5DECA

Crystal structure of the small alarmone synthetase 1 from bacillus subtilis
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
195
structure length
188
Chain Sequence
DDKWERFLVPYRQAVEELKVKLKGIRTLYEDDHSPIEFVTGRVKPVASILEKARRKSIPLHEIETMQDIAGLRIMCQFVDDIQIVKEMLFARKDFTVVDQRDYIAGYRSYHLVVLYPLQTVSGEKHVLVEIQIRTLAMNFWATIEHSLNYKYSGNIPEKVKLRLQRASEAASRLDEEMSEIRGEVQEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP pyrophosphokinase YjbM
publication title Catalytic mechanism and allosteric regulation of an oligomeric (p)ppGpp synthetase by an alarmone.
pubmed doi rcsb
source organism Bacillus subtilis (strain 168)
molecule tags Transferase
total genus 64
structure length 188
sequence length 195
chains with identical sequence B, C, D
ec nomenclature ec 2.7.6.5: GTP diphosphokinase.
pdb deposition date 2015-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04607 RelA_SpoT Region found in RelA / SpoT proteins
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.860 Mainly Alpha Orthogonal Bundle Helix Hairpins Nucleotidyltransferase 5decA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5decA01
5CB1A 4I2BA 4M5DA 4XRHA 8ICNA 4UBCA 1ZQEA 4KLTA 4MF2A 1ZQCA 2ZH3A 2M2VA 4ATBA 3UQ2A 3L9DA 4XQ8A 4LT6A 1ZQXA 4RWOA 4UB5A 3TFSA 1R8AA 1KNYA 5HRGA 3PNCA 5HHHA 1BPZA 4NKTA 3RJHA 3B0YA 4X4RA 4Z6FA 1UETA 4TUQA 3HX0A 7ICOA 2FMPA 5HRFA 5J2AA 2ID1A 5J0PA 1RZTA 1V4AA 4FHVA 5DB8A 4RPZA 5D49A 4RT2A 4WC5A 4GXJA 3V72A 1PX5A 2ZH7A 5J2FA 9ICIA 3V7JA 7ICUA 4E8FA 1ZQHA 5HHIA 3HIYA 4I2AA 4R65A 5DEDA 4RQ4A 4M47A 4KLGA 4R64A 5IIKA 3RH6A 4KLHA 5J29A 4M9GA 2ZH1A 1KDHA 3WFOA 4PHPA 3C2MA 7ICKA 1MIYA 1ZQAA 4K4GA 4E80A 4X5VA 8ICWA 3C66A 4MFAA 3ISDA 9ICEA 3C5FA 4UAZA 3WFQE 4NLZA 2HHPA 4O5CA 5J0SA 2BPFA 4RQ8A 5J2GA 4I2DA 3OVSA 8ICFA 2M2TA 4YD1A 3MGIA 1ZQNA 4KLMA 5DB9A 2ZH8A 4PPXA 4LZDA 9ICHA 4EBKA 4WC3A 4NM2A 3UXNA 1MIWA 5DKWA 4PHDA 1ZQKA 5HRKA 9ICNA 8ICJA 5BPCA 9ICAA 3UQ0A 2ZH4A 5J0TA 3WFSC 4WBYA 9ICJA 3C2LA 9ICWA 1HUZA 