5DECA

Crystal structure of the small alarmone synthetase 1 from bacillus subtilis
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
195
structure length
188
Chain Sequence
DDKWERFLVPYRQAVEELKVKLKGIRTLYEDDHSPIEFVTGRVKPVASILEKARRKSIPLHEIETMQDIAGLRIMCQFVDDIQIVKEMLFARKDFTVVDQRDYIAGYRSYHLVVLYPLQTVSGEKHVLVEIQIRTLAMNFWATIEHSLNYKYSGNIPEKVKLRLQRASEAASRLDEEMSEIRGEVQEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GTP pyrophosphokinase YjbM
publication title Catalytic mechanism and allosteric regulation of an oligomeric (p)ppGpp synthetase by an alarmone.
pubmed doi rcsb
source organism Bacillus subtilis (strain 168)
total genus 64
structure length 188
sequence length 195
chains with identical sequence B, C, D
ec nomenclature ec 2.7.6.5: GTP diphosphokinase.
pdb deposition date 2015-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04607 RelA_SpoT Region found in RelA / SpoT proteins
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.860 Mainly Alpha Orthogonal Bundle Helix Hairpins Nucleotidyltransferase 5decA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5decA01
1ZQDA 3MDCA 8ICSA 4UB5A 9ICUA 5BPCA 7ICSA 4X4UA 7ICRA 4NKTA 4RQ0A 3V7KA 3L9DA 4UB2A 4RPYA 5CR0A 1F5AA 4IG8A 5DEDA 4PPXA 5J2EA 4M0AA 8ICRA 1HUOA 9ICGA 2DR7A 4I29A 3H3AA 1ZQUA 4KLLA 1ZQIA 4QZHA 2M2UA 9ICSA 7ICJA 1TFYA 2ID1A 4S3NA 2FMPA 7ICFA 1ZQSA 3UQ0A 5HR9A 7ICNA 5HRBA 5DB9A 3OUYA 5J0SA 3C66A 3UXPA 2PFOA 3B0YA 4RQ7A 5J2CA 4QZIA 3ISCA 5CJ7A 9ICIA 5DDMA 1YLQA 4FHWA 3NYBA 4DO9A 1XSPA 9ICBA 5J2HA 5J0QA 4O5EA 3RH5A 2IHMA 4XQ8A 4WC1A 3V7LA 2BCSA 2DRAA 4IQUA 1ZQWA 1TVAA 5J0PA 4E7XA 4RWNA 4Z6FA 2FMSA 4M9HA 3UPQA 4KLDA 4YCXA 5DDYA 4QZBA 3C5GA 4M9JA 3ISDA 4WC0A 2ZH4A 1BPEA 4XQ7A 2M2WA 3JPPA 4YMMA 1VJ7A 3MGHA 4UB3A 4XA5A 3UQ2A 2RFFA 2VANA 1KDHA 5CB1A 4I28A 9ICAA 2ZH2A 4P4MA 2ZH3A 1TFWA 1UEVA 5IIMA 9ICOA 4QZAA 4PGYA 1MQ2A 4WBZA 4LZDA 4NM1A 4WBYA 1MQ3A 2BPCA 1ZQGA 4YD2A 2ZHAA 4TURA 3C18A 4QZFA 1BPZA 4PHDA 4P4PA 7ICGA 2DRBA 4TUSA 7ICTA 4KLEA 3RJEA 5HRDA 5DBBA 1XSLA 2HHPA 5HRKA 3RJIA 5IIJA 4I2AA 5DBCA 4NLKA 5EOZA 3RJJA 4KLOA 9ICPA 5DKWA 8ICQA 1R8BA 3V72A 5J2JA 4XUSA 1ZQRA 4PHEA 2ISPA 2DR5A 4GXIA 4PHAA 4WC4A 2PFQA 7ICUA 4RQ1A 5TZVA 5J0OA 3HIYA 4WC7A 3PMNA 4KLTA 9ICKA 3WFOA 5HHHA 2ZH5A 9ICMA 1BPDA 1JQRA 4ATBA 1ZQYA 4AT7A 3C5FA 9ICLA 4YN4A 4X0AA 4UD5A 4RQ5A 2P66A 4QZ8A 4I2EA 5J2FA 3H37A 5D46A 4Z6DA 2ZH6A 3AQNA 5J2DA 1RPLA 8ICEA 3OV7A 1R89A 4TUPA 1ZQTA 3GDXA 8ICYA 3PNCA 4KLGA 4GXKA 4PGXA 2PFNA 2I9GA 3V7JA 9ICRA 7ICEA 1TV9A 4QZDA 3B0XA 1JAJA 5DB8A 4QZEA 8ICPA 4FH5A 4M2YA 4I2JA 5J29A 8ICZA 4RWOA 4X4NA 5IILA 1KEJA 3PMLA 8ICJA 1ZQFA 8ICGA 5IIKA 5DB7A 4RT3A 5HC9A 8ICTA 9ICVA 4KLIA 4EP7A 3RJFA 1JMSA 1R8CA 5F2VO 3TFRA 7ICMA 3WFRE 2BCVA 9ICJA 2GWSA 5J0UA 4RQ6A 4UBBA 8ICFA 4UB4A 4R64A 3OUYB 5BOMA 4Z6EA 3UXOA 5IIOA 5J2GA 1ZQZA 3WFPA 9ICQA 3HW8A 1NO5A 5HRIA 2M2VA 3JPOA 1Q78A 3OVAA 3C2KA 4F5RA 3RH4A 1UETA 4F5OA 4NY8A 3C2LA 4X4OA 1ZQPA 4RWPA 4QZCA 3JPNA 4UB1A 3AUOA 3MDAA 4M5DA 4JWMA 4MFCA 2M2TA 1WOTA 3HJ1A 1ZQNA 3H39A 5J2KA 5D49A 4Z6CA 1BPYA 4GXJA 4KLMA 4UAWA 4LVSA 9ICCA 7ICIA 2ZH1A 1R8AA 1KNYA 2ZH7A 5D4BA 4KLSA 1ZQBA 3JYYA 4MFFA 4P2HA 2ISOA 4FHPA 4NM2A 8ICIA 5J0RA 3OGUA 4DOAA 4FHVA 1MIWA 4I2DA 4AT9A 8ICOA 2NRKA 4WC6A 4O5CA 1ZQOA 4DOCA 4FO6A 1ZJNA 4FHXA 4M9NA 1MIVA 2O5AA 4RT2A 4AT8A 1ZQMA 4KLHA 8ICXA 2W9MA 9ICNA 4E80A 7ICPA 1MIYA 5J2IA 1ZQXA 4FHYA 1ZQKA 4QZGA 4LT6A 3AQLA 5CHGA 4X0BA 4RQ8A 4X4PA 3LK9A 2Q66A 3AQKA 5CA7A 4KLUA 1VFGA 7ICKA 8ICLA 3MBYA 8ICUA 3H38A 4RWQA 5HRLA 4I2GA 4I2CA 4F5NA 5IIIA 4EBJA 3UXNA 4FH3A 5J0XA 4XRHA 4MF8A 4ATBB 5HRHA 4AT7B 4IQTA 4MF2A 4WC3A 2DR9A 9ICFA 3LQCB 4O9MA 1ZQVA 4NXZA 4WC2A 4K4GA 8ICWA 3WFSC 4JWNA 5J0YA 1Q79A 4YMNA 4K4IA 4F5QA 1FA0A 4RQ2A 3AQMA 5CWRA 4DOBA 2BCQA 4EBKA 4R65A 2BPFA 8ICBA 1ZQAA 1ZQJA 5CP2A 2BCRA 4KLJA 2PFPA 3OVSA 2ZHBA 1ZQCA 1OU5A 2DVIA 1ZQLA 4PHPA 4YMOA 1ZJMA 3JPRA 3JPTA 5HREA 4RQ4A 3C2MA 3TFSA 4QZ9A 4R63A 1UEUA 3AU2A 4UAZA 4LZGA 4WC5A 5IINA 4X4TA 2DR8A 4I27A 4K4HA 1RZTA 7ICVA 5HRGA 2PXIA 5J0TA 4TUQA 4R66A 4E8FA 4X4RA 7ICOA 2PBEA 3WFQE 3RH6A 2BCUA 2FMQA 2BPGA 4NKUA 4PH5A 1JN3A 4NLZA 4PGQA 4WCWA 3HX0A 2BE3A 7ICLA 7ICHA 8ICVA 4UD4A 4YD1A 4UBCA 5DB6A 3AU6A 4NLNA 8ICHA 9ICTA 1HUZA 1ZQEA 4O5KA 4MFAA 1V4AA 5HHIA 5J2AA 2ZH9A 3RJKA 4IQWA 9ICEA 3HWTA 3ISBA 5J0WA 4M04A 2ZH8A 1XSNA 5DECA 1ZQQA 4RPXA 4KLFA 7ICQA 4M47A 5BOLA 4IQVA 1NOMA 4X4QA 3OVBA 9ICXA 3RJHA 5J2BA 4X5VA 3K75D 4RPZA 4AT9B 8ICNA 3RJGA 3HJ4A 1BPBA 4I2IA 4I2HA 8ICCA 3UPSA 4M9LA 5DBAA 4RQ3A 1BPXA 2O1PA 9ICHA 4KLQA 4X4SA 3JPQA 3MGIA 4M9GA 4UAYA 5HRFA 4AT8B 8ICMA 9ICWA 1PX5A 1ZQHA 8ICKA 3JZ0A 4X4VA 4F5PA 3JPSA 8ICAA 4P4OA 4I2BA 4I2FA
chains in the Genus database with same CATH superfamily
4B7KA 4DV1B 5BPCA 4X4UA 3SPJA 4UCRA 5A2QN 2BSKA 3L9DA 4I0XB 4RPYA 5LP6A 2WLMA 4YY3O 3JCFA 1M4UA 3CX5F 1G4YB 8ICRA 1NU1H 1W59A 2BTOA 1NJIW 4MTGA 1AB3A 3HKCA 3H3AA 1Q86W 4JI4B 4PDRA 4NYKA 1XNQB 2UXDO 4LH6A 2PGGA 4QZHA 2GTAA 2ILMA 3PJSK 2XAGA 5LMUO 4GKJB 3X2QC 2P06A 1FJGB 4N21A 2FMPA 4OAIZ 2LFRA 4DR4O 5J2TA 2PFOA 4DV0O 4MW8A 4CBCA 3B0YA 4OAGA 2AXTZ 1K4DC 1NTKH 4HYOA 2WWWA 4X9QA 1TVKA 2EJ7A 4CZZA 4WBNB 3DSQA 4J7ZA 1XSPA 1VF7A 4PDVA 2YEVB 1NZ6A 2Q0OC 4O5EA 5JCOC 2L35A 4WC1A 3V7LA 4IQUA 1ZQWA 3FKSG 1W2BU 4RWNA 4E7XA 4R50A 3UKMA 2QKAA 4FPPA 1V55B 2FMLA 2CAZC 4LNUA 3FYEB 4DV3O 5EC1C 2WA3A 3ISDA 2IJIA 3W7XA 4WC0A 3FYIB 3JPPA 1SRYA 3HPLC 3UQ2A 5KLVH 1OCCC 4I28A 3ZN0A 2QKSA 2F1MA 5H6QA 4WOYA 2UUCO 1MQ2A 3MHHC 3KCXA 2WA4A 2PI5A 1ZQGA 2ZHAA 1BPZA 3HKBA 4PHDA 2ADQB 4K8VA 4U7OA 2UU9B 4FZ1A 7ICTA 1L1FA 1QU7A 3OD4A 1KUQA 5LYJB 1XHXA 5BR8O 4JI5O 1XSLA 5IWAO 4DUZB 3RJIA 1HWYA 1ZL8A 2Y69C 1Z5VA 1ENVA 4WQLA 5EOZA 1I08A 1P7BA 4GKKB 4KHPB 4LR3A 5KHHA 4XUSA 4PHEA 3PN1A 4GCZA 3CCJV 4WC4A 2PFQA 3ZMTA 5TZVA 5J0OA 2YUAA 3LSUA 3QNEA 1KMIZ 2EX3A 4KLTA 2AZ0A 4DR3O 2C2AA 5FNVB 1NKDA 3CCMV 2DYRB 1W0JG 2LW7A 2RQ6A 1G6UA 4YJ3B 4ATBA 4DR5O 3B8NA 3AK1A 3BABA 4YN4A 2YDEA 4UD5A 2R9RB 4YIPA 1OCOB 4TUYA 1AI5A 2D3OW 5JJNB 2VQEO 5D46A 4X62B 3ZRXA 4FJCC 2Y4TA 2G38A 3RYIA 4DV6B 8ICEA 4JGSA 4JAUA 4TUPA 4LF9B 1YHQV 1GN3A 4UCUA 4FZ0A 4JZ2A 5IYBO 3BRCA 9ICRA 1G1XB 2QTOA 2BSKB 3TGUH 1S5JA 1I0HA 1XL6A 4MVMA 5J29A 3MDSA 1YF2A 2XAJA 4K98A 2AW9A 2CGOA 1KEJA 4CH6A 4UCSA 3AG7A 1EZVH 2LQTA 1ZSPA 3HKCB 5DB7A 1EBOA 1QQCA 5HC9A 1IVSA 4UCVA 4EP7A 3JCUZ 3RJFA 5F2VO 2UXBB 4JTCB 3OW2U 9ICJA 1SQXH 5J0UA 5BOMA 1MNGA 5J2TB 4RQEA 2B5UA 5J2GA 1ZQZA 5EIBC 1US6A 3A0BZ 4H44B 5HFMA 2Q9LA 4HAMA 3WFPA 3VQVA 5GTHZ 4DYLA 3ABUA 1TVKB 4FFKA 3HW8A 1SQFA 4X20A 5E1AC 3JPOA 4CS3A 4I4TA 3OVAA 2YIAA 3RH4A 4LH7A 3U11A 4B3SB 4UVCA 2DQ3A 4N23A 1KKDA 3JD1A 3OTFA 3E8HA 3G80A 4F6RA 3JPNA 2EILC 4JI6B 3MDAA 1R3LC 4QJFB 1IXBA 2AGAA 1YCIA 1WOTA 3HJ1A 2ZR3A 5J2KA 5D49A 1FPOA 4Z6CA 4K99A 4GXJA 1BPYA 4AQYO 2QDOA 2QWQB 2FL4A 1WJZA 4IL6Z 4LNUB 1N33B 1PV0A 1OZ0A 1CPYA 2Q6AA 3A2FA 5EBWC 5CA0A 2PF4E 3CE2A 4ZHQA 2XAFA 2ISOA 1MA1A 2NNUA 2GV9A 3FB8C 3M7MX 5J0RA 3STZC 1V54C 8ICOA 1GN6A 1GMGA 1H2KA 4WC6A 1JVMA 2WPDG 4EGWA 4R8CA 1N34B 1N36B 1Q90D 4JI3B 1BZKA 3RYHA 3HKBB 3OGCC 2WLJA 1K4CC 4PA7A 4AT8A 2XOKG 4QE7A 1MMMA 3CYOA 4QNHB 4PDLA 4RQFA 2M6YA 5LMNO 7ICPA 5J2IA 4MTOA 3KZIZ 4JI7B 4QZGA 1ZQKA 2OCCB 4X8AA 5IT9N 1JJ2U 1VF6C 3JD3A 3VQWA 1KBHA 4DV2O 4RWUA 2Q66A 5L3GA 2X6CA 