQVA 1GKFA 3AG3B 1CP9A 5BR8B 4FLYA 4NXNO 4UD5A 1IBLO 2AHYA 1H2SB 1K9MW 1TUBB 1H2GA 2E75B 2QGNA 5TZVA 2OTLV 3IAYA 5CB4B 5HC9A 1NT2B 2PY5A 4M0AA 1BHAA 2NNUA 4AQYO 3FB5C 2WA3A 2Q7EA 4PDRA 5DB8A 4JAVA 5FL7G 4LWSA 4X4PA 1M56C 3VQXA 4PH5A 3E22B 7ICKA 3AQNA 4TSFG 4QPKA 1S72V 3SPJA 2PUSA 4WFFA 2CE4A 5JQGB 3M7MX 3ERCC 3V7LA 2DWDC 3ZMVA 4DR5O 1ZQEA 3VQWA 3ISDA 4JWMA 4B3MB 3BEHA 2HLDG 3OVBA 3RH5A 5KMGA 5J0YA 4GZRB 2Q0OC 3LNMB 4HNAA 4DV5B 1VQ8V 4TUPA 4X1KA 4X4VA 1WOTA 4B3SO 3SR2C 4YIOA 1L8DA 5HRHA 3E86A 2JGDA 2DR5A 1AJNA 1SA0A 3TJTA 3FAVA 5J2AA 3JATA 3C2MA 5LMNO 4I55B 4KLJA 2X6CA 1NR7A 1RPLA 4DOAA 3ASOB 5J0WA 2HJDA 2ATKC 3ZBHA 2L35A 3T1HB 9ICGA 3UXNA 4YN4A 3JAKB 4R6ZA 2YSUB 4CH5A 2NRKA 2WLLB 2DE0X 8ICHA 1THZA 1ZQXA 2HHHO 2H8PC 1K34A 4UVCA 4IIJA 3MBYA 1AJQA 1K5SA 4OAFA 5LMUO 2ZH3A 1GMGA 3EHBB 3UT5B 5DBCA 9ICTA 1M93A 2ZXWC 5CN0A 4BIUA 4OAGA 3V7JA 5LHGA 1OJHA 5LGTA 4PELA 4LBEC 1FXHA 3C3SA 4F5QA 1FFTB 3RJHA 1MMMA 1HNWB 3R65A 4Z1MG 3W7TA 9ICHA 3RYIB 3SJQC 5JJEB 1HDJA 4GX0A 3ZMZA 1NVPB 2P67A 5IJ0B 1XMOO 1KBHA 3S3WA 2GBOA 3CCJV 5CA1A 1X4TA 4NLKA 2F1MA 1Q86W 1VJ7A 9ICXA 2ZDIC 2F93B 1I5XA 2QKSA 2IU0A 3JPTA 4BWAA 4NTXA 3STZC 4O4IB 4PGQA 5J2JA 4DV1B 4RT2A 1H2LA 3A0RA 3RN4A 1WPXA 2ZT9B 5CB1A 3CCMV 4ZI7B 3ZEDA 1JMKC 3APOA 1MG1A 2D2CB 5ITZB 1BE3H 9ICJA 1TUBA 5BXZA 4MTGA 1VF6A 5HRFA 4DR2O 4DR4O 2F43G 5CB4A 3ZRWB 3AQKA 3U11A 4RUEA 1FPOA 5IIJA 7ICQA 4I0UA 5JCOC 3A2FA 2M6YA 5EC1C 1QCEA 5IINA 4X65B 1UEUA 4TV8B 3OTOB 2Q66A 3CC2V 4K9AA 5IT9N 1I7FA 4A5UB 1K33A 3E22A 4K4GA 2DN9A 1FXKC 4PI2A 4LR3A 2R9RB 1BPDA 5JQGA 4DV3B 4U3FH 4X9QA 4DOBA 8ICJA 3OMNB 2PYJA 2E5LB 5B1BC 5JTGA 4RQ0A 1FXKB 1DTOA 2DR8A 1VEWA 1MQ3A 3JAWB 4G2KA 5HFLA 1XL4A 2ZINA 3CWBH 1JVMA 4OAIZ 2CAZC 3JALB 1YJNV 2F4VB 2IJIA 5BR8O 4NXXA 4YMMA 5LA6A 3BHPA 4MTXA 3SYCA 2F23A 3U0ZA 4U3JB 4RWUA 3C2KA 3AK2A 1GK9A 2WLNA 5KHIA 4I28A 1ZQDA 5CA0A 1VF7A 1N0NA 3F7VC 2FCLA 2Q68A 4LZGA 5FPOA 4I50A 1ZAUA 1NQTA 1OZ0A 1XHZA 3ABMB 4JAAA 3TK1A 1NTZH 2Y48A 3I5DA 3UQ8A 9ICMA 4EB6B 4RQ6A 3JAKA 3H39A 4PV1B 3AG2C 3JCZA 7ICTA 3N2GB 4LFCB 2GA9D 8ICCA 4RWNA 2WLLA 3CC7V 4K8VA 4JZGA 3U10A 3ETGA 4X64B 3K59A 3AG2B 4JLZA 4DUYO 2ZHBA 4B3MO 2QWOB 3UT5A 5KAIZ 1N33B 1ZQUA 2XAQA 4N23A 5C8YB 2B4VA 1ZQRA 4QZ9A 4WC2A 4FPPA 1ENVA 3LDCA 1Q78A 1QBZA 1R3JC 1G1XB 1ZQQA 1M5IA 5BMVA 4O2AB 4TV9B 3I56V 4JV5B 1YI2V 1FA0A 4UB2A 4I4TB 2UUCO 1KMIZ 1U97A 4QE7A 1CPYA 3OUYB 8ICZA 5BOLA 1ZL8B 1HUZA 5K1PA 3RYIA 1IBMO 5HR9A 4KLQA 1K92A 1Q3EA 2QWNB 4GLXA 2ZH2A 2ITCC 2ZH4A 3ZRVA 8ICAA 5IJ0A 3WFQE 1ZQHA 5L3DA 1S5LZ 3JD0A 1MSDA 4JI1B 4GKJB 4YD2A 2Q0AA 4QZGA 2BCQA 3APQA 5D5PA 2FYUH 1KDHA 3KCXA 1Y6XA 3ZHTA 2IHMA 4X1IB 3SGIA 3R66A 1XMQB 2YEVB 4J7JA 4RT3A 2QEXV 4O4IA 4RQ4A 3SJCC 4DR7B 1O9HA 4LH6A 5H5NA 1BQ0A 4QZHA 5EYPB 3NVOA 4PA7A 2QJ1A 5D62A 5IYZB 1D2DA 2YS8A 2AHZA 4KB6A 5AG2A 5ITZA 4IHJA 4JYBA 1RM1B 5CFUA 3ISCA 5EZYB 2DR7A 4FH5A 1O9GA 3ML0A 1XQ8A 4XDKA 4I2JA 4DR1B 2XTAA 3ABTA 2ADQB 3RVYA 1JR9A 4JI3O 1SF9A 3OGIB 2WPDG 2Z0AA 4X4QA 4QE9A 4TV8A 1H2MA 1GN4A 3WG7B 2QM4A 1ZQLA 4X4SA 1BPYA 2OTJV 4LFBB 1QR9A 1E1RG 1SQBH 1RP3B 4Z2WA 1R6TA 3B2EE 4WBNA 1R3KC 5DDYA 4JI5B 2DW4A 2ZE6A 2Z5UA 3AG4C 2ZE7A 5KA6A 4DV1O 5FNVB 2O5AA 1EN4A 3QF7A 5KX5A 2JIZG 3JALA 3OW2U 2BPFA 4FLVA 2Y0IA 5BY1A 3IC7A 3AK1A 2GAFD 4NKUA 4U3JA 1M9NA 1SQGA 2FKXA 5EC2C 1YTFD 4GX1A 3I55V 1AI4A 2ZIMA 2YI9A 1DK1A 4QIWF 1AP6A 3E8GA 4AT7B 3FYIB 4NKGB 5L3BA 8ICRA 2B51A 4MVOA 1L0LH 3ASNB 1P4RA 2IBZH 4UV8A 4R8CA 3L70H 5J2EA 2QTSA 1I0HA 4K9BA 2WLKA 4EB6A 4X65O 3OTOO 4WC3A 4J9YB 4R63A 3EVKA 3N2GA 1V55B 2JRIA 2XAHA 4NY8A 9ICSA 1M90W 4PI0A 5LP6B 4DV3O 1YZBA 3B40A 1Q43A 4MVZA 3G6EV 2E5LO 4NXNB 1E79G 2DMXA 3RH4A 1TV9A 2YXHA 2WLHA 5B1AC 5C8YA 4K0KB 4UB3A 2UUAO 2IH1C 3JD2A 1EZJA 1SERA 1XILA 3ETEA 4E2LA 2C2AA 3HWTA 3ISBA 1MZFA 4O2AA 2VWJA 2F4VO 4DRXB 3OAAG 2HVJC 1ZL8A 4EP7A 3HJ4A 4LZDA 4F5RA 4JYCA 4PHEA 1G4YB 2WLMA 2ZNJA 2DRBA 4FH3A 5A2QN 4PHZA 4WCEV 3SDLA 5CWRA 4FM0A 4TWKA 4JPRA 5J0UA 4Q6GA 4DV7O 3JD4A 5DBBA 4UB5A 4IL6Z 1SETA 3BCCH 4LFCO 3Q4HA 1Q6HA 1KC8W 1PX5A 1NOMA 4XJEA 4X64O 3ZHRA 3HB3B 5J0SA 4EBKA 2OT5A 1KEJA 4RQFA 1M57C 3IGAC 4WFGA 4EFBA 1N33O 2YDEA 2L6LA 3CRQA 5IYZA 2ZH5A 3L71H 3T1CA 2KB1A 2GUZB 4UXNA 3SPHA 4OGQB 4UCRA 4PHDA 3H1HH 4I5SA 3ZMTA 5EZYA 4Z6FA 1K7DA 1XNQO 4O67A 1OCCC 3G67A 1MABG 3K0DA 4LFAO 5LHIA 2QTOA 1ZQYA 4RQ5A 5IJ9B 3JASB 4YIPA 5J0PA 4M04A 1JX9A 1Q90D 1EN6A 2LO1A 2ZM6B 2JJ1G 4JTCB 3ABUA 1Q82W 2HHHB 4NXWA 4OAHA 3BY6A 1SC5B 4RPXA 4JI1O 4TQDA 4PPXA 1ZQSA 8ICPA 4F6RB 2WLIB 1B06A 1XMQO 5KAFZ 4X66B 4I2HA 4EEDA 2Y69C 4NLZA 5FNVA 5L3GA 2Q73A 3DC6A 4OX9O 4DR7O 2EULA 1EN5A 2IJHA 4HZ3A 4X62O 5LBQA 2JJ2G 4LF4B 2P6JA 4LNUB 3MD0A 4ZKIA 3OTFA 4UCOA 7ICLA 2VRZA 2I9GA 3LK9A 4TT3G 5CJ7A 4CC6A 4GUNA 4X8AA 1G8MA 4F5OA 5B5EZ 1SQXH 4TOIA 1XI1A 5BPCA 4DR1O 3PN1A 4AT7A 4GXJA 2M2WA 3QG5A 3K5MA 3AQMA 1J5EB 9ICNA 1VARA 3ZHVA 1S77D 1OCZC 1US6A 3CJHA
chains in the Genus database with same CATH topology