4AT8A 2PFPA 3H37A 1MQ3A 2BCSA 4X4PA 3TFRA 5DB6A 2ISOA 9ICKA 4UAYA 3RJEA 1ZQOA 3JPSA 5CP2A 1YLQA 1TFWA 4XA5A 5EOZA 5IIOA 5DBBA 1FA0A 8ICRA 4IQVA 2ZH6A 5HRLA 4AT9B 4R66A 7ICTA 1ZQUA 4PHEA 4FHPA 2BCUA 4NXZA 4NLNA 4S3NA 4RQ7A 4MF8A 4LVSA 8ICBA 3GDXA 5D46A 3HWTA 1KEJA 4I28A 1ZQDA 9ICFA 4IQUA 4X4QA 5J0XA 1BPXA 9ICRA 4QZBA 4FHYA 1ZQLA 5J2HA 7ICVA 4PHAA 4O5EA 4RPXA 4MFFA 5HREA 5HRIA 1HUOA 3MGHA 2NRKA 2Q66A 4M04A 2O5AA 4I2CA 3C18A 2DRAA 9ICVA 3OUYB 1RPLA 4QZ8A 4X4UA 3UPQA 4DOCA 2DR8A 5F2VO 4RWPA 3RJJA 3RH4A 4O5KA 8ICHA 1ZQVA 9ICTA 1VJ7A 4M9LA 4I2IA 4Z6DA 3UXPA 2M2WA 8ICOA 4XQ7A 3H3AA 5J2KA 3LK9A 4X4TA 3C5GA 4M9NA 2DRBA 4XUSA 9ICQA 2VANA 4UB3A 5DBCA 4FO6A 4F5OA 4MFCA 4AT7B 4YD2A 3AU6A 1ZQRA 3ISCA 7ICFA 7ICHA 4E7XA 1ZJNA 9ICPA 8ICYA 4WCWA 5D4BA 5IILA 4IQWA 4NY8A 4RQ3A 4Z6EA 4I27A 1UEVA 8ICQA 5CWRA 4P2HA 5BOLA 2PXIA 1VFGA 4ATBB 4KLFA 4RQ1A 2ZH2A 3UXOA 4DOAA 1ZQBA 3AQNA 4RQ5A 8ICAA 4JWMA 1NOMA 4UD4A 1XSLA 9ICSA 5IIMA 4M9HA 8ICSA 4TURA 3OVBA 2W9MA 5TZVA 2FMSA 3ISBA 5HR9A 1ZQQA 4QZ9A 5J2JA 2ISPA 3C2KA 4F5NA 8ICEA 4QZHA 3MDAA 4P4OA 8ICKA 4X4VA 5DB7A 3MBYA 4IQTA 7ICEA 1XSPA 9ICUA 5J2CA 5J0UA 1TFYA 1OU5A 4FHWA 1BPDA 1ZQPA 4X4NA 1ZQGA 4RQ6A 4YMMA 5DDYA 3MDCA 4F5QA 4DOBA 3AQMA 3AUOA 4RQ2A 4WC4A 2BCQA 2O1PA 2ZH5A 2BPCA 1Q78A 3V7LA 4R63A 3HW8A 4QZGA 4F5RA 3OUYA 8ICVA 4GXIA 1JAJA 4RT3A 4GXKA 5J0YA 5J2BA 4UB4A 3H38A 3OGUA 1MQ2A 3JPTA 3OVAA 2PBEA 4WC7A 3AU2A 3WFPA 7ICPA 3JZ0A 1ZQTA 3JPPA 1ZQJA 4I29A 4WC2A 1XSNA 2GWSA 2BCVA 3H39A 5CR0A 5J0OA 4KLDA 4X4OA 3JPOA 3PMNA 4X0BA 4FHXA 5BOMA 4M9JA 4K4HA 7ICJA 1JQRA 1ZQYA 4NM1A 3V7KA 5CA7A 2DR5A 4AT8B 1BPEA 2PFNA 2DR9A 4PGYA 9ICLA 8ICCA 4QZCA 4PH5A 2RFFA 3LQCB 5J0RA 4QZAA 4TUSA 1JN3A 9ICBA 4JWNA 4O9MA 8ICZA 8ICLA 5J0QA 7ICLA 5J2IA 4FH5A 5HRDA 1F5AA 2DVIA 1WOTA 4I2FA 5CJ7A 4I2JA 3RJGA 9ICCA 4F5PA 9ICXA 4WC6A 5IIIA 1MIVA 5HC9A 4QZDA 4P4MA 9ICGA 3NYBA 2I9GA 2ZHBA 7ICMA 4UB2A 4YN4A 1BPBA 5DECA 2ZHAA 1ZJMA 2PFQA 3RH5A 5IINA 4IG8A 4KLJA 8ICUA 4RQ0A 4QZIA 7ICGA 5J0WA 1Q79A 3JPNA 4I2GA 