4WFBV 3A8TA 3MHSC 1H8HG 3NR7A 1EFRG 2IJHA 1F7YA 4JASA 2QEXV 2XHBA 1FFXB 4I2GA 3BCCH 2GTSA 1S77D 1XNRO 2CE4A 2VWKA 5J0XA 5LXTA 1KU9A 3B77A 3WG7C 5AG2A 4ATBB 4MF8A 3EHBB 1IBMB 4IQTA 4TQDA 4WC3A 2H8PC 4JLXA 9ICFA 1K3EA 1NR1A 5H5NA 3K57A 3K9AA 5C8YA 2B51A 2DYSB 4TUYB 4JWNA 5D5PA 2IHOA 1Q79A 2E76B 2DWEC 4RQ2A 1AROP 5CBFA 5CFTA 3RYIB 5CFSA 1TAEA 4Q6GA 2A3QA 1XOUA 2YXHA 3K03A 1F4MA 2PYJA 2BCRA 3GVMA 2ZHBA 2IU3A 1VARA 1WAZA 1QLEB 4K0KB 2VQFO 1R6TA 2JGDA 3HR0A 3JPRA 3JPTA 4KUMA 5HREA 1D5AA 2V7QG 1UEUA 2CK3G 4LZGA 2B1GA 5IINA 2PTMA 4K4HA 7ICVA 5HRGA 2P5OA 1MG1A 4X4RA 4OX9B 1O9HA 3RH6A 4O4LA 2BPGA 1B06A 4Z2WA 1XREA 4EFBA 4WCWA 3KCYA 2KG7A 2N74A 5LP6C 3CCLV 3CPWU 1L0NH 1Q6HA 2Y0PA 4I4TB 4YD1A 1XQ8A 2M7WA 4NLNA 1RM1B 2R9IA 1XMQO 2E74B 4F6RB 4FLWA 3RVYA 5J2UB 5J2AA 3SR2C 2V4DA 3SYCA 4M04A 3GWOA 4O2BB 5IY5C 2UUAB 2OTJV 2MW2B 5DECA 1M5IA 4YIOA 2IM9A 4KLFA 4DUYO 3JD2A 1NVPB 4JAVA 5CA0B 4GX0A 5LBQA 1G8MA 4X4QA 4ZHQB 2RJZA 3T1HB 3WFVA 5CBHA 5CA1A 3JASA 2ZQMA 5CN0A 2P90A 3K75D 8ICNA 3B40A 2PZSA 3NWIA 4CS2A 1WLEA 3T1YB 1H2NA 2AHZA 4J11A 4LEZA 2HJFC 3E83A 1NBMG 3GB7C 4OPAA 1S72V 4K97A 1S5HC 4X4SA 1WPXA 3RYHB 3HB3B 3AEIA 1MZEA 3SYOA 4DR1B 4AT8B 4WFEA 8ICMA 4FLXA 4R7CA 3OUSA 8ICKA 3JD4A 1VQPV 3AG3C 1HNWO 4LWSA 1Q81W 1KD1W 5FL7G 3WB1A 4YY3B 1XILA 3E22B 3TCUA 4K9AA 4DR6O 3NVOA 1PM9A 3FB7C 5EBLC 2BOBC 5J9PC 9ICUA 3CB2A 7ICSA 7ICRA 1AJQA 4QGPA 1SQPH 2D2CB 4NKTA 1V9PA 3V7KA 5CR0A 3R66A 2UXDB 2A06H 5LMUB 2EIMC 5D62A 4CC6A 5J2EA 4M0AA 1AILA 2JIZG 9ICGA 2DR7A 1SA0A 5LXTB 4JPRA 4DR4B 3IGAC 4LF4O 2ZDIC 4YHHO 4ZIBA 2CTPA 4P30A 1TFYA 2LFSA 2R72A 3ABLC 3OWGA 2JS5A 4LCUC 5B66Z 5C8YB 7ICNA 5HRBA 1GRJA 1GM8A 1F51A 3C66A 4RQ7A 4QZIA 4GUNA 3ISCA 5LL6Y 2EIJC 3P30A 3ZIAG 4NXNO 4DO9A 4JV5O 5J2HA 4KXRA 2YIDA 4QIWF 4KB6A 4WQKA 4XQ8A 2E75B 2DRAA 3HKEA 3K5NA 1VF6A 2Y69B 4TV8B 2ZCEA 4CH3A 3CC4V 1WP8A 2Q5ZA 2JGDB 1KP2A 2OTLV 4DR2O 4YCXA 2DYSC 1Y6XA 2EULA 4QZBA 3BPZA 3RVZA 1EN4A 4UB8Z 4BWAA 4M9JA 2K9PA 2ITCC 4LF8O 3SYPA 2Y48A 4J7JA 1IBLO 4XQ7A 2M2WA 5TISZ 4YMMA 1ZTEA 3OMIB 4X65O 9ICAA 1VQOV 1URFA 1Q6UA 3AG2C 2ZH2A 1TGOA 4O4LB 4CH4A 3ZJZA 3JSNA 1VEWA 4D6TH 1WN7A 9ICOA 4WBZA 4XDKA 4MVRA 4TSFG 2CTWA 4MW3A 2GBOA 2KG7B 4NM1A 1JPXA 3JYCA 1MQ3A 5BR8B 4JI5B 3C18A 4QZFA 1I94O 1HDJA 4BIZA 4FM1A 1K7DA 4BIUA 2FYUH 4DV4O 2HLDG 4I2AA 5DBCA 3N2KA 4NLKA 3K0DA 2ATKC 5LHIA 4DR3B 5DKWA 1P49A 1TUBA 4LC1A 5J2JA 5JTGA 3DXRA 4TT3G 2P7TC 4PHAA 4DR5B 7ICUA 5CA1B 1XDCA 2ZIMA 1H2LA 4WC7A 3PMNA 3JASB 1FKAO 2ZM6O 4B7EA 4O6AA 4K9BA 2ZH5A 5EK0A 2KKWA 5B1AB 3BFRA 1JQRA 4DK1A 1RM1C 2VQEB 3UT5A 4KFMA 9ICLA 3QO7A 1ROPA 5H9CA 2QA4V 1NVPD 1D2DA 3G71V 4RQ5A 3O9OA 1J95A 2Q0AA 5K1PA 4G2KA 3WU2Z 3ABTA 4X1YA 5J2FA 3H37A 4LF6O 3W7UA 1I7FA 1DGSA 5J2DA 1WB8A 4FFBA 3FAVA 1RPLA 1QCEA 1R89A 2JEUA 3H1KH 4LWSB 1VQ8V 3ZMSA 5CFUA 2EILB 3V7JA 1LR1A 3B0XA 5L3EA 2OIGA 2PUSA 3K7DA 5LOVB 1N0JA 3RYCA 3EFFK 4IT5A 1DF5A 4TV9A 3G4SV 1MSWD 4I2JA 1M57C 2IW5A 5JWPA 2DW4A 3CEIA 5IILA 4NXMO 1CP9A 3C3SA 5GONA 4XBFA 1SA0B 1IBKO 4RAIA 2EINB 3LDCA 1V54B 3ASOB 4KLIA 2Q73A 1JMSA 1R8CA 3TFRA 7ICMA 2DN9A 3CCVV 2QKCA 3TETA 2GWSA 4LF5B 2V1DA 3FFQA 2QWNB 1CEZA 1KQSU 4J41A 1S76D 1FXVA 4JI0O 4N7RA 1BMFG 3D8CA 4BAYA 1SQQH 4X66B 5FPRA 5HRIA 2HVKC 3C2KA 4F5RA 2BBHA 2Q4PA 4P2ZA 4PI2A 3D36C 4B3TO 4NY8A 1IX9A 3RWRD 3K58A 4RWPA 4QZCA 2RCVA 1R6NA 2X6AA 3HKEB 1S5LZ 4M5DA 4MFCA 4PD4F 2M2TA 4JYBA 4MVQA 1U96A 3I56V 1AR4A 3H39A 3ZHVA 4H37A 3L73H 4KLMA 2XAHA 9ICCA 7ICIA 2GA9D 3ABMC 4GLXA 2ZH7A 4GT1A 5KHKA 3ERCC 5LGNA 1NS1A 1BS3A 3JAWA 2PYLA 2GSMB 3CJHA 1AP5A 3WG7B 5EBMC 3K5OA 1UFIA 3OGUA 4DOAA 2ZDIA 2AZ2A 1MIWA 2DQ0A 4AT9A 3CRCA 4O5CA 2CTQA 1ZQOA 1ZJNA 1XEQA 2QR4A 5GTIZ 4M9NA 1MIVA 5LMNB 2RNBA 2B56A 1P84F 2LP7A 1ZQMA 3DC5A 4DV2B 2A9HA 4E80A 1AJPA 2ZXWC 2PY5A 1VP7A 4FHYA 3AG1B 1NH2B 1R3JC 5CHGA 4X0BA 4X4PA 3N2KB 4CC5A 3RYFA 3CRMA 1GM9A 1TUBB 1XNRB 4W4LA 1Y66A 4TOIA 1JR9A 3DXRB 2L6LA 3K5LA 8ICLA 4ZKIA 4A5UB 2QM8A 2JJ1G 2ZE8A 3H38A 4RWQA 5HRLA 1K97A 4F5NA 5IIIA 3UXNA 4FH3A 1GPJA 3OT7A 1OCZC 2KQXA 1XBLA 4B08A 4LFCO 5HRHA 4I7ZB 4JI8O 3UT5B 3CSXA 2Y4UA 2RN9A 4U3JA 4DV7O 1MSDA 2DR9A 1YTFB 2KB1A 4O9MA 4NXZA 3CP1A 2YC0A 2EZPA 4X1YB 5LP6B 4WFFA 4F5QA 3LUTB 4UUJC 5CWRA 4DOBA 4FFBB 3FAVB 3TXSA 2BCQA 4GZRB 4BW9A 3MAQA 3CCEV 3KKYA 3AK2A 2VQFB 1Q8IA 1ZQJA 3DC6A 2A79B 3APOA 3QTCA 1QVGU 5CP2A 5EIBD 4KLJA 3OVSA 5B1AC 2ZNJA 1XI1A 2Q69A 3OUFA 5IJ0A 5IY5B 3RYCB 4PHPA 4D7SA 1JOYA 4TV9B 4YMOA 3F5WC 4JI4O 3UCSC 1XNQO 3UM7A 3C2MA 3J7AU 2OT5A 4GKJO 4UAZA 4X4TA 1Q43A 4GX2A 5GONB 1DLBA 2JVDA 1RZTA 1Y74A 4H0LB 4TUQA 1QLNA 4R66A 4WFGA 1HNXO 4E8FA 7ICOA 3NXSA 2FTKA 2FMQA 2FKXA 4EKWA 3SYAA 1Y76A 1B6QA 1XMQB 3IC9A 1N8RW 3FD9A 7ICHA 2QE7G 2Q7GA 1QR9A 4J42A 1UPGA 3AU6A 3AG3B 2DE0X 1ZQEA 4O5KA 2EINC 3ASOC 2HVJC 3GWKC 2ODMA 3ER9B 2ZH9A 3RJKA 4IQWA 9ICEA 3HWTA 3ISBA 2GUZA 2ZH8A 5CB4A 3WB2A 1ZQQA 7ICQA 1N32O 2ZE6A 4M47A 2LO1A 4X89A 3G6BA 3B8MA 2EIMB 9ICXA 3JAWB 5EZYA 2JJ2G 3CJHB 1YI2V 2GHYA 1VQ9V 5J2BA 3AK3A 5L3BA 3KG2A 4AT9B 3RJGA 2WLLA 3ABLB 1X59A 3ZN1A 1ZL8B 3TJTA 5DBAA 7ICGA 2O1PA 3JAKA 4KLQA 4JYAB 4W4KA 1JQ0A 4M9GA 1HNWB 2BBJA 2QM7A 3OEEG 1EN5A 5HRFA 3BVOA 3T4ZA 1Q6IA 3I55V 2EIJB 2GDSA 1SZXA 4DR6B 4UVBA 1PX5A 5LGTA 5B1NA 4AILC 1ZQHA 3D36A 1K73W 3JZ0A 1GM7A 4F5PA 3JPSA 5BMVA 3IAYA 4RUEA 1MOFA 4I2FA 1ZQDA 8ICSA 4JI1O 4UB5A 3RYFB 5LGUA 2QWPB 4RQ0A 5IE9A 4LF4B 4YHHB 3ABKC 3E8GA 3M99B 1FXHA 4IG8A 5DEDA 1O9GA 1H2MA 1SZTA 1HUOA 1NH2D 2WAMA 1SESA 3BHPA 3CRQA 3AG2B 5L3DA 1A32A 4KLLA 4PI0A 1VF5B 4U3JB 4O4HA 7ICJA 4DV6O 1OCRC 2ID1A 3AG1C 4NTXA 4PHZA 1ZQSA 3UQ0A 5HR9A 3OUYA 5DB9A 4JV5B 5J0SA 1RPRA 3FB5C 3QG5A 5J2CA 5DDMA 2QSAA 1KP3A 1PL4A 2R9AA 3LSSA 4MVSA 4FLYA 1FAFA 3NYBA 1KYOF 4K8ZA 1EM1A 1FYJA 9ICBA 1YTFD 3ZHQA 2Z5UA 3SYQA 4DR2B 2IHMA 2BCSA 2YI8A 4HNAA 4IIJA 2CUGA 4LF8B 1VQNV 2FMSA 5H6RA 1IBLB 4M9HA 4KLDA 5DN6G 2H94A 1PNMA 4X65B 2ZR2A 3S3WA 3SPIA 3E8BA 4X20B 1Y74B 3RGBA 2EIKC 1HNZO 1BPEA 5KA5A 3ETEA 1PD3A 4NB5A 1VJ7A 4UB3A 2RFFA 4UB6Z 3ZX6A 1YITV 5CB1A 2Q7HA 5EYPA 1R6KA 1DF4A 2EWRA 1AI6A 3SPCA 3A0RA 3UO3A 1I94B 3LNNA 4EEDA 5IIMA 3JALA 4PGYA 1Y76B 2IH3C 3IFXA 2HN1A 1TA8A 1BGYH 4UV9A 3JSLA 4WBYA 2Z3YA 4GX5A 4YD2A 3LSQA 1DK1A 4O69A 1Q3EA 4DV4B 3K08A 1VQ7V 3RJEA 3J80N 2NR5A 4FMTA 2E5LO 5HRDA 3CK6A 1SF9A 1Q7YW 4HX0A 4EEQA 1K5SA 4RO2A 2GUZB 1VQKV 5IIJA 5CB4B 1ZX3A 4TQFA 9ICPA 1M57B 3B2EE 2ZNIA 4OAFA 2ZM6B 8ICQA 3V72A 1BQZA 3RW0A 2Q8VA 1ZQRA 2DR5A 4GXIA 2H3OA 4JYCA 2UXCO 1N34O 3HIYA 3LDDA 1N36O 4BIOA 3SJBC 3WFOA 5HHHA 1JA8A 5IJ9A 2WLLB 4NXVA 1BPDA 1ZQYA 4LF6B 4AT7A 3OEHG 1YZBA 3ZMUA 4DV5O 4LFAO 3JAKB 1VIBA 4NTWA 5IYZA 1SERA 4KP4A 4FLTA 2ZH6A 3RN4A 3AQNA 2AHYA 2WLIA 2Z0AA 3OV7A 3GDXA 3ZEDA 3BEHA 1S3JA 2F95B 4PA3A 4DV0B 4GXKA 2IUBA 4PGXA 1Z2GA 2I9GA 2FCLA 2LGWA 7ICEA 1TV9A 4F6EA 2XT9A 2P67A 4P9OA 4NXMB 1OJHA 3IJ4A 4DK0A 8ICPA 3QO5A 1YSCA 1IBKB 4B3RO 4DR7O 1YJ9V 4M2YA 3VBBA 3ABMB 4J7KA 4QE9A 8ICZA 4RWOA 4X4NA 1E1QG 4MKPA 5K1XA 3PMLA 5B3SC 4WBNA 1NQTA 5IIKA 1LUVA 2Y0IA 8ICTA 2YEVA 1Z5WA 9ICVA 4O4HB 4JI0B 3WFRE 2F23A 2YS8A 2DOSA 4RQ6A 4UBBA 1X4TA 4DV3B 4R64A 5EC2C 4JI2O 3OUYB 1XHZA 1N4CA 2EZOA 5IIOA 1AI7A 2KSDA 1BL8A 3O65A 4B3TB 9ICQA 4X64O 4K35A 3CXHF 2BCCH 3CMEV 4FM0A 4K0KO 2JK5C 1Q78A 1BE3H 1RP3B 1UETA 1RSOA 3G6EV 4F5OA 2IH1C 2UUCB 3C2LA 2ZXWB 4X4OA 3ZRWA 4HNAB 4K8XA 