4LVSA 8ICHA 4AT8A 4WC0A 1ZQXA 3WFPA 4WBYA 2BPCA 1ZQPA 5HRBA 8ICGA 4I2FA 3MBYA 2FMQA 2ZH3A 4RWOA 5DBCA 9ICTA 5DBAA 9ICPA 3UPSA 5IIIA 3V7JA 1HUOA 3OUYA 5CHGA 1NO5A 3UQ2A 4FO6A 4ATBA 4UAWA 4F5QA 5HRGA 3RJHA 3LQCB 5D49A 7ICUA 4P4PA 5D46A 9ICHA 5J0XA 4JWNA 4RQ7A 2FMSA 3WFRE 4NLNA 4I2DA 4WC5A 4KLDA 4LT6A 3OVSA 4NLKA 4P4MA 4XUSA 8ICBA 1VJ7A 9ICXA 2M2TA 4RWQA 7ICJA 7ICVA 3NYBA 3JPTA 5IIMA 1BPBA 4PGQA 1Q79A 5CA7A 5J2JA 4RT2A 1ZQOA 4M47A 4K4HA 5CB1A 3C5FA 3JZ0A 4NKTA 3UPQA 4NXZA 4UAYA 5HRDA 1BPXA 9ICJA 4I29A 3RJFA 5HRFA 1ZQAA 4QZEA 4R64A 5HHIA 5J2CA 3AQKA 2RFFA 1ZJMA 5IIJA 3AUOA 1XSPA 5J2DA 7ICQA 4AT9A 4IQUA 1JAJA 5IINA 2BCVA 1UEUA 3JPOA 2Q66A 4QZ8A 4QZAA 4MF8A 1ZQNA 4K4GA 2PBEA 3UQ0A 3TFSA 1BPDA 4FHPA 5IIKA 4X0AA 3JPRA 2VANA 3B0YA 4M5DA 4PGYA 4I2EA 4EBJA 4DOBA 4M2YA 8ICJA 3V72A 4QZBA 3RJKA 4MFCA 4RQ0A 2DR8A 8ICKA 2ID1A 9ICVA 2PFPA 1MQ3A 4K4IA 5J29A 4KLOA 8ICMA 4E80A 1VFGA 4KLEA 4RPZA 4YMMA 2GWSA 2M2VA 4I2CA 3C2KA 3PMNA 2ZH6A 1OU5A 4M9JA 3H37A 4I28A 1ZQDA 4MFAA 2O1PA 1ZQVA 8ICVA 4LZGA 4KLHA 4X0BA 4YMNA 9ICEA 3L9DA 9ICMA 4RQ6A 3RJIA 1ZQZA 3H39A 2BE3A 4YCXA 5J2BA 7ICTA 7ICRA 8ICCA 4RWNA 7ICIA 2PFQA 3MGIA 2PFOA 5EOZA 4YMOA 5DB9A 7ICOA 9ICBA 1UETA 1UEVA 2ZHBA 5J2KA 1ZQUA 4WC1A 7ICFA 5CR0A 4FHVA 3JPPA 4QZFA 1ZQRA 4QZ9A 4WC2A 3JPSA 5HHHA 4Z6DA 1Q78A 1ZQQA 4P2HA 4KLGA 1FA0A 4UB2A 9ICCA 9ICWA 1V4AA 9ICUA 8ICZA 3OUYB 5J0QA 1R8BA 5BOLA 4QZIA 1HUZA 4MFFA 4WCWA 3AU6A 5HRKA 7ICPA 5HR9A 4KLQA 4XQ7A 5BOMA 2BPGA 1ZQKA 2ZHAA 5J2IA 3JPQA 5J2FA 2ZH2A 4Z6EA 4UD4A 2ZH4A 4R66A 3AU2A 8ICAA 3OVAA 3WFQE 1ZQHA 4TUQA 1XSNA 4F5NA 4YD2A 4FHXA 3JYYA 7ICNA 4IQTA 9ICQA 4PGXA 4QZGA 2BCQA 1KDHA 2IHMA 1TFWA 8ICYA 1R89A 4I2IA 4RT3A 5DEDA 4KLMA 5HRLA 4RQ4A 3MDCA 4QZHA 3PMLA 2HHPA 1JMSA 4KLUA 3OV7A 1ZQMA 8ICTA 4GXIA 1JQRA 4X4OA 3HX0A 3ISCA 2BCRA 4IG8A 3K75D 7ICGA 4TURA 2DR7A 4FH5A 3HJ1A 4I2JA 5CP2A 4KLIA 4X5VA 8ICXA 5IIOA 4X4QA 5J0RA 4Z6CA 1ZQJA 4UBCA 1JN3A 3WFOA 1ZQLA 4X4SA 5J2GA 1BPYA 4R65A 9ICIA 1BPZA 5J0TA 1MIVA 5DDYA 4KLSA 1F5AA 4XA5A 3MGHA 3HW8A 4I27A 4M9GA 2O5AA 8ICIA 1XSLA 4M9HA 5IILA 8ICOA 2ZH7A 1ZQWA 4UB1A 5DB7A 2BPFA 7ICHA 4P4OA 4NKUA 4O5EA 3H38A 5HRIA 4UAZA 3RJEA 7ICEA 4RWPA 4FHWA 2BCUA 5DDMA 4AT7B 3OGUA 8ICRA 5DECA 3RH6A 8ICSA 5J2EA 3PNCA 9ICFA 8ICFA 4WC3A 4R63A 2DR9A 4NY8A 9ICSA 4KLLA 1MIYA 4YD1A 4AT8B 4WC6A 3C5GA 7ICMA 8ICLA 5DB6A 9ICLA 4WBZA 9ICKA 2ZH9A 3RH4A 1TV9A 4UB3A 4WC7A 5J2HA 3GDXA 1ZQTA 8ICNA 1ZQIA 1ZJNA 4QZDA 3HWTA 4IQWA 3UXPA 3ISBA 4NM1A 1ZQFA 4I2AA 4KLFA 3WFSC 4ATBB 2PXIA 1R8CA 5DKWA 4I2GA 4DO9A 5D4BA 4EP7A 1TVAA 3HJ4A 4LZDA 4F5RA 3TFRA 4I2BA 4PHEA 3HIYA 1MIWA 3C66A 5HREA 2PFNA 2DRBA 4FH3A 5J0OA 2ZH1A 4M9LA 3C18A 5CWRA 1ZQBA 4XQ8A 5J0UA 4UBBA 4PHAA 5DBBA 4X4UA 4PHPA 4UB5A 1KNYA 9ICOA 4O9MA 4QZCA 1PX5A 1NOMA 4S3NA 4NM2A 4UB4A 5J0SA 4EBKA 3JPNA 1ZQGA 9ICRA 4RQ8A 1KEJA 4IQVA 4RPYA 8ICWA 4M9NA 4MF2A 2ZH5A 2DRAA 3RJJA 1TFYA 4UD5A 3AQLA 4PHDA 4Z6FA 5TZVA 4X4NA 2W9MA 1ZQYA 4RQ5A 5HC9A 1MQ2A 3V7KA 5J0PA 4M0AA 4DOCA 4M04A 4O5CA 4RQ1A 4AT9B 7ICSA 4KLTA 1R8AA 2BCSA 5DB8A 4X4PA 1BPEA 1YLQA 4PH5A 4RPXA 3AQNA 7ICKA 4RQ2A 3RJGA 4PPXA 9ICAA 1ZQSA 2DVIA 8ICPA 3V7LA 2M2UA 4X4RA 4FHYA 1ZQEA 3H3AA 3ISDA 4I2HA 4JWMA 4RQ3A 2FMPA 4NLZA 4O5KA 2ISPA 3OVBA 3RH5A 5J0YA 4F5PA 7ICLA 3MDAA 2I9GA 3LK9A 4TUPA 5CJ7A 5F2VO 1WOTA 4X4VA 2P66A 4TUSA 4F5OA 2ZH8A 5HRHA 4E8FA 2DR5A 3B0XA 8ICUA 5BPCA 4AT7A 4WC4A 4XRHA 5J2AA 3C2MA 4GXJA 2M2WA 4KLJA 4DOAA 1RPLA 3AQMA 5J0WA 3C2LA 9ICNA 8ICQA 1ZQCA 2ISOA 4X4TA 3UXNA 9ICGA 4GXKA 8ICEA 4YN4A 3UXOA 1RZTA 4E7XA 2NRKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LVS A;  8ICH A;  4AT8 A;  4WC0 A;  1ZQX A;  3WFP A;  4WBY A;  2BPC A;  1ZQP A;  5HRB A;  8ICG A;  4I2F A;  3MBY A;  2FMQ A;  2ZH3 A;  4RWO A;  5DBC A;  9ICT A;  5DBA A;  9ICP A;  3UPS A;  5III A;  3V7J A;  1HUO A;  3OUY A;  5CHG A;  1NO5 A;  3UQ2 A;  4FO6 A;  4ATB A;  4UAW A;  4F5Q A;  5HRG A;  3RJH A;  3LQC B;  5D49 A;  7ICU A;  4P4P A;  5D46 A;  9ICH A;  5J0X A;  4JWN A;  4RQ7 A;  2FMS A;  3WFR E;  4NLN A;  4I2D A;  4WC5 A;  4KLD A;  4LT6 A;  3OVS A;  4NLK A;  4P4M A;  4XUS A;  8ICB A;  1VJ7 A;  9ICX A;  2M2T A;  4RWQ A;  7ICJ A;  7ICV A;  3NYB A;  3JPT A;  5IIM A;  1BPB A;  4PGQ A;  1Q79 A;  5CA7 A;  5J2J A;  4RT2 A;  1ZQO A;  4M47 A;  4K4H A;  5CB1 A;  3C5F A;  3JZ0 A;  4NKT A;  3UPQ A;  4NXZ A;  4UAY A;  5HRD A;  1BPX A;  9ICJ A;  4I29 A;  3RJF A;  5HRF A;  1ZQA A;  4QZE A;  4R64 A;  5HHI A;  5J2C A;  3AQK A;  2RFF A;  1ZJM A;  5IIJ A;  3AUO A;  1XSP A;  5J2D A;  7ICQ A;  4AT9 A;  4IQU A;  1JAJ A;  5IIN A;  2BCV A;  1UEU A;  3JPO A;  2Q66 A;  4QZ8 A;  4QZA A;  4MF8 A;  1ZQN A;  4K4G A;  2PBE A;  3UQ0 A;  3TFS A;  1BPD A;  4FHP A;  5IIK A;  4X0A A;  3JPR A;  2VAN A;  3B0Y A;  4M5D A;  4PGY A;  4I2E A;  4EBJ A;  4DOB A;  4M2Y A;  8ICJ A;  3V72 A;  4QZB A;  3RJK A;  4MFC A;  4RQ0 A;  2DR8 A;  8ICK A;  2ID1 A;  9ICV A;  2PFP A;  1MQ3 A;  4K4I A;  5J29 A;  4KLO A;  8ICM A;  4E80 A;  1VFG A;  4KLE A;  4RPZ A;  4YMM A;  2GWS A;  2M2V A;  4I2C A;  3C2K A;  3PMN A;  2ZH6 A;  1OU5 A;  4M9J A;  3H37 A;  4I28 A;  1ZQD A;  4MFA A;  2O1P A;  1ZQV A;  8ICV A;  4LZG A;  4KLH A;  4X0B A;  4YMN A;  9ICE A;  3L9D A;  9ICM A;  4RQ6 A;  3RJI A;  1ZQZ A;  3H39 A;  2BE3 A;  4YCX A;  5J2B A;  7ICT A;  7ICR A;  8ICC A;  4RWN A;  7ICI A;  2PFQ A;  3MGI A;  2PFO A;  5EOZ A;  4YMO A;  5DB9 A;  7ICO A;  9ICB A;  1UET A;  1UEV A;  2ZHB A;  5J2K A;  1ZQU A;  4WC1 A;  7ICF A;  5CR0 A;  4FHV A;  3JPP A;  4QZF A;  1ZQR A;  4QZ9 A;  4WC2 A;  3JPS A;  5HHH A;  4Z6D A;  1Q78 A;  1ZQQ A;  4P2H A;  4KLG A;  1FA0 A;  4UB2 A;  9ICC A;  9ICW A;  1V4A A;  9ICU A;  8ICZ A;  3OUY B;  5J0Q A;  1R8B A;  5BOL A;  4QZI A;  1HUZ A;  4MFF A;  4WCW A;  3AU6 A;  