8ICPA 9ICMA 4QZFA 4AT9A 1JMSA 4EP7A 1ZQMA 2BE3A 1UEUA 7ICRA 8ICMA 4X0AA 4NKUA 4LZGA 3OV7A 2P66A 7ICIA 1ZQZA 3RJKA 7ICSA 9ICOA 4PGXA 4YMOA 3JPRA 4KLIA 4YCXA 3RJIA 4KLQA 4TUPA 4QZEA 2FMQA 2BCRA 8ICXA 7ICQA 4KLSA 1BPYA 4WC0A 4WC1A 4M2YA 2IHMA 3RJFA 7ICNA 8ICGA 4K4IA 4NLKA 4UBBA 4Z6CA 3K75D 3JPQA 1TVAA 5J2EA 3PMLA 4WBZA 4KLLA 5HRBA 1R89A 4UD5A 4EBJA 5CHGA 5IIJA 1ZQIA 3AQLA 3B0XA 1ZQWA 4M0AA 2PFOA 4RWNA 4P4PA 4UAWA 1TV9A 2ZH9A 4I2HA 4FH3A 1NO5A 4RPYA 3AQKA 8ICIA 3UPSA 3HJ4A 5HRHA 1ZQFA 4DO9A 3JYYA 5DBAA 4KLEA 4KLOA 5DDMA 1ZQSA 4KLUA 4UB1A 3WFRE 2M2UA 4I2EA 4PGQA 1R8CA 8ICTA 2DR7A 2BPGA 4AT7A 5J2DA 4X4SA 4YMNA 3HJ1A 4RWQA 1R8BA
chains in the Genus database with same CATH superfamily
3QO7A 1QQCA 3BABA 5IY5B 3C3SA 5CB1A 1Z5VA 4XDJA 8ICNA 4UBCA 4MF2A 4IT5A 3OFNG 4X1IB 3ZMVA 4BIOA 1QVGU 4I4TA 4DR7B 4NXVA 2ZH3A 5KHKA 1GN3A 2M2VA 4NXWA 4QPJA 3SPIA 1SQPH 3L9DA 2ZR2A 4RWOA 4LF5B 4B3MB 2LGWA 1TUBB 2VWKA 2QWRB 5IDJA 2UUCB 3PNCA 3EXAA 3RJHA 2X7RB 4FM2A 1KD1W 1GMGA 1MG1A 1BGYH 1UETA 1N0JA 2FMPA 4GLXA 4KUMA 4IHJB 5J0PA 2CGNA 2LW1A 5DB8A 3L72H 5D49A 2OCCB 1XNRO 4WC5A 5LXTA 3N2GA 4X88A 5IY5C 2ZH7A 2WPDG 1IBKB 3JYCA 3UT5A 5J2FA 1Q82W 9ICIA 7ICUA 4FM0A 4BIUA 2ITCC 1UJWB 4E8FA 2QGNA 4DRXA 2AHZA 1DLBA 4I2AA 1S5HC 5DEDA 4M47A 1AJPA 4KLGA 4P30A 3CX5F 1FJGO 3W7UA 1KB9F 1WPBA 3RW0A 4LEVA 3C66A 3I56V 3ISDA 4JZ2A 4ZI7B 4O5CA 3HKEA 4JI2O 5CA3A 4MTFA 1FAFA 1KKCA 3CP1A 4AQYO 2Q0AA 1ZQNA 2ZH8A 3JASA 2OCCC 4UCRA 4PPXA 1Q6IA 2IU0A 1DF5A 1BL8A 4EBKA 3ABMB 4PA3A 4EFEA 2CUGA 1MIWA 4JI3O 1QNMA 4PHDA 1YTFD 1ZQKA 1QLNA 1F51A 5HRKA 8ICJA 1N0NA 3ML0A 1VQLV 4WBYA 9ICJA 1NI8A 2PFPA 4ZIBA 1MQ3A 1GK9A 4X4PA 3TFRA 3OD4A 5LA6B 3IC7A 3CCRV 4UB8Z 1WLEA 3RJEA 3VBBA 3RYIA 1K97A 3VOUA 3AG4B 3ZMUA 1AJNA 2YXYA 4MVQA 4HX0A 3T1YO 1H8HG 2HHHO 2Q73A 4PI0A 4EGWA 1XILA 4NTWA 5C8YB 2ZINA 1TGOA 5HRLA 1IVSA 4R66A 3ER8C 1QR8A 1N34B 1Z5WA 3K5OA 2H94A 4K98A 2ETNA 1SF9A 4NXZA 4QPKA 1WA8A 2WLIB 2XNDG 3QG5A 4LF7B 4DYLA 4ZHQB 2M6YA 3N2KB 1NH2B 3NXSA 1K8AW 1KEJA 