3HKDA 3CD6V 2LJ2A 3AUOA 4JWMA 2O57A 3ETQA 5GW7A 1ZQNA 3RBZA 1SC5B 2R70A 2UUBO 1KECA 2XTAA 2ZH1A 1QBZA 1QHTA 1R8AA 1KNYA 5IWAB 3K5MA 2XUMA 8ICIA 1GK9A 3Q4HA 1OCZB 5EYPB 5CMUA 5IDJA 5BXZA 4FHVA 4I2DA 1PP9H 2NRKA 3JALB 3CC2V 3CHXA 5ITZA 2Q67A 4DOCA 4FO6A 4FHXA 3BY6A 2O5AA 1ZLZA 1I5XA 1NTMH 3QO8A 3K04A 4UXNA 2JDIG 4U3FH 1K33A 4H13B 1H2GA 1YXBA 3U0ZA 4JYYA 2XASA 1ZQXA 3P32A 2A0LA 1FD9A 1HR0O 3AQLA 3IC7A 1IXMA 4J9ZB 4RQ8A 2DWDC 1AP6A 5LHGA 3K06A 1W0KG 7ICKA 4LFCB 4JI8B 8ICUA 1OV9A 4OPHA 1DTOA 4I2CA 3P3NA 4EBJA 3BA9A 5IJ9B 4MTFA 4XRHA 1NTZH 4AT7B 4MF2A 2CH7A 3ASNC 1ZQVA 5IYZB 3VQXA 8ICWA 5J0YA 4K4IA 3W7SA 2WLIB 4QPJA 4EBKA 3OTOO 4MS2A 3EF2A 1YDXA 1M93A 8ICBA 2ZKOA 1K8AW 5IYDO 3THOA 4K96A 5JQGA 4I50A 1ZQCA 1OU5A 4ASUG 2YXLA 1HP8A 4HZ3A 2DVIA 1XMOO 4G28B 5BZBA 3CCRV 1ZJMA 4P9PA 4ZI7A 1S0VA 3ZHSA 1GAXA 4QZ9A 4R63A 3AU2A 2WLNA 1HNXB 3VQYA 1E79G 5DM6V 3D3QA 2OCHA 2DR8A 2WSSG 3AG4C 4GX1A 4E2LA 5KUKA 2VWJA 3ZRSA 2B1IA 3SPHA 3H1HH 4AQYB 1FXKA 3L75H 2PBEA 3DGEA 2BCUA 5D63A 2F43G 4LFBO 4LP8A 4NKUA 2DJVA 4PH5A 4I55A 3L74H 4PGQA 2HP8A 2P4VA 1EZJA 1LUWA 5D61A 2WLHA 4JTAB 7ICLA 3H01A 8ICVA 2CDYA 4UD4A 4UBCA 3SJAC 2BTQA 4EB6A 1RSOB 3JATA 4UVAA 4Q20A 4UFZA 1WA8A 8ICHA 3S3XA 3ZRWB 1J5EO 1GTOA 2B4VA 3HKDB 4MFAA 1V4AA 4MSWC 1N32B 1BSMA 5HHIA 1AR1B 1VQ5V 4O67A 4O68A 4WH5A 5J0WA 4DO2A 2IU0A 4FVMA 2QWRB 1BT8A 5KA6A 5B3QA 2OIEA 3ABKB 4RPXA 4LF7O 5BOLA 1NOMA 1R1BA 4B3MO 1GKFA 3OVBA 2HHHO 3RJHA 4IGGA 3LDEA 3Q4HB 3K0GA 4X5VA 4LEYA 4O2AA 1M90W 3TXQA 2EJRA 4RPZA 2CGNA 5H2FZ 1OCRB 5KUMA 4I2IA 4I5SA 2ITDC 3MCRA 5ITZB 4I2HA 4XJEA 2QJ1A 3ZRVA 3UPSA 4M9LA 3SJCC 3CCSV 1BPXA 1Q82W 3WB0A 1OHHG 5CBGA 3JPQA 4J10A 4BR6A 4UAYA 1FFXA 4ABMA 1ZWIC 2RMKB 9ICWA 1K9MW 2F4VO 2F66C 3G67A 4JI1B 1JCHA 1YVWA 4HBNA 4JF3A 3FX7A 4X4VA 5D5QA 4LEWA 4FIPC 8ICAA 3APQA 1NR7A 4OAHA 3RFRA 5E79Z 3TK1A 2YIBA 3OMAB 4K3AA 3MDCA 4L87A 1K92A 5KHGA 1JMKC 5KMGA 2P4KA 1KB9F 4UB2A 1VQMV 4WF9V 1F5AA 3QVNA 1FS0G 4FK5C 2LGQA 3OM3B 1YJWV 1CXZB 5KX5A 4PPXA 3OAAG 2EIKB 4DV1O 4NXUA 1XL4A 4MVOA 4I29A 4TWKA 5C93A 5B1OA 4FLVA 1ZQUA 2CH7B 1ZQIA 4X1KA 5CA3A 1Q5OA 2M2UA 9ICSA 1JX9A 2YI9A 4S3NA 7ICFA 2ZIOA 1H2SB 5LA6A 4ICGA 3UXPA 3PHZA 1QR8A 4NVPA 2QWOB 4IYIA 3K59A 5CJ7A 9ICIA 2OYQA 1YLQA 4FHWA 1FJGO 4UV8A 4I0UA 4KL1A 3W7WA 4J80A 5KHIA 5J0QA 3RH5A 5B1BB 5JQGB 4I50B 4Z1VA 2Q68A 2W0FC 2X0LA 1TVAA 1ZAUA 2F93B 3L71H 3OMNB 5J0PA 4Z6FA 4ZI7B 1HNZB 3UPQA 2W6JG 1ZUQA 5HFLA 2EBOA 4QPKA 3ZBHA 5LHHA 5DDYA 4NTYA 3F7VC 3C5GA 4LF5O 4ZOLA 1NI8A 4YXWG 5B5EZ 3JARA 3I5DA 2ZH4A 3MGHA 4XA5A 1BHBA 2VANA 1SQGA 3BA8A 2GAFD 3OGIB 1FXKB 2ZT9B 4WCEV 2N04A 1KDHA 4PJ0Z 4P4MA 4X66O 2ZH3A 4DUYB 1H38A 5J2UA 1TFWA 1UEVA 1VQLV 1SS3A 4I55B 2XNDG 4QZAA 3A0HZ 1KKCA 2P6JA 2XAQA 4NR1A 4O2BA 4XDLA 4E4EA 3EVKA 3ZHTA 3T4DA 1L8DA 2E5LB 2OWOA 4LZDA 2BPCA 2MK3A 1SQVH 4TURA 1IURA 1PPJH 1WPBA 2BTQB 4EB6B 3ZHUA 3CXCU 3JATB 3CC7V 4IHJA 4P4PA 4TUSA 2HG5C 1WA8B 3LNMB 4WFHA 2DRBA 4KLEA 1AJNA 5DBBA 2HHPA 5HRKA 2IJJA 2K1EA 2UU9O 1RPOA 2UXCB 5L3FA 3ICXA 3RJJA 4KLOA 1R8BA 4RUFA 3ZCCA 4DUZO 4O4IA 1V55C 4YJ2A 2ISPA 1VQ6V 4DV5B 5B3SB 3U10A 4LFAB 4RQ1A 4I9WA 5FLXN 4O2AB 4PDMA 9ICKA 4XDJA 5JCOA 4GKKO 4FLZA 4KHPO 3H1IH 3OR6C 9ICMA 2Q7EA 1WNSA 4UCOA 3E22A 3C5FA 2VS0A 4X0AA 5L3CA 1AR5A 4AI8A 3F7YC 2P66A 3NKUA 4QZ8A 4I2EA 4Z6DA 3K3WA 3JAMN 3K79A 3CWBH 1JFFA 4KM5A 1ZQTA 2WLKA 1T5EA 4B3RB 2W0XA 8ICYA 2E3CA 1BCCH 4DR7B 3PNCA 4KLGA 3ZMVA 1U97A 4GYCB 2PFNA 4X62O 2IBZH 2DMXA 4QZDA 3ER8C 3ETGA 3OFNG 3QF7A 4UCTA 3T2MA 1JAJA 5DB8A 4QZEA 5KMGB 4LF9O 4NXNB 4FH5A 4F4LA 1LNQA 3L70H 4X1IA 4NXTA 1JJOA 4PELA 5KX5B 4JAAA 5JVDA 3N2GA 8ICJA 1YEWA 1ZQFA 8ICGA 4JI2B 3H9VA 4RT3A 5KHJA 3CCQV 4X1KB 4CH5A 1GN2A 4O4JA 4X64B 2UXXA 2BCVA 2DYRC 3W7TA 3T1CA 1D5NA 4TV8A 5JJEB 8ICFA 5IJ0B 4UB4A 2UXNA 3SPGA 4Z6EA 5LA6B 3UXOA 1VMGA 2HN2A 2HJDA 4NKGB 2UXBO 1OCOC 4X88A 3M8AA 4H33A 1NO5A 4DW1A 4MTXA 2M2VA 1P7GA 2X7RB 1GN4A 3SJQC 3OR7C 1IDSA 4FM2A 1Y4MA 2ZE7A 1ZQPA 3R65A 2QM4A 2UUBB 4DRXA 4UB1A 5B3PA 1N0NA 4JZGA 3C90A 4NXWA 3FB6C 3K9SA 4B3SO 1F4NA 4UAWA 4LVSA 3ETDA 3JCZA 5BY1A 3ML0A 1SKVA 1M56B 1YIJV 4JI6O 4ZOLB 1YJNV 5D4BA 3JD0A 4KLSA 3UQ8A 1ZQBA 3JYYA 4MFFA 3JARB 4P2HA 5FPOA 4JTDB 1BHAA 3H1JH 4FHPA 5JH7A 1TUEB 3E89A 4NM2A 2B9ZA 1HW7A 1N33O 3CCUV 2NN4A 3ASNB 3F5TA 5B1BC 4DXWA 4Z1MG 1COWG 2ZD9A 4PA6A 3CS5A 3STLC 2NLJC 2HKOA 3BAAA 3SDLA 4IYHA 4RT2A 3RT3C 4R6ZA 2IJKA 2YICA 3E8FA 4AHCA 1GH6A 4G27B 2VRZA 1HR0B 4IHJB 5EZYB 4KLHA 1EN6A 4LBEC 3UO2A 8ICXA 4OXSA 1M1KW 2W9MA 9ICNA 1Y67A 4EEBA 3B09A 4MVZA 4JI3O 1MIYA 3CRAA 3X2QB 1B3QA 4DW0A 1FXKC 1AVMA 4LT6A 1GO3F 1BQ0A 1P4RA 1NT2B 2QGNA 3LK9A 3AQKA 5CA7A 4KLUA 1VFGA 3ZHRA 3D3IA 1WB7A 4I0XA 4O4IB 4YJ2B 4JI7O 3J81N 3MBYA 5IYCO 3AG4B 2X6BA 1FFTB 2YSUB 4JYAO 3N27A 3ZMZA 4MT8A 2YXYA 1AI4A 3OE7G 2ZINA 5BMVB 1ORQC 4ZBMA 2RDCA 1R3KC 3H1LH 1SETA 1RFYA 3DTUB 3LQCB 1PNKA 2HFEC 2HEPA 1WP7A 5LOVA 3OTOB 1SQBH 4WC2A 2ETNA 4K4GA 4CS4A 3WFSC 4YMNA 1M9NA 1IBMO 1UJWB 2ARHA 3VOUA 1FA0A 3AQMA 4NXXA 1JFFB 4R65A 1H8EG 1XMOB 2BPFA 1OCCB 4OGQB 1IZ3A 2P22C 1ZQAA 1I5YA 2HR3A 2JS3A 4I9QA 2PFPA 4PA4A 2OCCC 1PKXA 1MZFA 2QTSA 1ZQLA 5CHEA 2FB5A 2ZE5A 2PI4A 4RQ4A 1K5QA 3E86A 4X1IB 3TFSA 1R3IC 3E2EA 5JVDB 4WC5A 3N2GB 4I27A 4LFBB 1F23A 2YIBD 2PXIA 5J0TA 2JEXA 3SGIA 1XUQA 4O4JB 3ZS8C 5JJJB 5KAFZ 3C3TA 4IIJB 4EFEA 3WFQE 1B04A 1QNMA 2BOCC 3L72H 1K34A 1JN3A 4NLZA 1PNLA 3HX0A 1J5EB 2BE3A 4L8JA 4PV1B 4JLZA 4OX9O 2LW1A 1KC8W 1QVFU 3E35A 5KAIZ 5A9GA 4WFAV 5DB6A 3CRRA 4FO1A 9ICTA 1MABG 1HUZA 2JGUA 3B4SA 3CMAV 4DRXB 5LYJA 4LF7B 4B3MB 2HHHB 1QLEC 1XSNA 3EXAA 4D7TA 3MD0A 2CTRA 4IQVA 2N05A 5JH7B 4C7UA 2UUAO 1THZA 1VQ4V 2A7WA 5FNVA 3HJ4A 1BPBA 4EV6A 4YJ3A 3P3PA 4MVUA 3T1HO 4LEVA 8ICCA 2F4VB 4RQ3A 9ICHA 2ADPA 3MGIA 4J9YB 4U7NA 3T1YO 1M56C 2JRIA 4DV7B 4FLUA 4BW5A 1PL0A 2W6IG 1L0LH 1R73A 4DR1O 4P4OA 4I2BA 1E1RG 4PA9A
chains in the Genus database with same CATH topology
1ZQDA 3MDCA 8ICSA 4UB5A 9ICUA 5BPCA 7ICSA 4X4UA 7ICRA 4NKTA 4RQ0A 3V7KA 3L9DA 4UB2A 4RPYA 5CR0A 1F5AA 4IG8A 5DEDA 4PPXA 5J2EA 4M0AA 8ICRA 1HUOA 9ICGA 2DR7A 4I29A 3H3AA 1ZQUA 4KLLA 1ZQIA 4QZHA 2M2UA 9ICSA 7ICJA 1TFYA 2ID1A 4S3NA 2FMPA 7ICFA 1ZQSA 3UQ0A 5HR9A 7ICNA 5HRBA 5DB9A 3OUYA 5J0SA 3C66A 3UXPA 2PFOA 3B0YA 4RQ7A 5J2CA 4QZIA 3ISCA 5CJ7A 9ICIA 5DDMA 1YLQA 4FHWA 3NYBA 4DO9A 1XSPA 9ICBA 5J2HA 5J0QA 4O5EA 3RH5A 2IHMA 4XQ8A 4WC1A 3V7LA 2BCSA 2DRAA 4IQUA 1ZQWA 1TVAA 5J0PA 4E7XA 4RWNA 4Z6FA 2FMSA 4M9HA 3UPQA 4KLDA 4YCXA 5DDYA 4QZBA 3C5GA 4M9JA 3ISDA 4WC0A 2ZH4A 1BPEA 4XQ7A 2M2WA 3JPPA 4YMMA 1VJ7A 3MGHA 4UB3A 4XA5A 3UQ2A 2RFFA 2VANA 1KDHA 5CB1A 4I28A 9ICAA 2ZH2A 4P4MA 2ZH3A 1TFWA 1UEVA 5IIMA 9ICOA 4QZAA 4PGYA 1MQ2A 4WBZA 4LZDA 4NM1A 4WBYA 1MQ3A 2BPCA 1ZQGA 4YD2A 2ZHAA 4TURA 3C18A 4QZFA 1BPZA 4PHDA 4P4PA 7ICGA 2DRBA 4TUSA 7ICTA 4KLEA 3RJEA 5HRDA 5DBBA 1XSLA 2HHPA 5HRKA 3RJIA 5IIJA 4I2AA 5DBCA 4NLKA 5EOZA 3RJJA 4KLOA 9ICPA 5DKWA 8ICQA 1R8BA 3V72A 5J2JA 4XUSA 1ZQRA 4PHEA 2ISPA 2DR5A 4GXIA 4PHAA 4WC4A 2PFQA 7ICUA 4RQ1A 5TZVA 5J0OA 3HIYA 4WC7A 3PMNA 4KLTA 9ICKA 3WFOA 5HHHA 2ZH5A 9ICMA 1BPDA 1JQRA 4ATBA 1ZQYA 4AT7A 3C5FA 9ICLA 4YN4A 4X0AA 4UD5A 4RQ5A 2P66A 4QZ8A 4I2EA 5J2FA 3H37A 5D46A 4Z6DA 2ZH6A 3AQNA 5J2DA 1RPLA 8ICEA 3OV7A 1R89A 4TUPA 1ZQTA 3GDXA 8ICYA 3PNCA 4KLGA 4GXKA 4PGXA 2PFNA 2I9GA 3V7JA 9ICRA 7ICEA 1TV9A 4QZDA 3B0XA 1JAJA 