5HRK A;  7ICP A;  5HR9 A;  4KLQ A;  4XQ7 A;  5BOM A;  2BPG A;  1ZQK A;  2ZHA A;  5J2I A;  3JPQ A;  5J2F A;  2ZH2 A;  4Z6E A;  4UD4 A;  2ZH4 A;  4R66 A;  3AU2 A;  8ICA A;  3OVA A;  3WFQ E;  1ZQH A;  4TUQ A;  1XSN A;  4F5N A;  4YD2 A;  4FHX A;  3JYY A;  7ICN A;  4IQT A;  9ICQ A;  4PGX A;  4QZG A;  2BCQ A;  1KDH A;  2IHM A;  1TFW A;  8ICY A;  1R89 A;  4I2I A;  4RT3 A;  5DED A;  4KLM A;  5HRL A;  4RQ4 A;  3MDC A;  4QZH A;  3PML A;  2HHP A;  1JMS A;  4KLU A;  3OV7 A;  1ZQM A;  8ICT A;  4GXI A;  1JQR A;  4X4O A;  3HX0 A;  3ISC A;  2BCR A;  4IG8 A;  3K75 D;  7ICG A;  4TUR A;  2DR7 A;  4FH5 A;  3HJ1 A;  4I2J A;  5CP2 A;  4KLI A;  4X5V A;  8ICX A;  5IIO A;  4X4Q A;  5J0R A;  4Z6C A;  1ZQJ A;  4UBC A;  1JN3 A;  3WFO A;  1ZQL A;  4X4S A;  5J2G A;  1BPY A;  4R65 A;  9ICI A;  1BPZ A;  5J0T A;  1MIV A;  5DDY A;  4KLS A;  1F5A A;  4XA5 A;  3MGH A;  3HW8 A;  4I27 A;  4M9G A;  2O5A A;  8ICI A;  1XSL A;  4M9H A;  5IIL A;  8ICO A;  2ZH7 A;  1ZQW A;  4UB1 A;  5DB7 A;  2BPF A;  7ICH A;  4P4O A;  4NKU A;  4O5E A;  3H38 A;  5HRI A;  4UAZ A;  3RJE A;  7ICE A;  4RWP A;  4FHW A;  2BCU A;  5DDM A;  4AT7 B;  3OGU A;  8ICR A;  5DEC A;  3RH6 A;  8ICS A;  5J2E A;  3PNC A;  9ICF A;  8ICF A;  4WC3 A;  4R63 A;  2DR9 A;  4NY8 A;  9ICS A;  4KLL A;  1MIY A;  4YD1 A;  4AT8 B;  4WC6 A;  3C5G A;  7ICM A;  8ICL A;  5DB6 A;  9ICL A;  4WBZ A;  9ICK A;  2ZH9 A;  3RH4 A;  1TV9 A;  4UB3 A;  4WC7 A;  5J2H A;  3GDX A;  1ZQT A;  8ICN A;  1ZQI A;  1ZJN A;  4QZD A;  3HWT A;  4IQW A;  3UXP A;  3ISB A;  4NM1 A;  1ZQF A;  4I2A A;  4KLF A;  3WFS C;  4ATB B;  2PXI A;  1R8C A;  5DKW A;  4I2G A;  4DO9 A;  5D4B A;  4EP7 A;  1TVA A;  3HJ4 A;  4LZD A;  4F5R A;  3TFR A;  4I2B A;  4PHE A;  3HIY A;  1MIW A;  3C66 A;  5HRE A;  2PFN A;  2DRB A;  4FH3 A;  5J0O A;  2ZH1 A;  4M9L A;  3C18 A;  5CWR A;  1ZQB A;  4XQ8 A;  5J0U A;  4UBB A;  4PHA A;  5DBB A;  4X4U A;  4PHP A;  4UB5 A;  1KNY A;  9ICO A;  4O9M A;  4QZC A;  1PX5 A;  1NOM A;  4S3N A;  4NM2 A;  4UB4 A;  5J0S A;  4EBK A;  3JPN A;  1ZQG A;  9ICR A;  4RQ8 A;  1KEJ A;  4IQV A;  4RPY A;  8ICW A;  4M9N A;  4MF2 A;  2ZH5 A;  2DRA A;  3RJJ A;  1TFY A;  4UD5 A;  3AQL A;  4PHD A;  4Z6F A;  5TZV A;  4X4N A;  2W9M A;  1ZQY A;  4RQ5 A;  5HC9 A;  1MQ2 A;  3V7K A;  5J0P A;  4M0A A;  4DOC A;  4M04 A;  4O5C A;  4RQ1 A;  4AT9 B;  7ICS A;  4KLT A;  1R8A A;  2BCS A;  5DB8 A;  4X4P A;  1BPE A;  1YLQ A;  4PH5 A;  4RPX A;  3AQN A;  7ICK A;  4RQ2 A;  3RJG A;  4PPX A;  9ICA A;  1ZQS A;  2DVI A;  8ICP A;  3V7L A;  2M2U A;  4X4R A;  4FHY A;  1ZQE A;  3H3A A;  3ISD A;  4I2H A;  4JWM A;  4RQ3 A;  2FMP A;  4NLZ A;  4O5K A;  2ISP A;  3OVB A;  3RH5 A;  5J0Y A;  4F5P A;  7ICL A;  3MDA A;  2I9G A;  3LK9 A;  4TUP A;  5CJ7 A;  5F2V O;  1WOT A;  4X4V A;  2P66 A;  4TUS A;  4F5O A;  2ZH8 A;  5HRH A;  4E8F A;  2DR5 A;  3B0X A;  8ICU A;  5BPC A;  4AT7 A;  4WC4 A;  4XRH A;  5J2A A;  3C2M A;  4GXJ A;  2M2W A;  4KLJ A;  4DOA A;  1RPL A;  3AQM A;  5J0W A;  3C2L A;  9ICN A;  8ICQ A;  1ZQC A;  2ISO A;  4X4T A;  3UXN A;  9ICG A;  4GXK A;  8ICE A;  4YN4 A;  3UXO A;  1RZT A;  4E7X A;  2NRK A; 
#chains in the Genus database with same CATH topology
 2IJJ A;  2LW1 A;  5LP6 A;  4LFB O;  4PD4 F;  1LR1 A;  2P4K A;  2YIB A;  3OE7 G;  4MVM A;  2ZKO A;  3WFP A;  4JI5 O;  2Q4P A;  3CE2 A;  2BPC A;  4WBY A;  1ZQP A;  3BAA A;  5HRB A;  4I2F A;  4D6T H;  4O6A A;  3LDE A;  4O4J B;  1IVS A;  5LHH A;  5DBA A;  9ICP A;  3UPS A;  5III A;  2WSS G;  1T5E A;  1JA8 A;  2JEX A;  4FLX A;  5CHG A;  5IYC O;  4UUJ C;  4BW9 A;  1BGY H;  2UUB B;  2HEP A;  4DRX A;  4UAW A;  2LW7 A;  1K3E A;  2NLJ C;  4CS2 A;  1QQC A;  5LGU A;  3LQC B;  3CX5 F;  4BR6 A;  2W6I G;  5D49 A;  1B04 A;  5J0X A;  4JWN A;  2LFR A;  1VQK V;  4LEZ A;  2EIK C;  2GSM B;  2CTQ A;  3SJA C;  3OUS A;  3OVS A;  3ABK C;  4XUS A;  4UVA A;  3CCS V;  4RWQ A;  7ICJ A;  4DW1 A;  7ICV A;  2EIK B;  4UB6 Z;  3CRA A;  1FFX B;  5IIM A;  4JLX A;  4IYH A;  1BPB A;  1OV9 A;  1Q79 A;  3THO A;  1NZ6 A;  2CK3 G;  1YTF B;  4M47 A;  4K4H A;  1LUV A;  2EIJ B;  3NWI A;  4NKT A;  4B7K A;  4K0K O;  5L3E A;  4UAY A;  1AR4 A;  4LF8 B;  4EFE A;  4EEB A;  4WH5 A;  2EIM C;  2YXL A;  2XND G;  3ZJZ A;  1VP7 A;  4XDJ A;  4R64 A;  5HHI A;  2W6J G;  1QU7 A;  2QKA A;  2AZ2 A;  2RFF A;  5IJ9 A;  3JAS A;  3NXS A;  1FJG O;  3K7D A;  1XSP A;  1PL4 A;  5J2D A;  1G6U A;  3DSQ A;  3ETQ A;  4GX5 A;  3B4S A;  1ZUQ A;  2Q6A A;  4O4H B;  2BCV A;  2YIA A;  3JPO A;  1PL0 A;  4QZ8 A;  2OIG A;  1EFR G;  4IGG A;  4MF8 A;  1R3L C;  2ZCE A;  1M56 B;  4IT5 A;  4MVR A;  4DUY B;  1HP8 A;  3JPR A;  3ZHQ A;  1KU9 A;  2P4V A;  4F6R A;  2WLI A;  4BW5 A;  2RDC A;  3ER8 C;  3V72 A;  1EM1 A;  4U7O A;  3DTU B;  2R9A A;  2ID1 A;  1BSM A;  4K4I A;  4H33 A;  1L0N H;  5B66 Z;  2UUC B;  5CA3 A;  4KLO A;  2HJF C;  4E80 A;  1D5N A;  1HNZ O;  1VFG A;  4OPH A;  1IBM B;  2M2V A;  4PA6 A;  1VMG A;  4I2C A;  4NXM B;  4B3T B;  1GN2 A;  2HR3 A;  3BAB A;  1DF5 A;  2X6B A;  4LEV A;  3CYO A;  4M9J A;  3H37 A;  1R6K A;  2DOS A;  2O1P A;  2X0L A;  2VQE B;  1ZQV A;  3K57 A;  3TCU A;  3W7W A;  3E8H A;  1F4M A;  9ICE A;  2ZM6 O;  3CD6 V;  1Z5V A;  2AGA A;  4K98 A;  3RJI A;  4DO2 A;  4DXW A;  4UCU A;  1DLB A;  4I0X B;  5J2B A;  7ICR A;  3ICX A;  7ICI A;  5DM6 V;  2HFE C;  1I94 B;  3KG2 