4I28A 4XDLA 3CRMA 5LHGA 1FFXB 1BS3A 2N74A 1U96A 1L1FA 3BVOA 2OIGA 9ICRA 2X6AA 4A5UB 3CC2V 1ZQLA 3E22A 4DV5B 3AG4C 7ICVA 2P67A 4RPXA 1VF5B 2EJ7A 1SQVH 2F4VO 5KHJA 1AI4A 2NRKA 3M99B 2IM9A 4I55A 1LUVA 2R70A 4B3RO 2R9RB 4DV4B 4MVUA 3OUYB 1RPLA 3UPQA 3ZHRA 4ZOLB 2QTSA 4GKJO 2ZE8A 4FK5C 5F2VO 4NYKA 3JSLA 5CA0B 5GTIZ 4DW0A 3HKDB 4NXNB 1B04A 1R3IC 2Q67A 4I2IA 4Z6DA 2UU9B 4YJ3A 3UO2A 1IDSA 3EVKA 1VQ7V 1Y74B 4DUYO 1B3QA 3AK2A 3T4ZA 1YXBA 3LK9A 2LW7A 4DR4O 3LDCA 4WH5A 4M9NA 2Q7EA 1D5NA 1RPRA 2AHYA 4F5OA 3Q4HA 5CFUA 3ISCA 4E7XA 3RVZA 2P22C 2QSAA 4FLUA 2DQ0A 5B1OA 2ZNJA 3ZRSA 3J80N 2XAHA 2QTOA 3UO3A 1GO3F 1VQOV 4I4TB 4FPPA 4AI8A 5CB4B 2PXIA 1VFGA 1VP7A 3AG2B 2ZH2A 4JAAA 1ZQBA 4RQ5A 4JWMA 3K5NA 4PV1B 8ICSA 4DR5B 1Z2GA 4DUZB 2WAMA 2ZE7A 3ZX6A 2VQEB 3AK1A 2R9IA 1E79G 1IBMB 1R3KC 1NU1H 4PDMA 4JZGA 8ICKA 4X4VA 5DB7A 7ICEA 5LXTB 2XT9A 4IQTA 2UUAB 4EFBA 5JJNB 4D7TA 1TFYA 1EZJA 4JLXA 1BPDA 5IWAO 3ABTA 1N32B 4DRXB 5KA6A 4WFFA 4LEWA 4WC4A 2XAJA 3AG2C 1BHAA 2BCQA 1UPGA 4EEBA 2F66C 4MTOA 3WFVA 1M5IA 4CBCA 4FFBB 4RUEA 2BBHA 8ICVA 1THZA 3WB2A 3B40A 4EEQA 3W7XA 2EZPA 1NJIW 1MQ2A 4UVBA 4B3SO 3HKEB 3JZ0A 1PKXA 5LHHA 1ZQJA 4I29A 1Y67A 4WC2A 3JASB 1XMOO 2CH7A 4TSFG 2BCVA 3E83A 5FNVA 2DN9A 1J5EO 5CR0A 5CFSA 3CCSV 5KHIA 4E4EA 5BXZA 1EN6A 5BOMA 2GAFD 4G28B 1YJ9V 4M9JA 1GM9A 4JLZA 2FYUH 3FKSG 4B3TO 4NM1A 2UXCO 1XNRB 4I0XA 3E35A 5H5NA 4PGYA 3E86A 2GHYA 1AROP 3ETDA 3RYIB 1JN3A 1XI1A 2RN9A 4O67A 2NR5A 1CXZB 1XREA 8ICZA 2F43G 1FJGB 5J2IA 3W7TA 4FLVA 1BSMA 2DVIA 5BR8O 3O9OA 2Y69B 2A3QA 1AP6A 4LF5O 4B3MO 5A9GA 1Q90D 3SJQC 4RUFA 2UUCO 4TWKA 4JI2B 1WA8B 3U0ZA 4K8ZA 1H2GA 4AQYB 3CJHA 4GKKO 1OCRB 5TISZ 3QO5A 2PFQA 4TQDA 4NTYA 1EBOA 3K04A 1PV0A 3DC5A 2B4VA 1H8EG 2EIKB 1IBKO 4KHPO 4LF4B 4QZFA 4LH7A 4AT9A 2OCHA 1JMSA 4EP7A 2IJJA 2FKXA 2XTAA 2KQXA 3H1KH 1ZQMA 4JTCB 1UEUA 2Y69C 5L3EA 1XEQA 4LZGA 3TXQA 3ASNB 7ICIA 2GSMB 4Q20A 1ZQZA 2YXHA 3T1HB 5B3QA 1GN6A 1I5XA 2KB1A 4J7KA 3BFRA 4QJFB 4YHHB 2BBJA 4YMOA 4JI8B 4WQLA 2IU3A 3ETGA 3T1YB 4YJ3B 