5DB8A 4QZEA 8ICPA 4FH5A 4M2YA 4I2JA 5J29A 8ICZA 4RWOA 4X4NA 5IILA 1KEJA 3PMLA 8ICJA 1ZQFA 8ICGA 5IIKA 5DB7A 4RT3A 5HC9A 8ICTA 9ICVA 4KLIA 4EP7A 3RJFA 1JMSA 1R8CA 5F2VO 3TFRA 7ICMA 3WFRE 2BCVA 9ICJA 2GWSA 5J0UA 4RQ6A 4UBBA 8ICFA 4UB4A 4R64A 3OUYB 5BOMA 4Z6EA 3UXOA 5IIOA 5J2GA 1ZQZA 3WFPA 9ICQA 3HW8A 1NO5A 5HRIA 2M2VA 3JPOA 1Q78A 3OVAA 3C2KA 4F5RA 3RH4A 1UETA 4F5OA 4NY8A 3C2LA 4X4OA 1ZQPA 4RWPA 4QZCA 3JPNA 4UB1A 3AUOA 3MDAA 4M5DA 4JWMA 4MFCA 2M2TA 1WOTA 3HJ1A 1ZQNA 3H39A 5J2KA 5D49A 4Z6CA 1BPYA 4GXJA 4KLMA 4UAWA 4LVSA 9ICCA 7ICIA 2ZH1A 1R8AA 1KNYA 2ZH7A 5D4BA 4KLSA 1ZQBA 3JYYA 4MFFA 4P2HA 2ISOA 4FHPA 4NM2A 8ICIA 5J0RA 3OGUA 4DOAA 4FHVA 1MIWA 4I2DA 4AT9A 8ICOA 2NRKA 4WC6A 4O5CA 1ZQOA 4DOCA 4FO6A 1ZJNA 4FHXA 4M9NA 1MIVA 2O5AA 4RT2A 4AT8A 1ZQMA 4KLHA 8ICXA 2W9MA 9ICNA 4E80A 7ICPA 1MIYA 5J2IA 1ZQXA 4FHYA 1ZQKA 4QZGA 4LT6A 3AQLA 5CHGA 4X0BA 4RQ8A 4X4PA 3LK9A 2Q66A 3AQKA 5CA7A 4KLUA 1VFGA 7ICKA 8ICLA 3MBYA 8ICUA 3H38A 4RWQA 5HRLA 4I2GA 4I2CA 4F5NA 5IIIA 4EBJA 3UXNA 4FH3A 5J0XA 4XRHA 4MF8A 4ATBB 5HRHA 4AT7B 4IQTA 4MF2A 4WC3A 2DR9A 9ICFA 3LQCB 4O9MA 1ZQVA 4NXZA 4WC2A 4K4GA 8ICWA 3WFSC 4JWNA 5J0YA 1Q79A 4YMNA 4K4IA 4F5QA 1FA0A 4RQ2A 3AQMA 5CWRA 4DOBA 2BCQA 4EBKA 4R65A 2BPFA 8ICBA 1ZQAA 1ZQJA 5CP2A 2BCRA 4KLJA 2PFPA 3OVSA 2ZHBA 1ZQCA 1OU5A 2DVIA 1ZQLA 4PHPA 4YMOA 1ZJMA 3JPRA 3JPTA 5HREA 4RQ4A 3C2MA 3TFSA 4QZ9A 4R63A 1UEUA 3AU2A 4UAZA 4LZGA 4WC5A 5IINA 4X4TA 2DR8A 4I27A 4K4HA 1RZTA 7ICVA 5HRGA 2PXIA 5J0TA 4TUQA 4R66A 4E8FA 4X4RA 7ICOA 2PBEA 3WFQE 3RH6A 2BCUA 2FMQA 2BPGA 4NKUA 4PH5A 1JN3A 4NLZA 4PGQA 4WCWA 3HX0A 2BE3A 7ICLA 7ICHA 8ICVA 4UD4A 4YD1A 4UBCA 5DB6A 3AU6A 4NLNA 8ICHA 9ICTA 1HUZA 1ZQEA 4O5KA 4MFAA 1V4AA 5HHIA 5J2AA 2ZH9A 3RJKA 4IQWA 9ICEA 3HWTA 3ISBA 5J0WA 4M04A 2ZH8A 1XSNA 5DECA 1ZQQA 4RPXA 4KLFA 7ICQA 4M47A 5BOLA 4IQVA 1NOMA 4X4QA 3OVBA 9ICXA 3RJHA 5J2BA 4X5VA 3K75D 4RPZA 4AT9B 8ICNA 3RJGA 3HJ4A 1BPBA 4I2IA 4I2HA 8ICCA 3UPSA 4M9LA 5DBAA 4RQ3A 1BPXA 2O1PA 9ICHA 4KLQA 4X4SA 3JPQA 3MGIA 4M9GA 4UAYA 5HRFA 4AT8B 8ICMA 9ICWA 1PX5A 1ZQHA 8ICKA 3JZ0A 4X4VA 4F5PA 3JPSA 8ICAA 4P4OA 4I2BA 4I2FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZQD A;  3MDC A;  8ICS A;  4UB5 A;  9ICU A;  5BPC A;  7ICS A;  4X4U A;  7ICR A;  4NKT A;  4RQ0 A;  3V7K A;  3L9D A;  4UB2 A;  4RPY A;  5CR0 A;  1F5A A;  4IG8 A;  5DED A;  4PPX A;  5J2E A;  4M0A A;  8ICR A;  1HUO A;  9ICG A;  2DR7 A;  4I29 A;  3H3A A;  1ZQU A;  4KLL A;  1ZQI A;  4QZH A;  2M2U A;  9ICS A;  7ICJ A;  1TFY A;  2ID1 A;  4S3N A;  2FMP A;  7ICF A;  1ZQS A;  3UQ0 A;  5HR9 A;  7ICN A;  5HRB A;  5DB9 A;  3OUY A;  5J0S A;  3C66 A;  3UXP A;  2PFO A;  3B0Y A;  4RQ7 A;  5J2C A;  4QZI A;  3ISC A;  5CJ7 A;  9ICI A;  5DDM A;  1YLQ A;  4FHW A;  3NYB A;  4DO9 A;  1XSP A;  9ICB A;  5J2H A;  5J0Q A;  4O5E A;  3RH5 A;  2IHM A;  4XQ8 A;  4WC1 A;  3V7L A;  2BCS A;  2DRA A;  4IQU A;  1ZQW A;  1TVA A;  5J0P A;  4E7X A;  4RWN A;  4Z6F A;  2FMS A;  4M9H A;  3UPQ A;  4KLD A;  4YCX A;  5DDY A;  4QZB A;  3C5G A;  4M9J A;  3ISD A;  4WC0 A;  2ZH4 A;  1BPE A;  4XQ7 A;  2M2W A;  3JPP A;  4YMM A;  1VJ7 A;  3MGH A;  4UB3 A;  4XA5 A;  3UQ2 A;  2RFF A;  2VAN A;  1KDH A;  5CB1 A;  4I28 A;  9ICA A;  2ZH2 A;  4P4M A;  2ZH3 A;  1TFW A;  1UEV A;  5IIM A;  9ICO A;  4QZA A;  4PGY A;  1MQ2 A;  4WBZ A;  4LZD A;  4NM1 A;  4WBY A;  1MQ3 A;  2BPC A;  1ZQG A;  4YD2 A;  2ZHA A;  4TUR A;  3C18 A;  4QZF A;  1BPZ A;  4PHD A;  4P4P A;  7ICG A;  2DRB A;  4TUS A;  7ICT A;  4KLE A;  3RJE A;  5HRD A;  5DBB A;  1XSL A;  2HHP A;  5HRK A;  3RJI A;  5IIJ A;  4I2A A;  5DBC A;  4NLK A;  5EOZ A;  3RJJ A;  4KLO A;  9ICP A;  5DKW A;  8ICQ A;  1R8B A;  3V72 A;  5J2J A;  4XUS A;  1ZQR A;  4PHE A;  2ISP A;  2DR5 A;  4GXI A;  4PHA A;  4WC4 A;  2PFQ A;  7ICU A;  4RQ1 A;  5TZV A;  5J0O A;  3HIY A;  4WC7 A;  3PMN A;  4KLT A;  9ICK A;  3WFO A;  5HHH A;  2ZH5 A;  9ICM A;  1BPD A;  1JQR A;  4ATB A;  1ZQY A;  4AT7 A;  3C5F A;  9ICL A;  4YN4 A;  4X0A A;  4UD5 A;  4RQ5 A;  2P66 A;  4QZ8 A;  4I2E A;  5J2F A;  3H37 A;  5D46 A;  4Z6D A;  2ZH6 A;  3AQN A;  5J2D A;  1RPL A;  8ICE A;  3OV7 A;  1R89 A;  4TUP A;  1ZQT A;  3GDX A;  8ICY A;  3PNC A;  4KLG A;  4GXK A;  4PGX A;  2PFN A;  2I9G A;  3V7J A;  9ICR A;  7ICE A;  1TV9 A;  4QZD A;  3B0X A;  1JAJ A;  5DB8 A;  4QZE A;  8ICP A;  4FH5 A;  4M2Y A;  4I2J A;  5J29 A;  8ICZ A;  4RWO A;  4X4N A;  5IIL A;  1KEJ A;  3PML A;  8ICJ A;  1ZQF A;  8ICG A;  5IIK A;  5DB7 A;  4RT3 A;  5HC9 A;  8ICT A;  9ICV A;  4KLI A;  4EP7 A;  3RJF A;  1JMS A;  1R8C A;  5F2V O;  3TFR A;  7ICM A;  3WFR E;  2BCV A;  9ICJ A;  2GWS A;  5J0U A;  4RQ6 A;  4UBB A;  8ICF A;  4UB4 A;  4R64 A;  3OUY B;  5BOM A;  4Z6E A;  3UXO A;  5IIO A;  5J2G A;  1ZQZ A;  3WFP A;  9ICQ A;  3HW8 A;  1NO5 A;  5HRI A;  2M2V A;  3JPO A;  1Q78 A;  3OVA A;  3C2K A;  4F5R A;  3RH4 A;  1UET A;  4F5O A;  4NY8 A;  3C2L A;  4X4O A;  1ZQP A;  4RWP A;  4QZC A;  3JPN A;  4UB1 A;  3AUO A;  3MDA A;  4M5D A;  4JWM A;  4MFC A;  2M2T A;  1WOT A;  3HJ1 A;  1ZQN A;  3H39 A;  5J2K A;  5D49 A;  4Z6C A;  1BPY A;  4GXJ A;  4KLM A;  4UAW A;  4LVS A;  9ICC A;  7ICI A;  2ZH1 A;  1R8A A;  1KNY A;  2ZH7 A;  5D4B A;  4KLS A;  1ZQB A;  3JYY A;  4MFF A;  4P2H A;  2ISO A;  4FHP A;  4NM2 A;  8ICI A;  5J0R A;  3OGU A;  4DOA A;  4FHV A;  1MIW A;  4I2D A;  4AT9 A;  8ICO A;  2NRK A;  4WC6 A;  4O5C A;  1ZQO A;  4DOC A;  4FO6 A;  1ZJN A;  4FHX A;  4M9N A;  1MIV A;  2O5A A;  4RT2 A;  4AT8 A;  1ZQM A;  4KLH A;  8ICX A;  2W9M A;  9ICN A;  4E80 A;  7ICP A;  1MIY A;  5J2I A;  1ZQX A;  4FHY A;  1ZQK A;  4QZG A;  4LT6 A;  3AQL A;  5CHG A;  4X0B A;  4RQ8 A;  4X4P A;  3LK9 A;  2Q66 A;  3AQK A;  5CA7 A;  4KLU A;  1VFG A;  7ICK A;  8ICL A;  3MBY A;  8ICU A;  3H38 A;  4RWQ A;  5HRL A;  4I2G A;  4I2C A;  4F5N A;  5III A;  4EBJ A;  3UXN A;  4FH3 A;  5J0X A;  4XRH A;  4MF8 A;  4ATB B;  5HRH A;  4AT7 B;  4IQT A;  4MF2 A;  4WC3 A;  2DR9 A;  9ICF A;  3LQC B;  4O9M A;  1ZQV A;  4NXZ A;  4WC2 A;  4K4G A;  8ICW A;  3WFS C;  4JWN A;  5J0Y A;  1Q79 A;  4YMN A;  4K4I A;  4F5Q A;  1FA0 A;  4RQ2 A;  3AQM A;  5CWR A;  4DOB A;  2BCQ A;  4EBK A;  4R65 A;  2BPF A;  8ICB A;  1ZQA A;  1ZQJ A;  5CP2 A;  2BCR A;  4KLJ A;  2PFP A;  3OVS A;  2ZHB A;  1ZQC A;  1OU5 A;  2DVI A;  1ZQL A;  4PHP A;  4YMO A;  1ZJM A;  3JPR A;  3JPT A;  5HRE A;  4RQ4 A;  3C2M A;  3TFS A;  4QZ9 A;  4R63 A;  1UEU A;  3AU2 A;  4UAZ A;  4LZG A;  4WC5 A;  5IIN A;  4X4T A;  2DR8 A;  4I27 A;  4K4H A;  1RZT A;  7ICV A;  5HRG A;  2PXI A;  5J0T A;  4TUQ A;  4R66 A;  4E8F A;  4X4R A;  7ICO A;  2PBE A;  3WFQ E;  3RH6 A;  2BCU A;  2FMQ A;  2BPG A;  4NKU A;  4PH5 A;  1JN3 A;  4NLZ A;  4PGQ A;  4WCW A;  3HX0 A;  2BE3 A;  7ICL A;  7ICH A;  8ICV A;  4UD4 A;  4YD1 A;  4UBC A;  5DB6 A;  3AU6 A;  4NLN A;  8ICH A;  9ICT A;  1HUZ A;  1ZQE A;  4O5K A;  4MFA A;  1V4A A;  5HHI A;  5J2A A;  2ZH9 A;  3RJK A;  4IQW A;  9ICE A;  3HWT A;  3ISB A;  5J0W A;  4M04 A;  2ZH8 A;  1XSN A;  5DEC A;  1ZQQ A;  4RPX A;  4KLF A;  7ICQ A;  4M47 A;  5BOL A;  4IQV A;  1NOM A;  4X4Q A;  3OVB A;  9ICX A;  3RJH A;  5J2B A;  4X5V A;  3K75 D;  4RPZ A;  4AT9 B;  8ICN A;  3RJG A;  3HJ4 A;  1BPB A;  4I2I A;  4I2H A;  8ICC A;  3UPS A;  4M9L A;  5DBA A;  4RQ3 A;  1BPX A;  2O1P A;  9ICH A;  4KLQ A;  4X4S A;  3JPQ A;  3MGI A;  4M9G A;  4UAY A;  5HRF A;  4AT8 B;  8ICM A;  9ICW A;  1PX5 A;  1ZQH A;  8ICK A;  3JZ0 A;  4X4V A;  4F5P A;  3JPS A;  8ICA A;  4P4O A;  4I2B A;  4I2F A; 