A;  4XDL A;  2ZQM A;  4X89 A;  3L74 H;  4X66 O;  1F23 A;  2EZO A;  1UEV A;  4QZF A;  2K1E A;  2YUA A;  2ZXW B;  4FM1 A;  4LF4 O;  2OWO A;  1P7B A;  4JI3 B;  2B9Z A;  3SPG A;  9ICU A;  1R8B A;  3NKU A;  3OMA B;  4NXU A;  4WCW A;  4HYO A;  3AG1 C;  5HRK A;  1ORQ C;  2PTM A;  7ICP A;  1EBO A;  5BOM A;  2BPG A;  1ZQK A;  1RFY A;  2OCH A;  2P5O A;  4Z6E A;  2CGN A;  1N4C A;  3H1L H;  1KD1 W;  3OVA A;  1J5E O;  2DWE C;  1XSN A;  2HN1 A;  4F5N A;  4FHX A;  1GH6 A;  4IQT A;  4PGX A;  1RSO B;  1WA8 B;  1Q6I A;  2X6A A;  3UM7 A;  3P30 A;  1TFW A;  8ICY A;  1QHT A;  4I2I A;  3ZHS A;  5DED A;  2QE7 G;  3IJ4 A;  1JOY A;  5KUK A;  5H9C A;  1VIB A;  1MOF A;  2WLJ A;  5J9P C;  4WQK A;  4KLU A;  3O9O A;  4JI8 B;  4HX0 A;  3LSS A;  4WQL A;  2BCR A;  1GN3 A;  2ILM A;  7ICG A;  1XEQ A;  4MTO A;  2UUB O;  1TUE B;  1GTO A;  1UFI A;  2QWQ B;  1GM8 A;  4X5V A;  2Q7H A;  2NR5 A;  3JAR B;  3CPW U;  3J7A U;  5JH7 B;  3CCV V;  4O4H A;  1VQ4 V;  3K5O A;  4DW0 A;  1Y4M A;  4YJ3 B;  3SYA A;  4UBC A;  2B56 A;  3MAQ A;  3HKB B;  9ICI A;  2DQ0 A;  3H1J H;  4KFM A;  1BPZ A;  3H9V A;  2UUA B;  2B1I A;  3JSN A;  4XA5 A;  4K8X A;  4RUF A;  5D5Q A;  1N36 O;  5B1B B;  3W7S A;  4LF6 B;  4M9G A;  5KA5 A;  1N8R W;  1K5Q A;  3AK3 A;  4X1Y B;  1QVF U;  1JPX A;  2BTQ B;  3VQY A;  2VS0 A;  2HP8 A;  2ZH7 A;  4QPJ A;  1AR1 B;  2ZNI A;  1ZQW A;  7ICH A;  4LF8 O;  1IZ3 A;  1SES A;  3L73 H;  3H38 A;  4I55 A;  3W7X A;  3ZMU A;  3PJS K;  3RJE A;  4B7E A;  1FKA O;  2KKW A;  3RT3 C;  4FHW A;  4DV7 B;  5DDM A;  3J80 N;  4B3R B;  5DEC A;  4W4L A;  2ARH A;  2G38 A;  8ICF A;  2E74 B;  4I0X A;  5CBH A;  2RN9 A;  1JJ2 U;  4MW3 A;  4KLL A;  3QTC A;  3A8T A;  1TAE A;  1MSW D;  3C5G A;  5DB6 A;  1JFF B;  2EJR A;  4ZOL B;  3QO8 A;  4FLW A;  1XNQ B;  3K5N A;  2MK3 A;  3BA9 A;  2EIN C;  4LFA B;  1ZQI A;  1ZJN A;  3E8B A;  3G6B A;  5KHG A;  4QZD A;  2IM9 A;  1WNS A;  1ZQF A;  3CEI A;  3SYQ A;  4ATB B;  1SQQ H;  4MS2 A;  2XHB A;  5D4B A;  1Q5O A;  4NXM O;  4B3T O;  3OEH G;  4ABM A;  4I2B A;  4QJF B;  1MIW A;  2CTP A;  3OD4 A;  2W0X A;  2VQE O;  2ZH1 A;  1TA8 A;  2JGU A;  4XQ8 A;  1RSO A;  3BRC A;  1WA8 A;  4PHP A;  1KNY A;  5J2T B;  4OX9 B;  5K1X A;  2ZDI A;  4X62 B;  4H13 B;  5HFM A;  1YF2 A;  1YJ9 V;  4CBC A;  1I94 O;  4FJC C;  4ZI7 A;  4J7Z A;  5LYJ B;  4UB4 A;  5E79 Z;  1H8H G;  4HAM A;  1ZQG A;  3UO2 A;  5E1A C;  4MTF A;  4H37 A;  1FD9 A;  5GTH Z;  4M9N A;  4MF2 A;  2DRA A;  3RJJ A;  1NTM H;  3A0H Z;  3CCR V;  4UCS A;  3K79 A;  3ZRW A;  3OR6 C;  4JYY A;  5H6R A;  3K06 A;  4WFE A;  2W9M A;  1SQV H;  5IWA B;  2EZP A;  4LP8 A;  1HNX O;  4JZ2 A;  3F5T A;  5LXT B;  2UXD O;  3E35 A;  1WLE A;  4K3A A;  3CCE V;  3CRM A;  2YI8 A;  4DOC A;  1HW7 A;  5CBF A;  4O5C A;  1SRY A;  5JH7 A;  4RQ1 A;  4AT9 B;  4KLT A;  1R8A A;  3ZHU A;  4L87 A;  5JCO A;  4DR6 B;  2RNB A;  2Y4U A;  4XBF A;  1NKD A;  1W0J G;  1Q81 W;  3HKB A;  4BIO A;  4RQ2 A;  4I9W A;  4MW8 A;  1FXK A;  2A7W A;  2RCV A;  4YJ2 B;  4X4R A;  1ZWI C;  1F7Y A;  4K99 A;  3JAW A;  5IE9 A;  2FMP A;  4O5K A;  1PV0 A;  4P30 A;  3VOU A;  2ISP A;  3AG4 B;  2P22 C;  2F95 B;  4WFH A;  3CMA V;  3KCY A;  1B6Q A;  2WAM A;  2E76 B;  4JI8 O;  1VF5 B;  2FTK A;  3D36 C;  4WOY A;  5F2V O;  2P66 A;  2ZH8 A;  1AI6 A;  3T1Y B;  3CRC A;  2M7W A;  5IY5 C;  2HG5 C;  3RGB A;  3HPL C;  4XRH A;  2IUB A;  1YXB A;  2EJ7 A;  3RFR A;  2GDS A;  2N04 A;  2IJK A;  1OCO C;  2IHO A;  4FO1 A;  1ZQC A;  2MW2 B;  2CH7 B;  4X4T A;  4GXK A;  8ICE A;  3UXO A;  1RZT A;  2IU3 A;  4JI6 O;  1Y66 A;  5B3S C;  3GWO A;  3IC9 A;  2AXT Z;  2Q8V A;  1JFF A;  3JCU Z;  4NB5 A;  4J41 A;  8ICG A;  2FMQ A;  4RWO A;  4FIP C;  1UPG A;  5B3S B;  4LF6 O;  4TV9 A;  4EKW A;  4I4T A;  5B1A B;  3OUY A;  2QWR B;  5KUM A;  1P84 F;  4FO6 A;  1V9P A;  4ATB A;  1FJG B;  4O4L B;  2BBJ A;  2WA4 A;  3WB0 A;  1AVM A;  7ICU A;  1YCI A;  5D46 A;  2V7Q G;  5GTI Z;  3SPC A;  1DGS A;  1MA1 A;  3WFR E;  2Q9L A;  4B3R O;  1YSC A;  1K4D C;  5DN6 G;  4UVB A;  1GM9 A;  1JCH A;  4X1I A;  5J2U B;  4WC5 A;  4KLD A;  4LT6 A;  2YEV A;  5C93 A;  1QLE C;  3CXH F;  4JI0 B;  4DV4 O;  4FK5 C;  5J2T A;  2UXC B;  1S0V A;  1AB3 A;  2OYQ A;  3OEE G;  1NI8 A;  3LSU A;  4JGS A;  5EYP A;  1Y74 B;  5CA7 A;  4DUZ O;  1HNZ B;  4JI4 B;  1XNR B;  1SQP H;  4N21 A;  4PDV A;  3QO7 A;  2UXB O;  4DV6 O;  1R73 A;  4CS3 A;  1M57 B;  5EBL C;  4NXZ A;  5HRD A;  2PZS A;  4O68 A;  3RYC B;  3C3T A;  4I29 A;  3CSX A;  4K35 A;  2EIL C;  5IYD O;  1VQ5 V;  3RJF A;  5J2C A;  5LXT A;  1ARO P;  1OCC B;  3OFN G;  3TXS A;  3BPZ A;  3K03 A;  1ZSP A;  4RO2 A;  4JI2 B;  3K9A A;  4AT9 A;  1JAJ A;  2Y0P A;  3OUF A;  4CH3 A;  3K3W A;  4QZA A;  2IH3 C;  1ZQN A;  3AEI A;  3UQ0 A;  4IYI A;  1AI7 A;  3RVZ A;  5IIK A;  4X0A A;  3TGU H;  3P3N A;  3B0Y A;  4M5D A;  4JAU A;  4I2E A;  3ZCC A;  3PHZ A;  1N34 B;  2ETN A;  4EBJ A;  1NU1 H;  3LDD A;  3RJK A;  3BA8 A;  1XOU A;  8ICK A;  3CK6 A;  2Y69 B;  9ICV A;  3ZRS A;  5D63 A;  2LJ2 A;  4MT8 A;  2PFP A;  5J29 A;  2H94 A;  4LEW A;  1NH2 D;  3VBB A;  8ICM A;  3M8A A;  4DR3 B;  4RPZ A;  4FVM A;  2QA4 V;  4DV2 B;  2XAS A;  5KMG B;  1S5H C;  1VQP V;  2QSA A;  2RMK B;  4HNA B;  3IFX A;  3PMN A;  2ZH6 A;  4X1K B;  1F51 A;  1V54 C;  1J95 A;  1OU5 A;  5IWA O;  4OPA A;  1KUQ A;  4H44 B;  4FMT A;  