3RJIA 3SJBC 2IH1C 1HNWO 1OCRC 1IURA 1K92A 2Q8VA 2MW2B 3WU2Z 8ICXA 3ABLB 3BPZA 2DYRB 4YJ2A 2HLDG 4KLSA 4B7KA 4WC0A 5LOVA 4KB6A 8ICGA 4UBBA 1XHXA 3CCMV 3Q4HB 3RVYA 1SQFA 3JD1A 5IIJA 4FIPC 3F5TA 1NH2D 1AR5A 5KUMA 3B0XA 4U7OA 3ASNC 3G71V 1K9MW 3CHXA 4J7ZA 2QEXV 1AVMA 2EIMC 2Z0AA 4X65B 3UPSA 8ICIA 2M7WA 2P06A 1K5SA 3DC6A 4DO9A 3JYYA 5DBAA 2F4VB 1WPXA 3APQA 3QF7A 4R6ZA 3ABLC 1SRYA 1URFA 2DYRC 3RYFA 4RQFA 4K99A 3RFRA 3OWGA 4AT7A 3CCJV 4UCVA 4YMNA 5B3SB 1N34O 3HJ1A 4RWQA 3JD4A 1VQMV 4I2BA 1RSOB 4M5DA 4XRHA 4YIOA 1O9GA 1ZQEA 1YIJV 1K34A 4LF7O 1P49A 4FLXA 1S76D 2ADPA 3H1HH 3CC7V 4PI2A 1W0JG 1K7DA 4KXRA 1H2NA 1JPXA 3SGIA 2WLJA 4JYBA 4J80A 4DR4B 5IE9A 1ZQXA 3T4DA 1YITV 4UB5A 2Y0IA 4G27B 1VQ6V 1Y76B 2QA4V 1COWG 1HR0O 2G38A 1R8AA 2GUZA 5HRGA 1WP7A 2QWNB 2HJFC 4NKTA 1SKVA 1BE3H 5JVDB 2W6JG 1QLEB 2YIAA 1V55B 3KZIZ 4X4RA 2XHBA 4Z6FA 4TUQA 1I0HA 3K0GA 2GTAA 5BMVA 5HRFA 3HKBA 1FYJA 4WFEA 4LCUC 4RT2A 5B3SC 4DV4O 4AILC 3OM3B 2IJKA 3V7JA 3ZMSA 2CH7B 4H33A 4KM5A 1K3EA 2E76B 1PD3A 4MKPA 1VQ9V 4R65A 3ZRWA 4YY3O 1OCCB 3JARB 5KMGB 2DE0X 3ZHTA 3WFOA 4I50A 1FXVA 2CTQA 4J42A 3CCLV 1G8MA 1FPOA 2ODMA 1IX9A 1Q43A 1QLEC 3OTFA 1V55C 4EKWA 4I0XB 3OUFA 2HHPA 1MZFA 2BPFA 4RQ8A 1SZXA 4LWSA 5LGTA 4I2DA 1NZ6A 1RFYA 2EWRA 2ZT9B 4KLMA 2KG7A 5DB9A 4FFKA 4OGQB 1JFFB 4EB6B 4LZDA 3OR7C 4LNUB 5DKWA 5D5QA 5EC2C 1JJ2U 4J7JA 1S77D 5BPCA 3FYEB 3ZHQA 1OCCC 9ICWA 1MSWD 2AGAA 3PHZA 1K4CC 2BCSA 4DR5O 5DB6A 3CJHB 4P9PA 3OUSA 3OTOB 5CP2A 2LFSA 2PI5A 3HR0A 1US6A 4FLWA 4JI7O 2UUAO 4NXTA 1KBHA 5EOZA 4TUYA 2D3OW 1Q7YW 1FA0A 4PD4F 5CBGA 8ICRA 4AT9B 4DV2B 2F23A 3F7VC 3IJ4A 1PL4A 2Z5UA 1ZQUA 5H9CA 2EULA 4PHEA 3HB3B 4MTXA 5GONA 2UXBO 4FHPA 2BCUA 1FS0G 2R9AA 1ENVA 2OWOA 2CTWA 4MF8A 1XL6A 5KHGA 3CS5A 2B56A 2ZXWB 3GDXA 1WAZA 4HYOA 1YJNV 2JEUA 1L0LH 3H1IH 2BOCC 4X4QA 4IYIA 3CCEV 4H37A 4MTGA 2O57A 3OMIB 3AK3A 4QZBA 4FHYA 3APOA 5J2HA 3F5WC 4F6RA 3K79A 5JJJB 1O9HA 2V7QG 5JJEB 5BR8B 4I9WA 3W7WA 3ETQA 2GTSA 4Z1MG 5HRIA 1W2BU 5LOVB 2E75B 1HUOA 1ZLZA 2LP7A 1VEWA 1PNLA 