#chains in the Genus database with same CATH topology
 4B7K A;  4DV1 B;  5BPC A;  4X4U A;  3SPJ A;  4UCR A;  5A2Q N;  2BSK A;  3L9D A;  4I0X B;  4RPY A;  5LP6 A;  2WLM A;  4YY3 O;  3JCF A;  1M4U A;  3CX5 F;  1G4Y B;  8ICR A;  1NU1 H;  1W59 A;  2BTO A;  1NJI W;  4MTG A;  1AB3 A;  3HKC A;  3H3A A;  1Q86 W;  4JI4 B;  4PDR A;  4NYK A;  1XNQ B;  2UXD O;  4LH6 A;  2PGG A;  4QZH A;  2GTA A;  2ILM A;  3PJS K;  2XAG A;  5LMU O;  4GKJ B;  3X2Q C;  2P06 A;  1FJG B;  4N21 A;  2FMP A;  4OAI Z;  2LFR A;  4DR4 O;  5J2T A;  2PFO A;  4DV0 O;  4MW8 A;  4CBC A;  3B0Y A;  4OAG A;  2AXT Z;  1K4D C;  1NTK H;  4HYO A;  2WWW A;  4X9Q A;  1TVK A;  2EJ7 A;  4CZZ A;  4WBN B;  3DSQ A;  4J7Z A;  1XSP A;  1VF7 A;  4PDV A;  2YEV B;  1NZ6 A;  2Q0O C;  4O5E A;  5JCO C;  2L35 A;  4WC1 A;  3V7L A;  4IQU A;  1ZQW A;  3FKS G;  1W2B U;  4RWN A;  4E7X A;  4R50 A;  3UKM A;  2QKA A;  4FPP A;  1V55 B;  2FML A;  2CAZ C;  4LNU A;  3FYE B;  4DV3 O;  5EC1 C;  2WA3 A;  3ISD A;  2IJI A;  3W7X A;  4WC0 A;  3FYI B;  3JPP A;  1SRY A;  3HPL C;  3UQ2 A;  5KLV H;  1OCC C;  4I28 A;  3ZN0 A;  2QKS A;  2F1M A;  5H6Q A;  4WOY A;  2UUC O;  1MQ2 A;  3MHH C;  3KCX A;  2WA4 A;  2PI5 A;  1ZQG A;  2ZHA A;  1BPZ A;  3HKB A;  4PHD A;  2ADQ B;  4K8V A;  4U7O A;  2UU9 B;  4FZ1 A;  7ICT A;  1L1F A;  1QU7 A;  3OD4 A;  1KUQ A;  5LYJ B;  1XHX A;  5BR8 O;  4JI5 O;  1XSL A;  5IWA O;  4DUZ B;  3RJI A;  1HWY A;  1ZL8 A;  2Y69 C;  1Z5V A;  1ENV A;  4WQL A;  5EOZ A;  1I08 A;  1P7B A;  4GKK B;  4KHP B;  4LR3 A;  5KHH A;  4XUS A;  4PHE A;  3PN1 A;  4GCZ A;  3CCJ V;  4WC4 A;  2PFQ A;  3ZMT A;  5TZV A;  5J0O A;  2YUA A;  3LSU A;  3QNE A;  1KMI Z;  2EX3 A;  4KLT A;  2AZ0 A;  4DR3 O;  2C2A A;  5FNV B;  1NKD A;  3CCM V;  2DYR B;  1W0J G;  2LW7 A;  2RQ6 A;  1G6U A;  4YJ3 B;  4ATB A;  4DR5 O;  3B8N A;  3AK1 A;  3BAB A;  4YN4 A;  2YDE A;  4UD5 A;  2R9R B;  4YIP A;  1OCO B;  4TUY A;  1AI5 A;  2D3O W;  5JJN B;  2VQE O;  5D46 A;  4X62 B;  3ZRX A;  4FJC C;  2Y4T A;  2G38 A;  3RYI A;  4DV6 B;  8ICE A;  4JGS A;  4JAU A;  4TUP A;  4LF9 B;  1YHQ V;  1GN3 A;  4UCU A;  4FZ0 A;  4JZ2 A;  5IYB O;  3BRC A;  9ICR A;  1G1X B;  2QTO A;  2BSK B;  3TGU H;  1S5J A;  1I0H A;  1XL6 A;  4MVM A;  5J29 A;  3MDS A;  1YF2 A;  2XAJ A;  4K98 A;  2AW9 A;  2CGO A;  1KEJ A;  4CH6 A;  4UCS A;  3AG7 A;  1EZV H;  2LQT A;  1ZSP A;  3HKC B;  5DB7 A;  1EBO A;  1QQC A;  5HC9 A;  1IVS A;  4UCV A;  4EP7 A;  3JCU Z;  3RJF A;  5F2V O;  2UXB B;  4JTC B;  3OW2 U;  9ICJ A;  1SQX H;  5J0U A;  5BOM A;  1MNG A;  5J2T B;  4RQE A;  2B5U A;  5J2G A;  1ZQZ A;  5EIB C;  1US6 A;  3A0B Z;  4H44 B;  5HFM A;  2Q9L A;  4HAM A;  3WFP A;  3VQV A;  5GTH Z;  4DYL A;  3ABU A;  1TVK B;  4FFK A;  3HW8 A;  1SQF A;  4X20 A;  5E1A C;  3JPO A;  4CS3 A;  4I4T A;  3OVA A;  2YIA A;  3RH4 A;  4LH7 A;  3U11 A;  4B3S B;  4UVC A;  2DQ3 A;  4N23 A;  1KKD A;  3JD1 A;  3OTF A;  3E8H A;  3G80 A;  4F6R A;  3JPN A;  2EIL C;  4JI6 B;  3MDA A;  1R3L C;  4QJF B;  1IXB A;  2AGA A;  1YCI A;  1WOT A;  3HJ1 A;  2ZR3 A;  5J2K A;  5D49 A;  1FPO A;  4Z6C A;  4K99 A;  4GXJ A;  1BPY A;  4AQY O;  2QDO A;  2QWQ B;  2FL4 A;  1WJZ A;  4IL6 Z;  4LNU B;  1N33 B;  1PV0 A;  1OZ0 A;  1CPY A;  2Q6A A;  3A2F A;  5EBW C;  5CA0 A;  2PF4 E;  3CE2 A;  4ZHQ A;  2XAF A;  2ISO A;  1MA1 A;  2NNU A;  2GV9 A;  3FB8 C;  3M7M X;  5J0R A;  3STZ C;  1V54 C;  8ICO A;  1GN6 A;  1GMG A;  1H2K A;  4WC6 A;  1JVM A;  2WPD G;  4EGW A;  4R8C A;  1N34 B;  1N36 B;  1Q90 D;  4JI3 B;  1BZK A;  3RYH A;  3HKB B;  3OGC C;  2WLJ A;  1K4C C;  4PA7 A;  4AT8 A;  2XOK G;  4QE7 A;  1MMM A;  3CYO A;  4QNH B;  4PDL A;  4RQF A;  2M6Y A;  5LMN O;  7ICP A;  5J2I A;  4MTO A;  3KZI Z;  4JI7 B;  4QZG A;  1ZQK A;  2OCC B;  4X8A A;  5IT9 N;  1JJ2 U;  1VF6 C;  3JD3 A;  3VQW A;  1KBH A;  4DV2 O;  4RWU A;  2Q66 A;  5L3G A;  2X6C A;  4WFB V;  3A8T A;  3MHS C;  1H8H G;  3NR7 A;  1EFR G;  2IJH A;  1F7Y A;  4JAS A;  2QEX V;  2XHB A;  1FFX B;  4I2G A;  3BCC H;  2GTS A;  1S77 D;  1XNR O;  2CE4 A;  2VWK A;  5J0X A;  5LXT A;  1KU9 A;  3B77 A;  3WG7 C;  5AG2 A;  4ATB B;  4MF8 A;  3EHB B;  1IBM B;  4IQT A;  4TQD A;  4WC3 A;  2H8P C;  4JLX A;  9ICF A;  1K3E A;  1NR1 A;  5H5N A;  3K57 A;  3K9A A;  5C8Y A;  2B51 A;  2DYS B;  4TUY B;  4JWN A;  5D5P A;  2IHO A;  1Q79 A;  2E76 B;  2DWE C;  4RQ2 A;  1ARO P;  5CBF A;  5CFT A;  3RYI B;  5CFS A;  1TAE A;  4Q6G A;  2A3Q A;  1XOU A;  2YXH A;  3K03 A;  1F4M A;  2PYJ A;  2BCR A;  3GVM A;  2ZHB A;  2IU3 A;  1VAR A;  1WAZ A;  1QLE B;  4K0K B;  2VQF O;  1R6T A;  2JGD A;  3HR0 A;  3JPR A;  3JPT A;  4KUM A;  5HRE A;  1D5A A;  2V7Q G;  1UEU A;  2CK3 G;  4LZG A;  2B1G A;  5IIN A;  2PTM A;  4K4H A;  7ICV A;  5HRG A;  2P5O A;  1MG1 A;  4X4R A;  4OX9 B;  1O9H A;  3RH6 A;  4O4L A;  2BPG A;  1B06 A;  4Z2W A;  1XRE A;  4EFB A;  4WCW A;  3KCY A;  2KG7 A;  2N74 A;  5LP6 C;  3CCL V;  3CPW U;  1L0N H;  1Q6H A;  2Y0P A;  4I4T B;  4YD1 A;  1XQ8 A;  2M7W A;  4NLN A;  1RM1 B;  2R9I A;  1XMQ O;  2E74 B;  4F6R B;  4FLW A;  3RVY A;  5J2U B;  5J2A A;  3SR2 C;  2V4D A;  3SYC A;  4M04 A;  3GWO A;  4O2B B;  5IY5 C;  2UUA B;  2OTJ V;  2MW2 B;  5DEC A;  1M5I A;  4YIO A;  2IM9 A;  4KLF A;  4DUY O;  3JD2 A;  1NVP B;  4JAV A;  5CA0 B;  4GX0 A;  5LBQ A;  1G8M A;  4X4Q A;  4ZHQ B;  2RJZ A;  3T1H B;  3WFV A;  5CBH A;  5CA1 A;  3JAS A;  2ZQM A;  5CN0 A;  2P90 A;  3K75 D;  8ICN A;  3B40 A;  2PZS A;  3NWI A;  4CS2 A;  1WLE A;  3T1Y B;  1H2N A;  2AHZ A;  4J11 A;  4LEZ A;  2HJF C;  3E83 A;  1NBM G;  3GB7 C;  4OPA A;  1S72 V;  4K97 A;  1S5H C;  4X4S A;  1WPX A;  3RYH B;  3HB3 B;  3AEI A;  1MZE A;  3SYO A;  4DR1 B;  4AT8 B;  4WFE A;  8ICM A;  4FLX A;  4R7C A;  3OUS A;  8ICK A;  3JD4 A;  1VQP V;  3AG3 C;  1HNW O;  4LWS A;  1Q81 W;  1KD1 W;  5FL7 G;  3WB1 A;  4YY3 B;  1XIL A;  3E22 B;  3TCU A;  4K9A A;  4DR6 O;  3NVO A;  1PM9 A;  3FB7 C;  5EBL C;  2BOB C;  5J9P C;  9ICU A;  3CB2 A;  7ICS A;  7ICR A;  1AJQ A;  4QGP A;  1SQP H;  2D2C B;  4NKT A;  1V9P A;  3V7K A;  5CR0 A;  3R66 A;  2UXD B;  2A06 H;  5LMU B;  2EIM C;  5D62 A;  4CC6 A;  5J2E A;  4M0A A;  1AIL A;  2JIZ G;  9ICG A;  2DR7 A;  1SA0 A;  5LXT B;  4JPR A;  4DR4 B;  3IGA C;  4LF4 O;  2ZDI C;  4YHH O;  4ZIB A;  2CTP A;  4P30 A;  1TFY A;  2LFS A;  2R72 A;  3ABL C;  3OWG A;  2JS5 A;  4LCU C;  5B66 Z;  5C8Y B;  7ICN A;  5HRB A;  1GRJ A;  1GM8 A;  1F51 A;  3C66 A;  4RQ7 A;  4QZI A;  4GUN A;  3ISC A;  5LL6 Y;  2EIJ C;  3P30 A;  3ZIA G;  4NXN O;  4DO9 A;  4JV5 O;  5J2H A;  4KXR A;  2YID A;  4QIW F;  4KB6 A;  4WQK A;  4XQ8 A;  2E75 B;  2DRA A;  3HKE A;  3K5N A;  1VF6 A;  2Y69 B;  4TV8 B;  2ZCE A;  4CH3 A;  3CC4 V;  1WP8 A;  2Q5Z A;  2JGD B;  1KP2 A;  2OTL V;  4DR2 O;  4YCX A;  2DYS C;  1Y6X A;  2EUL A;  4QZB A;  3BPZ A;  3RVZ A;  1EN4 A;  4UB8 Z;  4BWA A;  4M9J A;  2K9P A;  2ITC C;  4LF8 O;  3SYP A;  2Y48 A;  4J7J A;  1IBL O;  4XQ7 A;  2M2W A;  5TIS Z;  4YMM A;  1ZTE A;  3OMI B;  4X65 O;  9ICA A;  1VQO V;  1URF A;  1Q6U A;  3AG2 C;  2ZH2 A;  1TGO A;  4O4L B;  4CH4 A;  3ZJZ A;  3JSN A;  1VEW A;  