1LUW A;  1R6N A;  2HKO A;  4O2B B;  2BSK B;  2E3C A;  2V4D A;  3STL C;  1SA0 B;  2CUG A;  3FAV B;  1V54 B;  1KP2 A;  3JAT B;  4GT1 A;  4DR6 O;  3CCU V;  4ZHQ B;  3WB1 A;  1ZQZ A;  2BE3 A;  3EFF K;  3K9S A;  4YCX A;  1VQM V;  1PNL A;  2FL4 A;  1BT8 A;  2P7T C;  1OCZ B;  2VWK A;  1R3I C;  2ZE5 A;  3MGI A;  4GKK B;  5CFS A;  2QR4 A;  1Q6U A;  3L75 H;  1JQ0 A;  3DXR B;  9ICB A;  4PA9 A;  3B8N A;  2IW5 A;  1TGO A;  1IBK B;  2CTR A;  4LF9 B;  1YJW V;  2Q7G A;  1H2N A;  1E1Q G;  4WC1 A;  4DYL A;  4J9Z B;  4D7T A;  4JAS A;  3JPS A;  1X59 A;  2JVD A;  2B5U A;  2X7R B;  1KB9 F;  4EEQ A;  4EGW A;  4P2H A;  9ICC A;  3BFR A;  9ICW A;  4O4L A;  2PF4 E;  5J0Q A;  3K5L A;  4QZI A;  3T1Y O;  4MFF A;  2DYR C;  1IX9 A;  2O57 A;  3CB2 A;  3AU6 A;  4UCV A;  3M99 B;  3K08 A;  4XQ7 A;  3ZIA G;  1I5Y A;  3S3X A;  2ZHA A;  3H1K H;  5J2I A;  4E4E A;  4UD4 A;  3D3I A;  1AP5 A;  3AU2 A;  4FM2 A;  5J2U A;  4LF5 B;  2DYR B;  4PJ0 Z;  4FLZ A;  1FAF A;  2XT9 A;  3QVN A;  3JYY A;  7ICN A;  4JYA O;  5L3C A;  1GAX A;  1SQF A;  2ZE8 A;  3X2Q C;  2XAF A;  3ABK B;  1N36 B;  4CC5 A;  1R89 A;  4AIL C;  4MKP A;  4KLM A;  4FLU A;  1Y74 A;  3SPI A;  1KYO F;  2EBO A;  1YEW A;  5BZB A;  3X2Q B;  3PML A;  2GUZ A;  2KSD A;  3B09 A;  2XOK G;  1NS1 A;  3T2M A;  3NR7 A;  3OV7 A;  1ZQM A;  1WAZ A;  4H0L B;  4GXI A;  1JQR A;  4X4O A;  1VF6 C;  3HX0 A;  1MZE A;  4IG8 A;  3K75 D;  4TUR A;  3HJ1 A;  3RW0 A;  1PM9 A;  2EIM B;  4AI8 A;  4KLI A;  1NBM G;  4KP4 A;  3F7Y C;  2QKC A;  4B08 A;  8ICX A;  3O65 A;  5IIO A;  3FD9 A;  4J80 A;  4Z6C A;  4G28 B;  1ZQJ A;  4K97 A;  2V1D A;  3ABL C;  5J2G A;  4R65 A;  3A0B Z;  1PKX A;  4JI0 O;  5J0T A;  2LGW A;  2UXC O;  2EWR A;  1F5A A;  1YVW A;  5B1N A;  1M1K W;  3ABL B;  4LNU A;  3HW8 A;  4JI4 O;  4I27 A;  1XNR O;  8ICI A;  4M9H A;  1H38 A;  4UB1 A;  5DB7 A;  2FML A;  4P4O A;  2Z3Y A;  2UU9 B;  5KHK A;  5LA6 B;  2YID A;  3G80 A;  3ASO C;  4O2B A;  2BSK A;  1K8A W;  3OMI B;  1ZTE A;  2GTA A;  4JI2 O;  4FZ1 A;  8ICS A;  3RWR D;  5LGN A;  1FYJ A;  5CA0 B;  4ZHQ A;  9ICF A;  1IXM A;  4I50 B;  4PA4 A;  4QGP A;  1MIY A;  4ASU G;  4O4J A;  4AT8 B;  3GWK C;  3RBZ A;  2A06 H;  3DXR A;  4WC6 A;  1N34 O;  3L72 H;  3FB8 C;  3MDS A;  9ICL A;  4UB8 Z;  4WBZ A;  9ICK A;  4JI7 B;  5GON B;  5D61 A;  1BCC H;  2JDI G;  3GDX A;  1ZQT A;  2ADP A;  5B3P A;  1FXV A;  4TUY B;  1HNX B;  4PA3 A;  2UXD B;  4D7S A;  4NM1 A;  4NTW A;  4DR3 O;  4I2A A;  4KM5 A;  1SZX A;  4DV2 O;  1R8C A;  5DKW A;  3J81 N;  1TVA A;  2RQ6 A;  3TFR A;  5BMV B;  3CCL V;  3HIY A;  1BQZ A;  4U7N A;  3LNN A;  3AG1 B;  3C66 A;  4YHH B;  5HRE A;  2PFN A;  5J0O A;  1IXB A;  1KEC A;  1PPJ H;  4M9L A;  4WFA V;  3C18 A;  1ZLZ A;  1ZQB A;  1FFX A;  5FLX N;  4PHA A;  1NH2 B;  2BOC C;  4O9M A;  2QM7 A;  4QZC A;  2PGG A;  1K4C C;  4S3N A;  2GHY A;  4GKK O;  1FS0 G;  1SZT A;  1IUR A;  4RQ8 A;  1PNM A;  4J10 A;  4Q20 A;  1IBK O;  4LF9 O;  5L3F A;  3N27 A;  4RPY A;  3TXQ A;  8ICW A;  3E2E A;  2DYS C;  3K0G A;  2AZ0 A;  4I9Q A;  3G71 V;  2HN2 A;  2K9P A;  4JTA B;  1TFY A;  1PNK A;  3UCS C;  4FFK A;  5FPR A;  3AQL A;  4X4N A;  2DYS B;  1Y67 A;  4IHJ B;  1MQ2 A;  2YIB D;  2ITD C;  3V7K A;  5CFT A;  4JI6 B;  7ICS A;  2BCS A;  4RAI A;  1BPE A;  2JK5 C;  4LF5 O;  1YLQ A;  3JD3 A;  3RYH B;  2LGQ A;  1TVK B;  1KKD A;  3RJG A;  2Q69 A;  9ICA A;  2DVI A;  2M2U A;  4FHY A;  3H3A A;  2KQX A;  1Q8I A;  1EZV H;  1KKC A;  4RQ3 A;  5EIB C;  3B8M A;  2ZD9 A;  1Z2G A;  3D8C A;  4WBN B;  3CXC U;  3B77 A;  4F5P A;  1NJI W;  2VQF O;  3MDA A;  3CC4 V;  1HR0 O;  4TUS A;  2BOB C;  3ZMS A;  4X20 B;  4BAY A;  2YC0 A;  5KX5 B;  3W7U A;  1U96 A;  2QDO A;  4E8F A;  2BCC H;  3B0X A;  8ICU A;  4KUM A;  1I08 A;  4WC4 A;  3ABM C;  4WFB V;  3HR0 A;  4DV4 B;  2HVK C;  2XAJ A;  3JYC A;  1VQ9 V;  3C2L A;  3F5W C;  1GM7 A;  8ICQ A;  1CEZ A;  3CHX A;  2ISO A;  3P32 A;  4DV0 B;  4E7X A;  4KHP B;  1PP9 H;  4DUZ B;  2CGO A;  4CH6 A;  4LVS A;  1CXZ B;  3ETD A;  4AT8 A;  1HWY A;  4WC0 A;  4G27 B;  4LH7 A;  2UXB B;  4DV6 B;  5EBW C;  2QM8 A;  4CH4 A;  5GON A;  3C90 A;  1KP3 A;  2N05 A;  2PI5 A;  1MNG A;  2B1G A;  1B3Q A;  3FYE B;  4N7R A;  3OT7 A;  1BZK A;  1HUO A;  3OR7 C;  4TUY A;  1NO5 A;  2EIN B;  3UQ2 A;  1W59 A;  4LF7 B;  5HRG A;  3E89 A;  2UU9 O;  4P9O A;  2CTW A;  2PI4 A;  2XAG A;  4DV5 O;  4P4P A;  2Q5Z A;  4NXT A;  3MCR A;  1DF4 A;  1Q7Y W;  1WP7 A;  5JVD B;  4RQ7 A;  2FMS A;  1H2K A;  1M4U A;  2WWW A;  3UKM A;  4EV6 A;  4NLN A;  4GX2 A;  4I2D A;  1WN7 A;  3E8F A;  1PD3 A;  3ZX6 A;  4UFZ A;  4P4M A;  4J11 A;  8ICB A;  2M2T A;  1D5A A;  2ZR2 A;  3NYB A;  1KQS U;  3T1H O;  1YDX A;  3HKD B;  4OXS A;  1ZQO A;  1QNM A;  3Q4H B;  3FB7 C;  1SKV A;  5EK0 A;  4F4L A;  1P7G A;  3BVO A;  4ZBM A;  4JI7 O;  3JZ0 A;  3C5F A;  1XUQ A;  3UPQ A;  1BL8 A;  3ZN1 A;  1WPB A;  1RM1 C;  2BTO A;  4O69 A;  1BPX A;  2D3O W;  1ZX3 A;  4FFB B;  3JAR A;  3TET A;  4W4K A;  1ZQA A;  4JF3 A;  1VQ7 V;  4QZE A;  2JS5 A;  3T4D A;  1WB8 A;  4TQF A;  4CS4 A;  4YJ3 A;  3QNE A;  1ZJM A;  3AUO A;  5GW7 A;  4IQU A;  3WG7 C;  3WFV A;  1HNW O;  4YHH O;  3RYF B;  4LC1 A;  3DC5 A;  3RYH A;  1XBL A;  2UXX A;  3QO5 A;  2PBE A;  3TFS A;  1TVK A;  4FHP A;  2UXN A;  5EBM C;  2VAN A;  5TIS Z;  3MHS C;  5B3Q A;  4PGY A;  4M2Y A;  4X1Y A;  4UCT A;  