4X9QA 2WWWA 3C18A 3ZS8C 4L87A 4QZ8A 4DOCA 2DR8A 3T2MA 4GKKB 1ZSPA 3RJJA 8ICHA 3E8HA 1FXKA 1VJ7A 4M9LA 4H44B 2JVDA 5KHHA 3UXPA 4PDVA 2ZXWC 3C90A 8ICOA 4KHPB 4LF6B 3H3AA 5LMUB 4K35A 5J2KA 2YXLA 3MDSA 5EYPB 4O4IB 4OAGA 3E8BA 5B3PA 1JVMA 4JI4O 2DRBA 4J10A 3D3IA 5DBCA 2ZE5A 2RDCA 2VS0A 1MABG 4AT7B 3AU6A 1ZQRA 1GKFA 4J41A 3H1JH 4O2AB 1VQ4V 1N36B 4IQWA 2P4KA 2EBOA 1GRJA 1HNWB 1ORQC 4Z6EA 2CTPA 4LH6A 1UEVA 3P32A 4CS2A 8ICQA 4G2KA 2PUSA 4UXNA 3ZBHA 2ZM6B 1WNSA 2XAFA 1A32A 2AZ0A 3AQNA 8ICAA 1D2DA 5J2TB 1VMGA 2GUZB 3G6BA 1JX9A 4QIWF 5JCOC 3OGCC 4TURA 4LF9O 3OGIB 2LGQA 2FMSA 4LF4O 1KP3A 4X66O 1B6QA 2A9HA 3CK6A 3ISBA 1ZQQA 4OX9B 5J2JA 3C2KA 3LSUA 4F5NA 5BMVB 1OCZB 4QZHA 4UUJC 3MDAA 5LMNO 4UCTA 3FX7A 3T1HO 3LUTB 1SQQH 3ZHSA 1OU5A 4FHWA 3M7MX 4YHHO 1XL4A 4JI8O 2CAZC 2X6BA 1TA8A 4CC6A 3MDCA 4F5QA 3HKCB 1LNQA 2JGDB 2HR3A 1SA0A 2MK3A 1AI6A 4O4HB 2RQ6A 1VIBA 3V7LA 1Q78A 4R63A 4TV8A 4QZGA 2Q4PA 3A0RA 4JPRA 3B2EE 1JAJA 4RT3A 3CE2A 5L3FA 5J2BA 2DJVA 3JPTA 3JD0A 1YF2A 3JCUZ 4O4LA 1SERA 4UB6Z 2PBEA 4WC7A 7ICPA 3J81N 1ZQTA 2YSUB 1OCZC 4LWSB 3KCXA 5A2QN 2KG7B 1DF4A 4PA7A 4LFCB 3LSQA 4O2BA 3STZC 5J0OA 1HR0B 4X4OA 4RWUA 3BA8A 4HZ3A 4F6EA 2UXNA 5J2UA 4X65O 3PMNA 4R8CA 3EF2A 4FHXA 4L8JA 4GX0A 4R50A 4WOYA 4K4HA 7ICJA 2NN4A 4ASUG 2ARHA 2OTJV 1ZQYA 3NVOA 4MT8A 2HKOA 4PHZA 3V7KA 2DR5A 1TAEA 4LFBB 2GBOA 8ICCA 5CN0A 2RFFA 3ABKB 5JQGB 4K9BA 1BMFG 2OIEA 3OT7A 4QGPA 4QZAA 1H2MA 1IBLB 1TVKA 5IYDO 3THOA 5KA5A 1PNMA 3B8NA 3BCCH 3SDLA 1AI7A 4YY3B 1JJOA 4JWNA 2FMLA 3A0HZ 4X1YA 4I2FA 5E79Z 4I2JA 2HVJC 4ABMA 5GONB 4CS3A 1MIVA 5HC9A 2JDIG 9ICGA 3NYBA 2ZHBA 4UB2A 4YN4A 4FM1A 2K1EA 4MVRA 4GZRB 5B66Z 1ZJMA 5J9PC 3RH5A 1ZUQA 2D2CB 3BAAA 3ABKC 5H2FZ 3QNEA 4FZ0A 3CC4V 4KLJA 3P3NA 1EZVH 1R73A 1S0VA 1Q79A 4J9YB 4I5SA 4HAMA 2ZIOA 1CPYA 4X8AA 2P66A 1FKAO 7ICSA 2AZ2A 9ICOA 2C2AA 4UV9A 1FXKB 2UUBB 4D7SA 1OHHG 3G80A 4JI7B 4YCXA 3K9AA 3N2GB 4HNAA 4TUPA 2LJ2A 1P7GA 3QTCA 2FMQA 2BCRA 1BQ0A 4H13B 4WQKA 3UT5B 4LBEC 5LL6Y 2HG5C 2QR4A 3SYOA 4M2YA 2DWEC 