4D6T H;  1WN7 A;  9ICO A;  4WBZ A;  4XDK A;  4MVR A;  4TSF G;  2CTW A;  4MW3 A;  2GBO A;  2KG7 B;  4NM1 A;  1JPX A;  3JYC A;  1MQ3 A;  5BR8 B;  4JI5 B;  3C18 A;  4QZF A;  1I94 O;  1HDJ A;  4BIZ A;  4FM1 A;  1K7D A;  4BIU A;  2FYU H;  4DV4 O;  2HLD G;  4I2A A;  5DBC A;  3N2K A;  4NLK A;  3K0D A;  2ATK C;  5LHI A;  4DR3 B;  5DKW A;  1P49 A;  1TUB A;  4LC1 A;  5J2J A;  5JTG A;  3DXR A;  4TT3 G;  2P7T C;  4PHA A;  4DR5 B;  7ICU A;  5CA1 B;  1XDC A;  2ZIM A;  1H2L A;  4WC7 A;  3PMN A;  3JAS B;  1FKA O;  2ZM6 O;  4B7E A;  4O6A A;  4K9B A;  2ZH5 A;  5EK0 A;  2KKW A;  5B1A B;  3BFR A;  1JQR A;  4DK1 A;  1RM1 C;  2VQE B;  3UT5 A;  4KFM A;  9ICL A;  3QO7 A;  1ROP A;  5H9C A;  2QA4 V;  1NVP D;  1D2D A;  3G71 V;  4RQ5 A;  3O9O A;  1J95 A;  2Q0A A;  5K1P A;  4G2K A;  3WU2 Z;  3ABT A;  4X1Y A;  5J2F A;  3H37 A;  4LF6 O;  3W7U A;  1I7F A;  1DGS A;  5J2D A;  1WB8 A;  4FFB A;  3FAV A;  1RPL A;  1QCE A;  1R89 A;  2JEU A;  3H1K H;  4LWS B;  1VQ8 V;  3ZMS A;  5CFU A;  2EIL B;  3V7J A;  1LR1 A;  3B0X A;  5L3E A;  2OIG A;  2PUS A;  3K7D A;  5LOV B;  1N0J A;  3RYC A;  3EFF K;  4IT5 A;  1DF5 A;  4TV9 A;  3G4S V;  1MSW D;  4I2J A;  1M57 C;  2IW5 A;  5JWP A;  2DW4 A;  3CEI A;  5IIL A;  4NXM O;  1CP9 A;  3C3S A;  5GON A;  4XBF A;  1SA0 B;  1IBK O;  4RAI A;  2EIN B;  3LDC A;  1V54 B;  3ASO B;  4KLI A;  2Q73 A;  1JMS A;  1R8C A;  3TFR A;  7ICM A;  2DN9 A;  3CCV V;  2QKC A;  3TET A;  2GWS A;  4LF5 B;  2V1D A;  3FFQ A;  2QWN B;  1CEZ A;  1KQS U;  4J41 A;  1S76 D;  1FXV A;  4JI0 O;  4N7R A;  1BMF G;  3D8C A;  4BAY A;  1SQQ H;  4X66 B;  5FPR A;  5HRI A;  2HVK C;  3C2K A;  4F5R A;  2BBH A;  2Q4P A;  4P2Z A;  4PI2 A;  3D36 C;  4B3T O;  4NY8 A;  1IX9 A;  3RWR D;  3K58 A;  4RWP A;  4QZC A;  2RCV A;  1R6N A;  2X6A A;  3HKE B;  1S5L Z;  4M5D A;  4MFC A;  4PD4 F;  2M2T A;  4JYB A;  4MVQ A;  1U96 A;  3I56 V;  1AR4 A;  3H39 A;  3ZHV A;  4H37 A;  3L73 H;  4KLM A;  2XAH A;  9ICC A;  7ICI A;  2GA9 D;  3ABM C;  4GLX A;  2ZH7 A;  4GT1 A;  5KHK A;  3ERC C;  5LGN A;  1NS1 A;  1BS3 A;  3JAW A;  2PYL A;  2GSM B;  3CJH A;  1AP5 A;  3WG7 B;  5EBM C;  3K5O A;  1UFI A;  3OGU A;  4DOA A;  2ZDI A;  2AZ2 A;  1MIW A;  2DQ0 A;  4AT9 A;  3CRC A;  4O5C A;  2CTQ A;  1ZQO A;  1ZJN A;  1XEQ A;  2QR4 A;  5GTI Z;  4M9N A;  1MIV A;  5LMN B;  2RNB A;  2B56 A;  1P84 F;  2LP7 A;  1ZQM A;  3DC5 A;  4DV2 B;  2A9H A;  4E80 A;  1AJP A;  2ZXW C;  2PY5 A;  1VP7 A;  4FHY A;  3AG1 B;  1NH2 B;  1R3J C;  5CHG A;  4X0B A;  4X4P A;  3N2K B;  4CC5 A;  3RYF A;  3CRM A;  1GM9 A;  1TUB B;  1XNR B;  4W4L A;  1Y66 A;  4TOI A;  1JR9 A;  3DXR B;  2L6L A;  3K5L A;  8ICL A;  4ZKI A;  4A5U B;  2QM8 A;  2JJ1 G;  2ZE8 A;  3H38 A;  4RWQ A;  5HRL A;  1K97 A;  4F5N A;  5III A;  3UXN A;  4FH3 A;  1GPJ A;  3OT7 A;  1OCZ C;  2KQX A;  1XBL A;  4B08 A;  4LFC O;  5HRH A;  4I7Z B;  4JI8 O;  3UT5 B;  3CSX A;  2Y4U A;  2RN9 A;  4U3J A;  4DV7 O;  1MSD A;  2DR9 A;  1YTF B;  2KB1 A;  4O9M A;  4NXZ A;  3CP1 A;  2YC0 A;  2EZP A;  4X1Y B;  5LP6 B;  4WFF A;  4F5Q A;  3LUT B;  4UUJ C;  5CWR A;  4DOB A;  4FFB B;  3FAV B;  3TXS A;  2BCQ A;  4GZR B;  4BW9 A;  3MAQ A;  3CCE V;  3KKY A;  3AK2 A;  2VQF B;  1Q8I A;  1ZQJ A;  3DC6 A;  2A79 B;  3APO A;  3QTC A;  1QVG U;  5CP2 A;  5EIB D;  4KLJ A;  3OVS A;  5B1A C;  2ZNJ A;  1XI1 A;  2Q69 A;  3OUF A;  5IJ0 A;  5IY5 B;  3RYC B;  4PHP A;  4D7S A;  1JOY A;  4TV9 B;  4YMO A;  3F5W C;  4JI4 O;  3UCS C;  1XNQ O;  3UM7 A;  3C2M A;  3J7A U;  2OT5 A;  4GKJ O;  4UAZ A;  4X4T A;  1Q43 A;  4GX2 A;  5GON B;  1DLB A;  2JVD A;  1RZT A;  1Y74 A;  4H0L B;  4TUQ A;  1QLN A;  4R66 A;  4WFG A;  1HNX O;  4E8F A;  7ICO A;  3NXS A;  2FTK A;  2FMQ A;  2FKX A;  4EKW A;  3SYA A;  1Y76 A;  1B6Q A;  1XMQ B;  3IC9 A;  1N8R W;  3FD9 A;  7ICH A;  2QE7 G;  2Q7G A;  1QR9 A;  4J42 A;  1UPG A;  3AU6 A;  3AG3 B;  2DE0 X;  1ZQE A;  4O5K A;  2EIN C;  3ASO C;  2HVJ C;  3GWK C;  2ODM A;  3ER9 B;  2ZH9 A;  3RJK A;  4IQW A;  9ICE A;  3HWT A;  3ISB A;  2GUZ A;  2ZH8 A;  5CB4 A;  3WB2 A;  1ZQQ A;  7ICQ A;  1N32 O;  2ZE6 A;  4M47 A;  2LO1 A;  4X89 A;  3G6B A;  3B8M A;  2EIM B;  9ICX A;  3JAW B;  5EZY A;  2JJ2 G;  3CJH B;  1YI2 V;  2GHY A;  1VQ9 V;  5J2B A;  3AK3 A;  5L3B A;  3KG2 A;  4AT9 B;  3RJG A;  2WLL A;  3ABL B;  1X59 A;  3ZN1 A;  1ZL8 B;  3TJT A;  5DBA A;  7ICG A;  2O1P A;  3JAK A;  4KLQ A;  4JYA B;  4W4K A;  1JQ0 A;  4M9G A;  1HNW B;  2BBJ A;  2QM7 A;  3OEE G;  1EN5 A;  5HRF A;  3BVO A;  3T4Z A;  1Q6I A;  3I55 V;  2EIJ B;  2GDS A;  1SZX A;  4DR6 B;  4UVB A;  1PX5 A;  5LGT A;  5B1N A;  4AIL C;  1ZQH A;  3D36 A;  1K73 W;  3JZ0 A;  1GM7 A;  4F5P A;  3JPS A;  5BMV A;  3IAY A;  4RUE A;  1MOF A;  4I2F A;  1ZQD A;  8ICS A;  4JI1 O;  4UB5 A;  3RYF B;  5LGU A;  2QWP B;  4RQ0 A;  5IE9 A;  4LF4 B;  4YHH B;  3ABK C;  3E8G A;  3M99 B;  1FXH A;  4IG8 A;  5DED A;  1O9G A;  1H2M A;  1SZT A;  1HUO A;  1NH2 D;  2WAM A;  1SES A;  3BHP A;  3CRQ A;  3AG2 B;  5L3D A;  1A32 A;  4KLL A;  4PI0 A;  1VF5 B;  4U3J B;  4O4H A;  7ICJ A;  4DV6 O;  1OCR C;  2ID1 A;  3AG1 C;  4NTX A;  4PHZ A;  1ZQS A;  3UQ0 A;  5HR9 A;  3OUY A;  5DB9 A;  4JV5 B;  5J0S A;  1RPR A;  3FB5 C;  3QG5 A;  5J2C A;  5DDM A;  2QSA A;  1KP3 A;  1PL4 A;  2R9A A;  3LSS A;  4MVS A;  4FLY A;  1FAF A;  3NYB A;  1KYO F;  4K8Z A;  1EM1 A;  1FYJ A;  9ICB A;  1YTF D;  3ZHQ A;  2Z5U A;  3SYQ A;  4DR2 B;  2IHM A;  2BCS A;  2YI8 A;  4HNA A;  4IIJ A;  2CUG A;  4LF8 B;  1VQN V;  2FMS A;  5H6R A;  1IBL B;  4M9H A;  4KLD A;  5DN6 G;  2H94 A;  1PNM A;  4X65 B;  2ZR2 A;  3S3W A;  3SPI A;  3E8B A;  4X20 B;  1Y74 B;  3RGB A;  2EIK C;  1HNZ O;  1BPE A;  5KA5 A;  3ETE A;  1PD3 A;  4NB5 A;  1VJ7 A;  4UB3 A;  2RFF A;  4UB6 Z;  3ZX6 A;  1YIT V;  5CB1 A;  2Q7H A;  5EYP A;  1R6K A;  1DF4 A;  2EWR A;  1AI6 A;  3SPC A;  3A0R A;  3UO3 A;  1I94 B;  3LNN A;  4EED A;  5IIM A;  3JAL A;  4PGY A;  1Y76 B;  2IH3 C;  3IFX A;  2HN1 A;  1TA8 A;  1BGY H;  4UV9 A;  3JSL A;  4WBY A;  2Z3Y A;  4GX5 A;  4YD2 A;  3LSQ A;  1DK1 A;  4O69 A;  1Q3E A;  4DV4 B;  3K08 A;  1VQ7 V;  3RJE A;  3J80 N;  2NR5 A;  4FMT A;  2E5L O;  5HRD A;  3CK6 A;  1SF9 A;  1Q7Y W;  4HX0 A;  4EEQ A;  1K5S A;  4RO2 A;  2GUZ B;  1VQK V;  5IIJ A;  5CB4 B;  1ZX3 A;  4TQF A;  9ICP A;  1M57 B;  3B2E E;  2ZNI A;  4OAF A;  2ZM6 B;  8ICQ A;  3V72 A;  1BQZ A;  3RW0 A;  2Q8V A;  1ZQR A;  2DR5 A;  4GXI A;  2H3O A;  4JYC A;  2UXC O;  1N34 O;  3HIY A;  3LDD A;  1N36 O;  4BIO A;  3SJB C;  3WFO A;  5HHH A;  1JA8 A;  5IJ9 A;  2WLL B;  4NXV A;  1BPD A;  1ZQY A;  4LF6 B;  4AT7 A;  3OEH G;  1YZB A;  3ZMU A;  4DV5 O;  4LFA O;  3JAK B;  1VIB A;  4NTW A;  5IYZ A;  1SER A;  4KP4 A;  4FLT A;  2ZH6 A;  3RN4 A;  3AQN A;  2AHY A;  2WLI A;  2Z0A A;  3OV7 A;  3GDX A;  3ZED A;  3BEH A;  1S3J A;  2F95 B;  4PA3 A;  4DV0 B;  4GXK A;  2IUB A;  4PGX A;  1Z2G A;  2I9G A;  2FCL A;  2LGW A;  7ICE A;  1TV9 A;  4F6E A;  2XT9 A;  2P67 A;  4P9O A;  4NXM B;  1OJH A;  3IJ4 A;  4DK0 A;  8ICP A;  3QO5 A;  1YSC A;  1IBK B;  4B3R O;  4DR7 O;  1YJ9 V;  4M2Y A;  3VBB A;  3ABM B;  4J7K A;  4QE9 A;  8ICZ A;  4RWO A;  4X4N A;  1E1Q G;  4MKP A;  5K1X A;  3PML A;  5B3S C;  4WBN A;  1NQT A;  5IIK A;  1LUV A;  2Y0I A;  8ICT A;  2YEV A;  1Z5W A;  9ICV A;  4O4H B;  4JI0 B;  3WFR E;  