2YIC A;  2BTQ A;  4QZB A;  4MFC A;  1JJO A;  5KHH A;  5JJJ B;  3DGE A;  2DQ3 A;  1N32 B;  1OCR C;  4NYK A;  3ZN0 A;  4FLT A;  5LL6 Y;  4NR1 A;  4BIZ A;  1GPJ A;  1WP8 A;  4YY3 B;  4KLE A;  2GWS A;  2OIE A;  4P9P A;  1F4N A;  3D3Q A;  4X20 A;  3N2K B;  1OCR B;  1AIL A;  3K58 A;  4QNH B;  4MVQ A;  4P2Z A;  1UJW B;  1P49 A;  4NXV A;  2R72 A;  3ASN C;  4MSW C;  5IY5 B;  4MFA A;  4JYA B;  8ICV A;  3HKE B;  1QR8 A;  4LCU C;  4KLH A;  4R50 A;  4X0B A;  4JTD B;  1RPO A;  4YMN A;  4CZZ A;  3L9D A;  2RJZ A;  1H8E G;  1GO3 F;  4WF9 V;  3KKY A;  1BS3 A;  1V55 C;  1OCO B;  4X88 A;  4J42 A;  4NVP A;  5LP6 C;  4ZOL A;  5LOV B;  1W2B U;  2PFQ A;  2PFO A;  5EOZ A;  3ZRX A;  4AHC A;  4YMO A;  5DB9 A;  7ICO A;  3CJH B;  3FX7 A;  1UET A;  1N0J A;  1W0K G;  4ICG A;  5J2K A;  4ZIB A;  7ICF A;  1NTK H;  4DK1 A;  2KG7 B;  5CR0 A;  4FHV A;  2R9I A;  3ER9 B;  4K96 A;  1XRE A;  1L1F A;  1Y76 B;  3JPP A;  3LSQ A;  5B1O A;  3HKC B;  5KHJ A;  5HHH A;  3FKS G;  1IBL B;  4Z6D A;  1WB7 A;  2GTS A;  1K73 W;  3SJB C;  4KLG A;  1V4A A;  1GN6 A;  1XL6 A;  2OCC C;  2CDY A;  5H2F Z;  3VQV A;  1VQ6 V;  1WJZ A;  2ZR3 A;  4I7Z B;  3WB2 A;  1RPR A;  4AQY B;  5JVD A;  3OWG A;  2LFS A;  3JPQ A;  5J2F A;  2A9H A;  2LQT A;  2AW9 A;  2OCC B;  5CMU A;  2ZIO A;  5IYB O;  1VQO V;  4R66 A;  4C7U A;  2R70 A;  4TUQ A;  3FB6 C;  2PYL A;  9ICQ A;  1YIT V;  4DV0 O;  4KHP O;  1QLE B;  5LYJ A;  2XUM A;  4DR5 B;  3CRR A;  1YIJ V;  3HKD A;  3ZS8 C;  3H1I H;  3SYP A;  1BMF G;  5HRL A;  3CME V;  4PDM A;  3MDC A;  2EX3 A;  3G4S V;  2HHP A;  4KL1 A;  1JMS A;  3SYO A;  2A0L A;  3JAM N;  4B3S B;  2Y4T A;  8ICT A;  1XDC A;  4GYC B;  3OM3 B;  4FFB A;  4LF7 O;  1VQN V;  5CP2 A;  2EIL B;  1ROP A;  5LMN B;  2H3O A;  4JV5 O;  5J0R A;  3RYF A;  4LWS B;  2A79 B;  4YJ2 A;  1NR1 A;  1JN3 A;  4R7C A;  3GB7 C;  3JD1 A;  3WFO A;  3EXA A;  2BBH A;  4NTY A;  5H6Q A;  4F6E A;  4LEY A;  4PDL A;  1MIV A;  1OHH G;  2LP7 A;  1R1B A;  5CBG A;  1S3J A;  3CCQ V;  4GKJ O;  4KLS A;  5JJN B;  3CS5 A;  5LMU B;  2NN4 A;  3MGH A;  4Z1V A;  1NVP D;  5IDJ A;  2Q67 A;  3K04 A;  1XSL A;  5IIL A;  8ICO A;  5CHE A;  3CP1 A;  3P3P A;  3N2K A;  3H01 A;  3D36 A;  4GCZ A;  4O5E A;  4K8Z A;  5HRI A;  4MVU A;  1YHQ V;  4UAZ A;  7ICE A;  2JGD B;  3JCF A;  4RWP A;  1AJP A;  1IDS A;  3WU2 Z;  2CH7 A;  5A9G A;  2BCU A;  2A3Q A;  3OGU A;  3HKE A;  4HBN A;  1SS3 A;  3JSL A;  3LUT B;  3RH6 A;  1XMO B;  1S76 D;  1GRJ A;  2N74 A;  3PNC A;  4UV9 A;  3MHH C;  2DR9 A;  5KLV H;  5LOV A;  3E83 A;  4YD1 A;  2JEU A;  1VQL V;  3AG7 A;  1AI5 A;  7ICM A;  8ICL A;  4RQE A;  2ZH9 A;  4IIJ B;  2P06 A;  2ODM A;  4KXR A;  1Z5W A;  2KG7 A;  1S5J A;  3UO3 A;  1Y76 A;  2DJV A;  4WC7 A;  3HKC A;  5J2H A;  1N32 O;  4MVS A;  2P90 A;  8ICN A;  3KZI Z;  2W0F C;  3OGC C;  3EF2 A;  3UXP A;  4IQW A;  4KLF A;  4YY3 O;  3WFS C;  2PXI A;  4DR2 B;  2QWP B;  4DR4 B;  1QVG U;  4I2G A;  4DO9 A;  4L8J A;  4DK0 A;  1BHB A;  2GV9 A;  2YXY A;  4J7K A;  1XHX A;  5EIB D;  1URF A;  1COW G;  4FZ0 A;  3T4Z A;  1LNQ A;  1A32 A;  5CA1 B;  4UBB A;  4X4U A;  2JS3 A;  9ICO A;  1K97 A;  3AG3 C;  3GVM A;  2VQF B;  4NM2 A;  1AR5 A;  3FFQ A;  2EIJ C;  4YXW G;  1HR0 B;  1QLN A;  2F66 C;  2FB5 A;  3JPN A;  9ICR A;  5JWP A;  3RYC A;  4IQV A;  1GKF A;  3AG3 B;  1CP9 A;  5BR8 B;  4FLY A;  4NXN O;  4UD5 A;  1IBL O;  2AHY A;  1H2S B;  1K9M W;  1TUB B;  1H2G A;  2E75 B;  2QGN A;  5TZV A;  2OTL V;  3IAY A;  5CB4 B;  5HC9 A;  1NT2 B;  2PY5 A;  4M0A A;  1BHA A;  2NNU A;  4AQY O;  3FB5 C;  2WA3 A;  2Q7E A;  4PDR A;  5DB8 A;  4JAV A;  5FL7 G;  4LWS A;  4X4P A;  1M56 C;  3VQX A;  4PH5 A;  3E22 B;  7ICK A;  3AQN A;  4TSF G;  4QPK A;  1S72 V;  3SPJ A;  2PUS A;  4WFF A;  2CE4 A;  5JQG B;  3M7M X;  3ERC C;  3V7L A;  2DWD C;  3ZMV A;  4DR5 O;  1ZQE A;  3VQW A;  3ISD A;  4JWM A;  4B3M B;  3BEH A;  2HLD G;  3OVB A;  3RH5 A;  5KMG A;  5J0Y A;  4GZR B;  2Q0O C;  3LNM B;  4HNA A;  4DV5 B;  1VQ8 V;  4TUP A;  4X1K A;  4X4V A;  1WOT A;  4B3S O;  3SR2 C;  4YIO A;  1L8D A;  5HRH A;  3E86 A;  2JGD A;  2DR5 A;  1AJN A;  1SA0 A;  3TJT A;  3FAV A;  5J2A A;  3JAT A;  3C2M A;  5LMN O;  4I55 B;  4KLJ A;  2X6C A;  1NR7 A;  1RPL A;  4DOA A;  3ASO B;  5J0W A;  2HJD A;  2ATK C;  3ZBH A;  2L35 A;  3T1H B;  9ICG A;  3UXN A;  4YN4 A;  3JAK B;  4R6Z A;  2YSU B;  4CH5 A;  2NRK A;  2WLL B;  2DE0 X;  8ICH A;  1THZ A;  1ZQX A;  2HHH O;  2H8P C;  1K34 A;  4UVC A;  4IIJ A;  3MBY A;  1AJQ A;  1K5S A;  4OAF A;  5LMU O;  2ZH3 A;  1GMG A;  3EHB B;  3UT5 B;  5DBC A;  9ICT A;  1M93 A;  2ZXW C;  5CN0 A;  4BIU A;  4OAG A;  3V7J A;  5LHG A;  1OJH A;  5LGT A;  4PEL A;  4LBE C;  1FXH A;  3C3S A;  4F5Q A;  1FFT B;  3RJH A;  1MMM A;  1HNW B;  3R65 A;  4Z1M G;  3W7T A;  9ICH A;  3RYI B;  3SJQ C;  5JJE B;  1HDJ A;  4GX0 A;  3ZMZ A;  1NVP B;  2P67 A;  5IJ0 B;  1XMO O;  1KBH A;  3S3W A;  2GBO A;  3CCJ V;  5CA1 A;  1X4T A;  4NLK A;  2F1M A;  1Q86 W;  1VJ7 A;  9ICX A;  2ZDI C;  2F93 B;  1I5X A;  2QKS A;  2IU0 A;  3JPT A;  4BWA A;  4NTX A;  3STZ C;  4O4I B;  4PGQ A;  5J2J A;  4DV1 B;  4RT2 A;  1H2L A;  3A0R A;  3RN4 A;  1WPX A;  2ZT9 B;  5CB1 A;  3CCM V;  4ZI7 B;  3ZED A;  1JMK C;  3APO A;  1MG1 A;  2D2C B;  5ITZ B;  1BE3 H;  9ICJ A;  1TUB A;  5BXZ A;  4MTG A;  1VF6 A;  5HRF A;  4DR2 O;  4DR4 O;  2F43 G;  5CB4 