2LFRA 4JYYA 5EBMC 4MSWC 1H38A 2UXBB 4K4IA 4NLKA 4Z6CA 5IYBO 2JK5C 1I08A 3MHHC 1GM8A 1J95A 3OE7G 4DXWA 1R89A 4UD5A 3JAWA 4EBJA 2E3CA 3AG1C 4JF3A 1ZQIA 4X20A 4YIPA 1ZQWA 4M0AA 2PFOA 3IGAC 3L74H 3D36A 3ZHVA 4NB5A 4X1KA 4DV3B 4I2HA 4PDRA 1FXKC 4JASA 3MAQA 1L8DA 3OTOO 5JWPA 4KLOA 1ZQSA 1R6NA 4I9QA 4UVAA 4D6TH 8ICTA 2WLHA 3BEHA 4JI0B 2EX3A 1K33A 2BPGA 2B51A 3U11A 4DR3O 4O4JA 4X4SA 4DV2O 5D62A 2HP8A 4IGGA 4UFZA 2IH3C 4U3JA 5IJ9A 2OYQA 1YJWV 2IW5A 3TCUA 4WBNA 1SZTA 2PF4E 4LFAB 4R7CA 4NKGB 4OAIZ 4W4KA 4ATBA 4CZZA 4JTDB 3T1CA 1XBLA 5EC1C 1JOYA 4JI4B 2Y0PA 1W59A 2YICA 1VQ8V 3CRCA 5HHHA 1BPZA 1Q6UA 1PP9H 4TV8B 3B0YA 1Q5OA 1YSCA 2DOSA 3HX0A 7ICOA 1K5QA 1PL0A 1GPJA 5J2AA 1KECA 4GXJA 1Q3EA 3LNMB 5KLVH 3V72A 2Q7HA 2ZE6A 4O69A 3IC9A 4K3AA 4O2BB 5BZBA 1JA8A 3ZMZA 2QE7G 3HIYA 4RQ4A 1FD9A 3E22B 3K57A 3EHBB 5DM6V 4LF9B 4R64A 5J29A 4LF6O 4M9GA 4X66B 3TXSA 5LMUO 2W6IG 4PHPA 2EINC 4IL6Z 3ZJZA 3C2MA 7ICKA 4N21A 1MIYA 1ZQAA 4E80A 1S5JA 4X5VA 4I55B 4MFAA 5LMNB 5LGUA 1M9NA 9ICEA 3C5FA 4UAZA 1YZBA 3WFQE 1X4TA 3I5DA 3SPGA 1AILA 5FPOA 1SQXH 3OVSA 5B5EZ 4YD1A 2PY5A 2EIMB 1N36O 3B8MA 9ICHA 4WC3A 3D8CA 4MVMA 4NM2A 3UXNA 4GX2A 1YDXA 3W7SA 5EZYA 2L6LA 1ZX3A 2BOBC 9ICNA 1DK1A 1GM7A 2Y4UA 4X1YB 3LDEA 2ZM6O 1R3LC 3UQ0A 2ZH4A 3UKMA 5J0TA 1BQZA 3WFSC 2ZCEA 3OW2U 2FB5A 4AT8A 4UV8A 3H37A 4FVMA 1WB7A 5B1BB 4OX9O 2QWOB 2YC0A 9ICKA 1HP8A 4GCZA 1KUQA 1ZQOA 3JAMN 3JPSA 3G4SV 3CRQA 1YLQA 3S3XA 4IYHA 1TFWA 1XMQB 1TUBA 2BCCH 4XA5A 1NBMG 1HW7A 5DBBA 1YTFB 3CXCU 3CWBH 1R3JC 5B1AB 4WFGA 5IJ0A 4IQVA 4EV6A 1BCCH 4X62B 4BR6A 4JI5B 4NR1A 2ITDC 1M1KW 3CPWU 4NLNA 1IXBA 4RQ7A 2CTRA 8ICBA 2YIDA 1VQKV 3DXRA 5D46A 3HWTA 3RBZA 1H2SB 1ZQDA 1MA1A 9ICFA 2XOKG 5B1BC 4J11A 4GUNA 1BPXA 4HNAB 3K58A 5L3GA 5CHEA 2KKWA 3FB7C 1VF7A 4JAUA 4PHAA 4O5EA 1H2LA 2CK3G 4LFCO 3QVNA 4MFFA 3AG3B 1OCOB 4WCEV 3CYOA 4WFBV 5B1AC 2Q66A 4M04A 1VARA 2YDEA 1I5YA 2YUAA 3CCQV 3BHPA 3D3QA 2DRAA 9ICVA 3JAWB 4UCSA 3SR2C 4DV1B 1W0KG 3RH4A 2OT5A 4X20B 1ZQVA 9ICTA 2WLMA 1LUWA 2BSKA 4NXMB 