2F23 A;  2YS8 A;  2DOS A;  4RQ6 A;  4UBB A;  1X4T A;  4DV3 B;  4R64 A;  5EC2 C;  4JI2 O;  3OUY B;  1XHZ A;  1N4C A;  2EZO A;  5IIO A;  1AI7 A;  2KSD A;  1BL8 A;  3O65 A;  4B3T B;  9ICQ A;  4X64 O;  4K35 A;  3CXH F;  2BCC H;  3CME V;  4FM0 A;  4K0K O;  2JK5 C;  1Q78 A;  1BE3 H;  1RP3 B;  1UET A;  1RSO A;  3G6E V;  4F5O A;  2IH1 C;  2UUC B;  3C2L A;  2ZXW B;  4X4O A;  3ZRW A;  4HNA B;  4K8X A;  3HKD A;  3CD6 V;  2LJ2 A;  3AUO A;  4JWM A;  2O57 A;  3ETQ A;  5GW7 A;  1ZQN A;  3RBZ A;  1SC5 B;  2R70 A;  2UUB O;  1KEC A;  2XTA A;  2ZH1 A;  1QBZ A;  1QHT A;  1R8A A;  1KNY A;  5IWA B;  3K5M A;  2XUM A;  8ICI A;  1GK9 A;  3Q4H A;  1OCZ B;  5EYP B;  5CMU A;  5IDJ A;  5BXZ A;  4FHV A;  4I2D A;  1PP9 H;  2NRK A;  3JAL B;  3CC2 V;  3CHX A;  5ITZ A;  2Q67 A;  4DOC A;  4FO6 A;  4FHX A;  3BY6 A;  2O5A A;  1ZLZ A;  1I5X A;  1NTM H;  3QO8 A;  3K04 A;  4UXN A;  2JDI G;  4U3F H;  1K33 A;  4H13 B;  1H2G A;  1YXB A;  3U0Z A;  4JYY A;  2XAS A;  1ZQX A;  3P32 A;  2A0L A;  1FD9 A;  1HR0 O;  3AQL A;  3IC7 A;  1IXM A;  4J9Z B;  4RQ8 A;  2DWD C;  1AP6 A;  5LHG A;  3K06 A;  1W0K G;  7ICK A;  4LFC B;  4JI8 B;  8ICU A;  1OV9 A;  4OPH A;  1DTO A;  4I2C A;  3P3N A;  4EBJ A;  3BA9 A;  5IJ9 B;  4MTF A;  4XRH A;  1NTZ H;  4AT7 B;  4MF2 A;  2CH7 A;  3ASN C;  1ZQV A;  5IYZ B;  3VQX A;  8ICW A;  5J0Y A;  4K4I A;  3W7S A;  2WLI B;  4QPJ A;  4EBK A;  3OTO O;  4MS2 A;  3EF2 A;  1YDX A;  1M93 A;  8ICB A;  2ZKO A;  1K8A W;  5IYD O;  3THO A;  4K96 A;  5JQG A;  4I50 A;  1ZQC A;  1OU5 A;  4ASU G;  2YXL A;  1HP8 A;  4HZ3 A;  2DVI A;  1XMO O;  4G28 B;  5BZB A;  3CCR V;  1ZJM A;  4P9P A;  4ZI7 A;  1S0V A;  3ZHS A;  1GAX A;  4QZ9 A;  4R63 A;  3AU2 A;  2WLN A;  1HNX B;  3VQY A;  1E79 G;  5DM6 V;  3D3Q A;  2OCH A;  2DR8 A;  2WSS G;  3AG4 C;  4GX1 A;  4E2L A;  5KUK A;  2VWJ A;  3ZRS A;  2B1I A;  3SPH A;  3H1H H;  4AQY B;  1FXK A;  3L75 H;  2PBE A;  3DGE A;  2BCU A;  5D63 A;  2F43 G;  4LFB O;  4LP8 A;  4NKU A;  2DJV A;  4PH5 A;  4I55 A;  3L74 H;  4PGQ A;  2HP8 A;  2P4V A;  1EZJ A;  1LUW A;  5D61 A;  2WLH A;  4JTA B;  7ICL A;  3H01 A;  8ICV A;  2CDY A;  4UD4 A;  4UBC A;  3SJA C;  2BTQ A;  4EB6 A;  1RSO B;  3JAT A;  4UVA A;  4Q20 A;  4UFZ A;  1WA8 A;  8ICH A;  3S3X A;  3ZRW B;  1J5E O;  1GTO A;  2B4V A;  3HKD B;  4MFA A;  1V4A A;  4MSW C;  1N32 B;  1BSM A;  5HHI A;  1AR1 B;  1VQ5 V;  4O67 A;  4O68 A;  4WH5 A;  5J0W A;  4DO2 A;  2IU0 A;  4FVM A;  2QWR B;  1BT8 A;  5KA6 A;  5B3Q A;  2OIE A;  3ABK B;  4RPX A;  4LF7 O;  5BOL A;  1NOM A;  1R1B A;  4B3M O;  1GKF A;  3OVB A;  2HHH O;  3RJH A;  4IGG A;  3LDE A;  3Q4H B;  3K0G A;  4X5V A;  4LEY A;  4O2A A;  1M90 W;  3TXQ A;  2EJR A;  4RPZ A;  2CGN A;  5H2F Z;  1OCR B;  5KUM A;  4I2I A;  4I5S A;  2ITD C;  3MCR A;  5ITZ B;  4I2H A;  4XJE A;  2QJ1 A;  3ZRV A;  3UPS A;  4M9L A;  3SJC C;  3CCS V;  1BPX A;  1Q82 W;  3WB0 A;  1OHH G;  5CBG A;  3JPQ A;  4J10 A;  4BR6 A;  4UAY A;  1FFX A;  4ABM A;  1ZWI C;  2RMK B;  9ICW A;  1K9M W;  2F4V O;  2F66 C;  3G67 A;  4JI1 B;  1JCH A;  1YVW A;  4HBN A;  4JF3 A;  3FX7 A;  4X4V A;  5D5Q A;  4LEW A;  4FIP C;  8ICA A;  3APQ A;  1NR7 A;  4OAH A;  3RFR A;  5E79 Z;  3TK1 A;  2YIB A;  3OMA B;  4K3A A;  3MDC A;  4L87 A;  1K92 A;  5KHG A;  1JMK C;  5KMG A;  2P4K A;  1KB9 F;  4UB2 A;  1VQM V;  4WF9 V;  1F5A A;  3QVN A;  1FS0 G;  4FK5 C;  2LGQ A;  3OM3 B;  1YJW V;  1CXZ B;  5KX5 A;  4PPX A;  3OAA G;  2EIK B;  4DV1 O;  4NXU A;  1XL4 A;  4MVO A;  4I29 A;  4TWK A;  5C93 A;  5B1O A;  4FLV A;  1ZQU A;  2CH7 B;  1ZQI A;  4X1K A;  5CA3 A;  1Q5O A;  2M2U A;  9ICS A;  1JX9 A;  2YI9 A;  4S3N A;  7ICF A;  2ZIO A;  1H2S B;  5LA6 A;  4ICG A;  3UXP A;  3PHZ A;  1QR8 A;  4NVP A;  2QWO B;  4IYI A;  3K59 A;  5CJ7 A;  9ICI A;  2OYQ A;  1YLQ A;  4FHW A;  1FJG O;  4UV8 A;  4I0U A;  4KL1 A;  3W7W A;  4J80 A;  5KHI A;  5J0Q A;  3RH5 A;  5B1B B;  5JQG B;  4I50 B;  4Z1V A;  2Q68 A;  2W0F C;  2X0L A;  1TVA A;  1ZAU A;  2F93 B;  3L71 H;  3OMN B;  5J0P A;  4Z6F A;  4ZI7 B;  1HNZ B;  3UPQ A;  2W6J G;  1ZUQ A;  5HFL A;  2EBO A;  4QPK A;  3ZBH A;  5LHH A;  5DDY A;  4NTY A;  3F7V C;  3C5G A;  4LF5 O;  4ZOL A;  1NI8 A;  4YXW G;  5B5E Z;  3JAR A;  3I5D A;  2ZH4 A;  3MGH A;  4XA5 A;  1BHB A;  2VAN A;  1SQG A;  3BA8 A;  2GAF D;  3OGI B;  1FXK B;  2ZT9 B;  4WCE V;  2N04 A;  1KDH A;  4PJ0 Z;  4P4M A;  4X66 O;  2ZH3 A;  4DUY B;  1H38 A;  5J2U A;  1TFW A;  1UEV A;  1VQL V;  1SS3 A;  4I55 B;  2XND G;  4QZA A;  3A0H Z;  1KKC A;  2P6J A;  2XAQ A;  4NR1 A;  4O2B A;  4XDL A;  4E4E A;  3EVK A;  3ZHT A;  3T4D A;  1L8D A;  2E5L B;  2OWO A;  4LZD A;  2BPC A;  2MK3 A;  1SQV H;  4TUR A;  1IUR A;  1PPJ H;  1WPB A;  2BTQ B;  4EB6 B;  3ZHU A;  3CXC U;  3JAT B;  3CC7 V;  4IHJ A;  4P4P A;  4TUS A;  2HG5 C;  1WA8 B;  3LNM B;  4WFH A;  2DRB A;  4KLE A;  1AJN A;  5DBB A;  2HHP A;  5HRK A;  2IJJ A;  2K1E A;  2UU9 O;  1RPO A;  2UXC B;  5L3F A;  3ICX A;  3RJJ A;  4KLO A;  1R8B A;  4RUF A;  3ZCC A;  4DUZ O;  4O4I A;  1V55 C;  4YJ2 A;  2ISP A;  1VQ6 V;  4DV5 B;  5B3S B;  3U10 A;  4LFA B;  4RQ1 A;  4I9W A;  5FLX N;  4O2A B;  4PDM A;  9ICK A;  4XDJ A;  5JCO A;  4GKK O;  4FLZ A;  4KHP O;  3H1I H;  3OR6 C;  9ICM A;  2Q7E A;  1WNS A;  4UCO A;  3E22 A;  3C5F A;  2VS0 A;  4X0A A;  5L3C A;  1AR5 A;  4AI8 A;  3F7Y C;  2P66 A;  3NKU A;  4QZ8 A;  4I2E A;  4Z6D A;  3K3W A;  3JAM N;  3K79 A;  3CWB H;  1JFF A;  4KM5 A;  1ZQT A;  2WLK A;  1T5E A;  4B3R B;  2W0X A;  8ICY A;  2E3C A;  1BCC H;  4DR7 B;  3PNC A;  4KLG A;  3ZMV A;  1U97 A;  4GYC B;  2PFN A;  4X62 O;  2IBZ H;  2DMX A;  4QZD A;  3ER8 C;  3ETG A;  3OFN G;  3QF7 A;  4UCT A;  3T2M A;  1JAJ A;  5DB8 A;  4QZE A;  5KMG B;  4LF9 O;  4NXN B;  4FH5 A;  4F4L A;  1LNQ A;  3L70 H;  4X1I A;  4NXT A;  1JJO A;  4PEL A;  5KX5 B;  4JAA A;  5JVD A;  3N2G A;  8ICJ A;  1YEW A;  1ZQF A;  8ICG A;  4JI2 B;  3H9V A;  4RT3 A;  5KHJ A;  3CCQ V;  4X1K B;  4CH5 A;  1GN2 A;  4O4J A;  4X64 B;  2UXX A;  2BCV A;  2DYR C;  3W7T A;  3T1C A;  1D5N A;  4TV8 A;  5JJE B;  8ICF A;  5IJ0 B;  4UB4 A;  2UXN A;  3SPG A;  4Z6E A;  5LA6 B;  3UXO A;  1VMG A;  2HN2 A;  2HJD A;  4NKG B;  2UXB O;  1OCO C;  4X88 A;  3M8A A;  4H33 A;  1NO5 A;  4DW1 A;  4MTX A;  2M2V A;  1P7G A;  2X7R B;  1GN4 A;  3SJQ C;  3OR7 C;  1IDS A;  4FM2 A;  1Y4M A;  2ZE7 A;  1ZQP A;  3R65 A;  2QM4 A;  2UUB B;  4DRX A;  4UB1 A;  5B3P A;  1N0N A;  4JZG A;  3C90 A;  4NXW A;  3FB6 C;  3K9S A;  4B3S O;  1F4N A;  4UAW A;  4LVS A;  3ETD A;  3JCZ A;  5BY1 A;  3ML0 A;  1SKV A;  1M56 B;  1YIJ V;  4JI6 O;  4ZOL B;  1YJN V;  5D4B A;  3JD0 A;  4KLS A;  3UQ8 A;  1ZQB A;  3JYY A;  4MFF A;  3JAR B;  4P2H A;  5FPO A;  4JTD B;  1BHA A;  3H1J H;  4FHP A;  5JH7 A;  1TUE B;  3E89 A;  4NM2 A;  2B9Z A;  1HW7 A;  1N33 O;  3CCU V;  2NN4 A;  3ASN B;  3F5T A;  5B1B C;  4DXW A;  4Z1M G;  1COW G;  2ZD9 A;  4PA6 A;  3CS5 A;  3STL C;  2NLJ C;  2HKO A;  3BAA A;  3SDL A;  4IYH A;  4RT2 A;  3RT3 C;  4R6Z A;  2IJK A;  2YIC A;  3E8F A;  4AHC A;  1GH6 A;  4G27 B;  2VRZ A;  1HR0 B;  4IHJ B;  5EZY B;  4KLH A;  1EN6 A;  4LBE C;  3UO2 A;  8ICX A;  4OXS A;  1M1K W;  2W9M A;  9ICN A;  1Y67 A;  4EEB A;  3B09 A;  4MVZ A;  4JI3 O;  1MIY A;  3CRA A;  3X2Q B;  1B3Q A;  4DW0 A;  1FXK C;  1AVM A;  4LT6 A;  1GO3 F;  