A;  3ZRW B;  3AQK A;  3U11 A;  4RUE A;  1FPO A;  5IIJ A;  7ICQ A;  4I0U A;  5JCO C;  3A2F A;  2M6Y A;  5EC1 C;  1QCE A;  5IIN A;  4X65 B;  1UEU A;  4TV8 B;  3OTO B;  2Q66 A;  3CC2 V;  4K9A A;  5IT9 N;  1I7F A;  4A5U B;  1K33 A;  3E22 A;  4K4G A;  2DN9 A;  1FXK C;  4PI2 A;  4LR3 A;  2R9R B;  1BPD A;  5JQG A;  4DV3 B;  4U3F H;  4X9Q A;  4DOB A;  8ICJ A;  3OMN B;  2PYJ A;  2E5L B;  5B1B C;  5JTG A;  4RQ0 A;  1FXK B;  1DTO A;  2DR8 A;  1VEW A;  1MQ3 A;  3JAW B;  4G2K A;  5HFL A;  1XL4 A;  2ZIN A;  3CWB H;  1JVM A;  4OAI Z;  2CAZ C;  3JAL B;  1YJN V;  2F4V B;  2IJI A;  5BR8 O;  4NXX A;  4YMM A;  5LA6 A;  3BHP A;  4MTX A;  3SYC A;  2F23 A;  3U0Z A;  4U3J B;  4RWU A;  3C2K A;  3AK2 A;  1GK9 A;  2WLN A;  5KHI A;  4I28 A;  1ZQD A;  5CA0 A;  1VF7 A;  1N0N A;  3F7V C;  2FCL A;  2Q68 A;  4LZG A;  5FPO A;  4I50 A;  1ZAU A;  1NQT A;  1OZ0 A;  1XHZ A;  3ABM B;  4JAA A;  3TK1 A;  1NTZ H;  2Y48 A;  3I5D A;  3UQ8 A;  9ICM A;  4EB6 B;  4RQ6 A;  3JAK A;  3H39 A;  4PV1 B;  3AG2 C;  3JCZ A;  7ICT A;  3N2G B;  4LFC B;  2GA9 D;  8ICC A;  4RWN A;  2WLL A;  3CC7 V;  4K8V A;  4JZG A;  3U10 A;  3ETG A;  4X64 B;  3K59 A;  3AG2 B;  4JLZ A;  4DUY O;  2ZHB A;  4B3M O;  2QWO B;  3UT5 A;  5KAI Z;  1N33 B;  1ZQU A;  2XAQ A;  4N23 A;  5C8Y B;  2B4V A;  1ZQR A;  4QZ9 A;  4WC2 A;  4FPP A;  1ENV A;  3LDC A;  1Q78 A;  1QBZ A;  1R3J C;  1G1X B;  1ZQQ A;  1M5I A;  5BMV A;  4O2A B;  4TV9 B;  3I56 V;  4JV5 B;  1YI2 V;  1FA0 A;  4UB2 A;  4I4T B;  2UUC O;  1KMI Z;  1U97 A;  4QE7 A;  1CPY A;  3OUY B;  8ICZ A;  5BOL A;  1ZL8 B;  1HUZ A;  5K1P A;  3RYI A;  1IBM O;  5HR9 A;  4KLQ A;  1K92 A;  1Q3E A;  2QWN B;  4GLX A;  2ZH2 A;  2ITC C;  2ZH4 A;  3ZRV A;  8ICA A;  5IJ0 A;  3WFQ E;  1ZQH A;  5L3D A;  1S5L Z;  3JD0 A;  1MSD A;  4JI1 B;  4GKJ B;  4YD2 A;  2Q0A A;  4QZG A;  2BCQ A;  3APQ A;  5D5P A;  2FYU H;  1KDH A;  3KCX A;  1Y6X A;  3ZHT A;  2IHM A;  4X1I B;  3SGI A;  3R66 A;  1XMQ B;  2YEV B;  4J7J A;  4RT3 A;  2QEX V;  4O4I A;  4RQ4 A;  3SJC C;  4DR7 B;  1O9H A;  4LH6 A;  5H5N A;  1BQ0 A;  4QZH A;  5EYP B;  3NVO A;  4PA7 A;  2QJ1 A;  5D62 A;  5IYZ B;  1D2D A;  2YS8 A;  2AHZ A;  4KB6 A;  5AG2 A;  5ITZ A;  4IHJ A;  4JYB A;  1RM1 B;  5CFU A;  3ISC A;  5EZY B;  2DR7 A;  4FH5 A;  1O9G A;  3ML0 A;  1XQ8 A;  4XDK A;  4I2J A;  4DR1 B;  2XTA A;  3ABT A;  2ADQ B;  3RVY A;  1JR9 A;  4JI3 O;  1SF9 A;  3OGI B;  2WPD G;  2Z0A A;  4X4Q A;  4QE9 A;  4TV8 A;  1H2M A;  1GN4 A;  3WG7 B;  2QM4 A;  1ZQL A;  4X4S A;  1BPY A;  2OTJ V;  4LFB B;  1QR9 A;  1E1R G;  1SQB H;  1RP3 B;  4Z2W A;  1R6T A;  3B2E E;  4WBN A;  1R3K C;  5DDY A;  4JI5 B;  2DW4 A;  2ZE6 A;  2Z5U A;  3AG4 C;  2ZE7 A;  5KA6 A;  4DV1 O;  5FNV B;  2O5A A;  1EN4 A;  3QF7 A;  5KX5 A;  2JIZ G;  3JAL A;  3OW2 U;  2BPF A;  4FLV A;  2Y0I A;  5BY1 A;  3IC7 A;  3AK1 A;  2GAF D;  4NKU A;  4U3J A;  1M9N A;  1SQG A;  2FKX A;  5EC2 C;  1YTF D;  4GX1 A;  3I55 V;  1AI4 A;  2ZIM A;  2YI9 A;  1DK1 A;  4QIW F;  1AP6 A;  3E8G A;  4AT7 B;  3FYI B;  4NKG B;  5L3B A;  8ICR A;  2B51 A;  4MVO A;  1L0L H;  3ASN B;  1P4R A;  2IBZ H;  4UV8 A;  4R8C A;  3L70 H;  5J2E A;  2QTS A;  1I0H A;  4K9B A;  2WLK A;  4EB6 A;  4X65 O;  3OTO O;  4WC3 A;  4J9Y B;  4R63 A;  3EVK A;  3N2G A;  1V55 B;  2JRI A;  2XAH A;  4NY8 A;  9ICS A;  1M90 W;  4PI0 A;  5LP6 B;  4DV3 O;  1YZB A;  3B40 A;  1Q43 A;  4MVZ A;  3G6E V;  2E5L O;  4NXN B;  1E79 G;  2DMX A;  3RH4 A;  1TV9 A;  2YXH A;  2WLH A;  5B1A C;  5C8Y A;  4K0K B;  4UB3 A;  2UUA O;  2IH1 C;  3JD2 A;  1EZJ A;  1SER A;  1XIL A;  3ETE A;  4E2L A;  2C2A A;  3HWT A;  3ISB A;  1MZF A;  4O2A A;  2VWJ A;  2F4V O;  4DRX B;  3OAA G;  2HVJ C;  1ZL8 A;  4EP7 A;  3HJ4 A;  4LZD A;  4F5R A;  4JYC A;  4PHE A;  1G4Y B;  2WLM A;  2ZNJ A;  2DRB A;  4FH3 A;  5A2Q N;  4PHZ A;  4WCE V;  3SDL A;  5CWR A;  4FM0 A;  4TWK A;  4JPR A;  5J0U A;  4Q6G A;  4DV7 O;  3JD4 A;  5DBB A;  4UB5 A;  4IL6 Z;  1SET A;  3BCC H;  4LFC O;  3Q4H A;  1Q6H A;  1KC8 W;  1PX5 A;  1NOM A;  4XJE A;  4X64 O;  3ZHR A;  3HB3 B;  5J0S A;  4EBK A;  2OT5 A;  1KEJ A;  4RQF A;  1M57 C;  3IGA C;  4WFG A;  4EFB A;  1N33 O;  2YDE A;  2L6L A;  3CRQ A;  5IYZ A;  2ZH5 A;  3L71 H;  3T1C A;  2KB1 A;  2GUZ B;  4UXN A;  3SPH A;  4OGQ B;  4UCR A;  4PHD A;  3H1H H;  4I5S A;  3ZMT A;  5EZY A;  4Z6F A;  1K7D A;  1XNQ O;  4O67 A;  1OCC C;  3G67 A;  1MAB G;  3K0D A;  4LFA O;  5LHI A;  2QTO A;  1ZQY A;  4RQ5 A;  5IJ9 B;  3JAS B;  4YIP A;  5J0P A;  4M04 A;  1JX9 A;  1Q90 D;  1EN6 A;  2LO1 A;  2ZM6 B;  2JJ1 G;  4JTC B;  3ABU A;  1Q82 W;  2HHH B;  4NXW A;  4OAH A;  3BY6 A;  1SC5 B;  4RPX A;  4JI1 O;  4TQD A;  4PPX A;  1ZQS A;  8ICP A;  4F6R B;  2WLI B;  1B06 A;  1XMQ O;  5KAF Z;  4X66 B;  4I2H A;  4EED A;  2Y69 C;  4NLZ A;  5FNV A;  5L3G A;  2Q73 A;  3DC6 A;  4OX9 O;  4DR7 O;  2EUL A;  1EN5 A;  2IJH A;  4HZ3 A;  4X62 O;  5LBQ A;  2JJ2 G;  4LF4 B;  2P6J A;  4LNU B;  3MD0 A;  4ZKI A;  3OTF A;  4UCO A;  7ICL A;  2VRZ A;  2I9G A;  3LK9 A;  4TT3 G;  5CJ7 A;  4CC6 A;  4GUN A;  4X8A A;  1G8M A;  4F5O A;  5B5E Z;  1SQX H;  4TOI A;  1XI1 A;  5BPC A;  4DR1 O;  3PN1 A;  4AT7 A;  4GXJ A;  2M2W A;  3QG5 A;  3K5M A;  3AQM A;  1J5E B;  9ICN A;  1VAR A;  3ZHV A;  1S77 D;  1OCZ C;  1US6 A;  3CJH A; 
#chains in the Genus database with same CATH homology