1BQ0 A;  1P4R A;  1NT2 B;  2QGN A;  3LK9 A;  3AQK A;  5CA7 A;  4KLU A;  1VFG A;  3ZHR A;  3D3I A;  1WB7 A;  4I0X A;  4O4I B;  4YJ2 B;  4JI7 O;  3J81 N;  3MBY A;  5IYC O;  3AG4 B;  2X6B A;  1FFT B;  2YSU B;  4JYA O;  3N27 A;  3ZMZ A;  4MT8 A;  2YXY A;  1AI4 A;  3OE7 G;  2ZIN A;  5BMV B;  1ORQ C;  4ZBM A;  2RDC A;  1R3K C;  3H1L H;  1SET A;  1RFY A;  3DTU B;  3LQC B;  1PNK A;  2HFE C;  2HEP A;  1WP7 A;  5LOV A;  3OTO B;  1SQB H;  4WC2 A;  2ETN A;  4K4G A;  4CS4 A;  3WFS C;  4YMN A;  1M9N A;  1IBM O;  1UJW B;  2ARH A;  3VOU A;  1FA0 A;  3AQM A;  4NXX A;  1JFF B;  4R65 A;  1H8E G;  1XMO B;  2BPF A;  1OCC B;  4OGQ B;  1IZ3 A;  2P22 C;  1ZQA A;  1I5Y A;  2HR3 A;  2JS3 A;  4I9Q A;  2PFP A;  4PA4 A;  2OCC C;  1PKX A;  1MZF A;  2QTS A;  1ZQL A;  5CHE A;  2FB5 A;  2ZE5 A;  2PI4 A;  4RQ4 A;  1K5Q A;  3E86 A;  4X1I B;  3TFS A;  1R3I C;  3E2E A;  5JVD B;  4WC5 A;  3N2G B;  4I27 A;  4LFB B;  1F23 A;  2YIB D;  2PXI A;  5J0T A;  2JEX A;  3SGI A;  1XUQ A;  4O4J B;  3ZS8 C;  5JJJ B;  5KAF Z;  3C3T A;  4IIJ B;  4EFE A;  3WFQ E;  1B04 A;  1QNM A;  2BOC C;  3L72 H;  1K34 A;  1JN3 A;  4NLZ A;  1PNL A;  3HX0 A;  1J5E B;  2BE3 A;  4L8J A;  4PV1 B;  4JLZ A;  4OX9 O;  2LW1 A;  1KC8 W;  1QVF U;  3E35 A;  5KAI Z;  5A9G A;  4WFA V;  5DB6 A;  3CRR A;  4FO1 A;  9ICT A;  1MAB G;  1HUZ A;  2JGU A;  3B4S A;  3CMA V;  4DRX B;  5LYJ A;  4LF7 B;  4B3M B;  2HHH B;  1QLE C;  1XSN A;  3EXA A;  4D7T A;  3MD0 A;  2CTR A;  4IQV A;  2N05 A;  5JH7 B;  4C7U A;  2UUA O;  1THZ A;  1VQ4 V;  2A7W A;  5FNV A;  3HJ4 A;  1BPB A;  4EV6 A;  4YJ3 A;  3P3P A;  4MVU A;  3T1H O;  4LEV A;  8ICC A;  2F4V B;  4RQ3 A;  9ICH A;  2ADP A;  3MGI A;  4J9Y B;  4U7N A;  3T1Y O;  1M56 C;  2JRI A;  4DV7 B;  4FLU A;  4BW5 A;  1PL0 A;  2W6I G;  1L0L H;  1R73 A;  4DR1 O;  4P4O A;  4I2B A;  1E1R G;  4PA9 A; 
#chains in the Genus database with same CATH homology
 1ZQD A;  3MDC A;  8ICS A;  4UB5 A;  9ICU A;  5BPC A;  7ICS A;  4X4U A;  7ICR A;  4NKT A;  4RQ0 A;  3V7K A;  3L9D A;  4UB2 A;  4RPY A;  5CR0 A;  1F5A A;  4IG8 A;  5DED A;  4PPX A;  5J2E A;  4M0A A;  8ICR A;  1HUO A;  9ICG A;  2DR7 A;  4I29 A;  3H3A A;  1ZQU A;  4KLL A;  1ZQI A;  4QZH A;  2M2U A;  9ICS A;  7ICJ A;  1TFY A;  2ID1 A;  4S3N A;  2FMP A;  7ICF A;  1ZQS A;  3UQ0 A;  5HR9 A;  7ICN A;  5HRB A;  5DB9 A;  3OUY A;  5J0S A;  3C66 A;  3UXP A;  2PFO A;  3B0Y A;  4RQ7 A;  5J2C A;  4QZI A;  3ISC A;  5CJ7 A;  9ICI A;  5DDM A;  1YLQ A;  4FHW A;  3NYB A;  4DO9 A;  1XSP A;  9ICB A;  5J2H A;  5J0Q A;  4O5E A;  3RH5 A;  2IHM A;  4XQ8 A;  4WC1 A;  3V7L A;  2BCS A;  2DRA A;  4IQU A;  1ZQW A;  1TVA A;  5J0P A;  4E7X A;  4RWN A;  4Z6F A;  2FMS A;  4M9H A;  3UPQ A;  4KLD A;  4YCX A;  5DDY A;  4QZB A;  3C5G A;  4M9J A;  3ISD A;  4WC0 A;  2ZH4 A;  1BPE A;  4XQ7 A;  2M2W A;  3JPP A;  4YMM A;  1VJ7 A;  3MGH A;  4UB3 A;  4XA5 A;  3UQ2 A;  2RFF A;  2VAN A;  1KDH A;  5CB1 A;  4I28 A;  9ICA A;  2ZH2 A;  4P4M A;  2ZH3 A;  1TFW A;  1UEV A;  5IIM A;  9ICO A;  4QZA A;  4PGY A;  1MQ2 A;  4WBZ A;  4LZD A;  4NM1 A;  4WBY A;  1MQ3 A;  2BPC A;  1ZQG A;  4YD2 A;  2ZHA A;  4TUR A;  3C18 A;  4QZF A;  1BPZ A;  4PHD A;  4P4P A;  7ICG A;  2DRB A;  4TUS A;  7ICT A;  4KLE A;  3RJE A;  5HRD A;  5DBB A;  1XSL A;  2HHP A;  5HRK A;  3RJI A;  5IIJ A;  4I2A A;  5DBC A;  4NLK A;  5EOZ A;  3RJJ A;  4KLO A;  9ICP A;  5DKW A;  8ICQ A;  1R8B A;  3V72 A;  5J2J A;  4XUS A;  1ZQR A;  4PHE A;  2ISP A;  2DR5 A;  4GXI A;  4PHA A;  4WC4 A;  2PFQ A;  7ICU A;  4RQ1 A;  5TZV A;  5J0O A;  3HIY A;  4WC7 A;  3PMN A;  4KLT A;  9ICK A;  3WFO A;  5HHH A;  2ZH5 A;  9ICM A;  1BPD A;  1JQR A;  4ATB A;  1ZQY A;  4AT7 A;  3C5F A;  9ICL A;  4YN4 A;  4X0A A;  4UD5 A;  4RQ5 A;  2P66 A;  4QZ8 A;  4I2E A;  5J2F A;  3H37 A;  5D46 A;  4Z6D A;  2ZH6 A;  3AQN A;  5J2D A;  1RPL A;  8ICE A;  3OV7 A;  1R89 A;  4TUP A;  1ZQT A;  3GDX A;  8ICY A;  3PNC A;  4KLG A;  4GXK A;  4PGX A;  2PFN A;  2I9G A;  3V7J A;  9ICR A;  7ICE A;  1TV9 A;  4QZD A;  3B0X A;  1JAJ A;  5DB8 A;  4QZE A;  8ICP A;  4FH5 A;  4M2Y A;  4I2J A;  5J29 A;  8ICZ A;  4RWO A;  4X4N A;  5IIL A;  1KEJ A;  3PML A;  8ICJ A;  1ZQF A;  8ICG A;  5IIK A;  5DB7 A;  4RT3 A;  5HC9 A;  8ICT A;  9ICV A;  4KLI A;  4EP7 A;  3RJF A;  1JMS A;  1R8C A;  5F2V O;  3TFR A;  7ICM A;  3WFR E;  2BCV A;  9ICJ A;  2GWS A;  5J0U A;  4RQ6 A;  4UBB A;  8ICF A;  4UB4 A;  4R64 A;  3OUY B;  5BOM A;  4Z6E A;  3UXO A;  5IIO A;  5J2G A;  1ZQZ A;  3WFP A;  9ICQ A;  3HW8 A;  1NO5 A;  5HRI A;  2M2V A;  3JPO A;  1Q78 A;  3OVA A;  3C2K A;  4F5R A;  3RH4 A;  1UET A;  4F5O A;  4NY8 A;  3C2L A;  4X4O A;  1ZQP A;  4RWP A;  4QZC A;  3JPN A;  4UB1 A;  3AUO A;  3MDA A;  4M5D A;  4JWM A;  4MFC A;  2M2T A;  1WOT A;  3HJ1 A;  1ZQN A;  3H39 A;  5J2K A;  5D49 A;  4Z6C A;  1BPY A;  4GXJ A;  4KLM A;  4UAW A;  4LVS A;  9ICC A;  7ICI A;  2ZH1 A;  1R8A A;  1KNY A;  2ZH7 A;  5D4B A;  4KLS A;  1ZQB A;  3JYY A;  4MFF A;  4P2H A;  2ISO A;  4FHP A;  4NM2 A;  8ICI A;  5J0R A;  3OGU A;  4DOA A;  4FHV A;  1MIW A;  4I2D A;  4AT9 A;  8ICO A;  2NRK A;  4WC6 A;  4O5C A;  1ZQO A;  4DOC A;  4FO6 A;  1ZJN A;  4FHX A;  4M9N A;  1MIV A;  2O5A A;  4RT2 A;  4AT8 A;  1ZQM A;  4KLH A;  8ICX A;  2W9M A;  9ICN A;  4E80 A;  7ICP A;  1MIY A;  5J2I A;  1ZQX A;  4FHY A;  1ZQK A;  4QZG A;  4LT6 A;  3AQL A;  5CHG A;  4X0B A;  4RQ8 A;  4X4P A;  3LK9 A;  2Q66 A;  3AQK A;  5CA7 A;  4KLU A;  1VFG A;  7ICK A;  8ICL A;  3MBY A;  8ICU A;  3H38 A;  4RWQ A;  5HRL A;  4I2G A;  4I2C A;  4F5N A;  5III A;  4EBJ A;  3UXN A;  4FH3 A;  5J0X A;  4XRH A;  4MF8 A;  4ATB B;  5HRH A;  4AT7 B;  4IQT A;  4MF2 A;  4WC3 A;  2DR9 A;  9ICF A;  3LQC B;  4O9M A;  1ZQV A;  4NXZ A;  4WC2 A;  4K4G A;  8ICW A;  3WFS C;  4JWN A;  5J0Y A;  1Q79 A;  4YMN A;  4K4I A;  4F5Q A;  1FA0 A;  4RQ2 A;  3AQM A;  5CWR A;  4DOB A;  2BCQ A;  4EBK A;  4R65 A;  2BPF A;  8ICB A;  1ZQA A;  1ZQJ A;  5CP2 A;  2BCR A;  4KLJ A;  2PFP A;  3OVS A;  2ZHB A;  1ZQC A;  1OU5 A;  2DVI A;  1ZQL A;  4PHP A;  4YMO A;  1ZJM A;  3JPR A;  3JPT A;  5HRE A;  4RQ4 A;  3C2M A;  3TFS A;  4QZ9 A;  4R63 A;  1UEU A;  3AU2 A;  4UAZ A;  4LZG A;  4WC5 A;  5IIN A;  4X4T A;  2DR8 A;  4I27 A;  4K4H A;  1RZT A;  7ICV A;  5HRG A;  2PXI A;  5J0T A;  4TUQ A;  4R66 A;  4E8F A;  4X4R A;  7ICO A;  2PBE A;  3WFQ E;  3RH6 A;  2BCU A;  2FMQ A;  2BPG A;  4NKU A;  4PH5 A;  1JN3 A;  4NLZ A;  4PGQ A;  4WCW A;  3HX0 A;  2BE3 A;  7ICL A;  7ICH A;  8ICV A;  4UD4 A;  4YD1 A;  4UBC A;  5DB6 A;  3AU6 A;  4NLN A;  8ICH A;  9ICT A;  1HUZ A;  1ZQE A;  4O5K A;  4MFA A;  1V4A A;  5HHI A;  5J2A A;  2ZH9 A;  3RJK A;  4IQW A;  9ICE A;  3HWT A;  3ISB A;  5J0W A;  4M04 A;  2ZH8 A;  1XSN A;  5DEC A;  1ZQQ A;  4RPX A;  4KLF A;  7ICQ A;  4M47 A;  5BOL A;  4IQV A;  1NOM A;  4X4Q A;  3OVB A;  9ICX A;  3RJH A;  5J2B A;  4X5V A;  3K75 D;  4RPZ A;  4AT9 B;  8ICN A;  3RJG A;  3HJ4 A;  1BPB A;  4I2I A;  4I2H A;  8ICC A;  3UPS A;  4M9L A;  5DBA A;  4RQ3 A;  1BPX A;  2O1P A;  9ICH A;  4KLQ A;  4X4S A;  3JPQ A;  3MGI A;  4M9G A;  4UAY A;  5HRF A;  4AT8 B;  8ICM A;  9ICW A;  1PX5 A;  1ZQH A;  8ICK A;  3JZ0 A;  4X4V A;  4F5P A;  3JPS A;  8ICA A;  4P4O A;  4I2B A;  4I2F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...