 4LVS A;  8ICH A;  4AT8 A;  4WC0 A;  1ZQX A;  3WFP A;  4WBY A;  2BPC A;  1ZQP A;  5HRB A;  8ICG A;  4I2F A;  3MBY A;  2FMQ A;  2ZH3 A;  4RWO A;  5DBC A;  9ICT A;  5DBA A;  9ICP A;  3UPS A;  5III A;  3V7J A;  1HUO A;  3OUY A;  5CHG A;  1NO5 A;  3UQ2 A;  4FO6 A;  4ATB A;  4UAW A;  4F5Q A;  5HRG A;  3RJH A;  3LQC B;  5D49 A;  7ICU A;  4P4P A;  5D46 A;  9ICH A;  5J0X A;  4JWN A;  4RQ7 A;  2FMS A;  3WFR E;  4NLN A;  4I2D A;  4WC5 A;  4KLD A;  4LT6 A;  3OVS A;  4NLK A;  4P4M A;  4XUS A;  8ICB A;  1VJ7 A;  9ICX A;  2M2T A;  4RWQ A;  7ICJ A;  7ICV A;  3NYB A;  3JPT A;  5IIM A;  1BPB A;  4PGQ A;  1Q79 A;  5CA7 A;  5J2J A;  4RT2 A;  1ZQO A;  4M47 A;  4K4H A;  5CB1 A;  3C5F A;  3JZ0 A;  4NKT A;  3UPQ A;  4NXZ A;  4UAY A;  5HRD A;  1BPX A;  9ICJ A;  4I29 A;  3RJF A;  5HRF A;  1ZQA A;  4QZE A;  4R64 A;  5HHI A;  5J2C A;  3AQK A;  2RFF A;  1ZJM A;  5IIJ A;  3AUO A;  1XSP A;  5J2D A;  7ICQ A;  4AT9 A;  4IQU A;  1JAJ A;  5IIN A;  2BCV A;  1UEU A;  3JPO A;  2Q66 A;  4QZ8 A;  4QZA A;  4MF8 A;  1ZQN A;  4K4G A;  2PBE A;  3UQ0 A;  3TFS A;  1BPD A;  4FHP A;  5IIK A;  4X0A A;  3JPR A;  2VAN A;  3B0Y A;  4M5D A;  4PGY A;  4I2E A;  4EBJ A;  4DOB A;  4M2Y A;  8ICJ A;  3V72 A;  4QZB A;  3RJK A;  4MFC A;  4RQ0 A;  2DR8 A;  8ICK A;  2ID1 A;  9ICV A;  2PFP A;  1MQ3 A;  4K4I A;  5J29 A;  4KLO A;  8ICM A;  4E80 A;  1VFG A;  4KLE A;  4RPZ A;  4YMM A;  2GWS A;  2M2V A;  4I2C A;  3C2K A;  3PMN A;  2ZH6 A;  1OU5 A;  4M9J A;  3H37 A;  4I28 A;  1ZQD A;  4MFA A;  2O1P A;  1ZQV A;  8ICV A;  4LZG A;  4KLH A;  4X0B A;  4YMN A;  9ICE A;  3L9D A;  9ICM A;  4RQ6 A;  3RJI A;  1ZQZ A;  3H39 A;  2BE3 A;  4YCX A;  5J2B A;  7ICT A;  7ICR A;  8ICC A;  4RWN A;  7ICI A;  2PFQ A;  3MGI A;  2PFO A;  5EOZ A;  4YMO A;  5DB9 A;  7ICO A;  9ICB A;  1UET A;  1UEV A;  2ZHB A;  5J2K A;  1ZQU A;  4WC1 A;  7ICF A;  5CR0 A;  4FHV A;  3JPP A;  4QZF A;  1ZQR A;  4QZ9 A;  4WC2 A;  3JPS A;  5HHH A;  4Z6D A;  1Q78 A;  1ZQQ A;  4P2H A;  4KLG A;  1FA0 A;  4UB2 A;  9ICC A;  9ICW A;  1V4A A;  9ICU A;  8ICZ A;  3OUY B;  5J0Q A;  1R8B A;  5BOL A;  4QZI A;  1HUZ A;  4MFF A;  4WCW A;  3AU6 A;  5HRK A;  7ICP A;  5HR9 A;  4KLQ A;  4XQ7 A;  5BOM A;  2BPG A;  1ZQK A;  2ZHA A;  5J2I A;  3JPQ A;  5J2F A;  2ZH2 A;  4Z6E A;  4UD4 A;  2ZH4 A;  4R66 A;  3AU2 A;  8ICA A;  3OVA A;  3WFQ E;  1ZQH A;  4TUQ A;  1XSN A;  4F5N A;  4YD2 A;  4FHX A;  3JYY A;  7ICN A;  4IQT A;  9ICQ A;  4PGX A;  4QZG A;  2BCQ A;  1KDH A;  2IHM A;  1TFW A;  8ICY A;  1R89 A;  4I2I A;  4RT3 A;  5DED A;  4KLM A;  5HRL A;  4RQ4 A;  3MDC A;  4QZH A;  3PML A;  2HHP A;  1JMS A;  4KLU A;  3OV7 A;  1ZQM A;  8ICT A;  4GXI A;  1JQR A;  4X4O A;  3HX0 A;  3ISC A;  2BCR A;  4IG8 A;  3K75 D;  7ICG A;  4TUR A;  2DR7 A;  4FH5 A;  3HJ1 A;  4I2J A;  5CP2 A;  4KLI A;  4X5V A;  8ICX A;  5IIO A;  4X4Q A;  5J0R A;  4Z6C A;  1ZQJ A;  4UBC A;  1JN3 A;  3WFO A;  1ZQL A;  4X4S A;  5J2G A;  1BPY A;  4R65 A;  9ICI A;  1BPZ A;  5J0T A;  1MIV A;  5DDY A;  4KLS A;  1F5A A;  4XA5 A;  3MGH A;  3HW8 A;  4I27 A;  4M9G A;  2O5A A;  8ICI A;  1XSL A;  4M9H A;  5IIL A;  8ICO A;  2ZH7 A;  1ZQW A;  4UB1 A;  5DB7 A;  2BPF A;  7ICH A;  4P4O A;  4NKU A;  4O5E A;  3H38 A;  5HRI A;  4UAZ A;  3RJE A;  7ICE A;  4RWP A;  4FHW A;  2BCU A;  5DDM A;  4AT7 B;  3OGU A;  8ICR A;  5DEC A;  3RH6 A;  8ICS A;  5J2E A;  3PNC A;  9ICF A;  8ICF A;  4WC3 A;  4R63 A;  2DR9 A;  4NY8 A;  9ICS A;  4KLL A;  1MIY A;  4YD1 A;  4AT8 B;  4WC6 A;  3C5G A;  7ICM A;  8ICL A;  5DB6 A;  9ICL A;  4WBZ A;  9ICK A;  2ZH9 A;  3RH4 A;  1TV9 A;  4UB3 A;  4WC7 A;  5J2H A;  3GDX A;  1ZQT A;  8ICN A;  1ZQI A;  1ZJN A;  4QZD A;  3HWT A;  4IQW A;  3UXP A;  3ISB A;  4NM1 A;  1ZQF A;  4I2A A;  4KLF A;  3WFS C;  4ATB B;  2PXI A;  1R8C A;  5DKW A;  4I2G A;  4DO9 A;  5D4B A;  4EP7 A;  1TVA A;  3HJ4 A;  4LZD A;  4F5R A;  3TFR A;  4I2B A;  4PHE A;  3HIY A;  1MIW A;  3C66 A;  5HRE A;  2PFN A;  2DRB A;  4FH3 A;  5J0O A;  2ZH1 A;  4M9L A;  3C18 A;  5CWR A;  1ZQB A;  4XQ8 A;  5J0U A;  4UBB A;  4PHA A;  5DBB A;  4X4U A;  4PHP A;  4UB5 A;  1KNY A;  9ICO A;  4O9M A;  4QZC A;  1PX5 A;  1NOM A;  4S3N A;  4NM2 A;  4UB4 A;  5J0S A;  4EBK A;  3JPN A;  1ZQG A;  9ICR A;  4RQ8 A;  1KEJ A;  4IQV A;  4RPY A;  8ICW A;  4M9N A;  4MF2 A;  2ZH5 A;  2DRA A;  3RJJ A;  1TFY A;  4UD5 A;  3AQL A;  4PHD A;  4Z6F A;  5TZV A;  4X4N A;  2W9M A;  1ZQY A;  4RQ5 A;  5HC9 A;  1MQ2 A;  3V7K A;  5J0P A;  4M0A A;  4DOC A;  4M04 A;  4O5C A;  4RQ1 A;  4AT9 B;  7ICS A;  4KLT A;  1R8A A;  2BCS A;  5DB8 A;  4X4P A;  1BPE A;  1YLQ A;  4PH5 A;  4RPX A;  3AQN A;  7ICK A;  4RQ2 A;  3RJG A;  4PPX A;  9ICA A;  1ZQS A;  2DVI A;  8ICP A;  3V7L A;  2M2U A;  4X4R A;  4FHY A;  1ZQE A;  3H3A A;  3ISD A;  4I2H A;  4JWM A;  4RQ3 A;  2FMP A;  4NLZ A;  4O5K A;  2ISP A;  3OVB A;  3RH5 A;  5J0Y A;  4F5P A;  7ICL A;  3MDA A;  2I9G A;  3LK9 A;  4TUP A;  5CJ7 A;  5F2V O;  1WOT A;  4X4V A;  2P66 A;  4TUS A;  4F5O A;  2ZH8 A;  5HRH A;  4E8F A;  2DR5 A;  3B0X A;  8ICU A;  5BPC A;  4AT7 A;  4WC4 A;  4XRH A;  5J2A A;  3C2M A;  4GXJ A;  2M2W A;  4KLJ A;  4DOA A;  1RPL A;  3AQM A;  5J0W A;  3C2L A;  9ICN A;  8ICQ A;  1ZQC A;  2ISO A;  4X4T A;  3UXN A;  9ICG A;  4GXK A;  8ICE A;  4YN4 A;  3UXO A;  1RZT A;  4E7X A;  2NRK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...