4LFBO 5EIBC 1VQPV 3CRRA 4MVOA 2PTMA 4ZKIA 5IYZA 2P4VA 4X1KB 2K9PA 1R1BA 4NVPA 4DV7O 5CBHA 1Y6XA 1XOUA 5FNVB 1IBLO 3C5GA 4YXWG 2ZR3A 2DWDC 1GH6A 4UB3A 4FO6A 3AG3C 1OCOC 4YD2A 4O4JB 7ICHA 1Y66A 5LA6A 4WCWA 8ICYA 2VRZA 1JCHA 4U3JB 4K9AA 5IJ9B 2CDYA 3O65A 3WG7C 1G6UA 3LNNA 4XBFA 4I27A 5CWRA 4P2HA 5BOLA 4ATBB 4KLFA 3D36C 1I94B 3UQ8A 4K97A 1SQBH 3ZN0A 3SYAA 1NOMA 1XSLA 9ICSA 1GN2A 3KKYA 4TQFA 2L35A 5K1XA 3ASOB 5IIMA 2PGGA 1MZEA 2WLIA 5HR9A 2X0LA 4QZ9A 2QDOA 5EBLC 2W0FC 3KG2A 3MHSC 3CSXA 1T5EA 4P4OA 3ERCC 2RCVA 3JD3A 4PELA 2E5LO 1XSPA 4DR6B 4E2LA 5J0UA 4LF8O 2Y4TA 3WB0A 3DTUB 5D5PA 2UUBO 1ZQGA 4QE7A 4RQ6A 3OEHG 4YMMA 1HWYA 3RN4A 4ZBMA 3AUOA 4KP4A 3SJAC 4RQ2A 3K03A 1M57B 2B1GA 4MVZA 4JI1B 2O1PA 4DR3B 1Y4MA 4F5RA 3OUYA 4QE9A 2VQFB 4ZOLA 4GXIA 3E89A 3NKUA 3ASOC 4GXKA 2A79B 5J0YA 3P30A 3M8AA 4OXSA 3H38A 4UB4A 3OGUA 3SPHA 2WLNA 5CA0A 1SETA 3HKDA 2IJIA 2A06H 3H01A 3AU2A 3WFPA 3DSQA 3JPPA 3RYCA 1Y74A 1Q86W 3GWKC 2GWSA 2IUBA 4DR1B 3L75H 3H39A 1XNQO 3FD9A 4KLDA 3H1LH 2FCLA 4UVCA 4DV3O 3NWIA 4Z1VA 3JPOA 3JAKA 5EZYB 4X0BA 4YJ2B 4WFAV 4GX5A 1M57C 3CCUV 3OEEG 4FLZA 2QM8A 5CA7A 4DW1A 3CMAV 1BPEA 4AT8B 4JI0O 1MNGA 4PDLA 4BIZA 4PH5A 3LQCB 1IXMA 4JTAB 4DR2B 2N04A 5CB4A 2ILMA 4I0UA 1QU7A 2EJRA 3RYHA 4LFAO 1M4UA 8ICLA 3LDDA 7ICLA 3OAAG 2W0XA 4FH5A 5IJ0B 5HRDA 1F5AA 1EM1A 3JALA 3S3WA 5CJ7A 4K8VA 1F4NA 9ICCA 4F5PA 2RMKB 9ICXA 4WC6A 5IIIA 3RYFB 1R6KA 4QZDA 3FB8C 7ICMA 5EK0A 2QKCA 3UM7A 3ZCCA 1BPBA 4W4LA 3DXRB 1KQSU 5DECA 2ZHAA 2QWQB 4MS2A 3IFXA 4IG8A 4RAIA 8ICUA 4RQ0A 1ZWIC 4QZIA 1NS1A 3CXHF 2FL4A 3JPNA 4I2GA 1JR9A 3QO8A 4K0KO 3K9SA 8ICPA 2YI9A 9ICMA 2PYJA 1UFIA 1FXHA 4FFBA 3VQVA 2QM4A 1HDJA 3JD2A 5GTHZ 4JYAB 1AB3A 2BE3A 2HEPA 4N23A 1QVFU 2Z3YA 1Q81W 3CD6V 4X0AA 1WJZA 3OV7A 2JJ2G 4B08A 3RJKA 4PGXA 1XUQA 3HKBB 3TETA 1N33O 5CMUA 4DV6B 3K7DA 2BSKB 4KLIA 3CB2A 5IYZB 1M56B 4FO1A 1S5LZ 2YS8A 7ICQA 5KAIZ 3DGEA 1BPYA 4KFMA 2HJDA 1M90W 3KCYA 5KX5A 7ICNA 1NR1A 2BTQA 3ZRWB 3K75D 3JPQA 3PMLA 4TV9A 5EBWC 5ITZA 2YIBA 4I50B 2P90A 4U7NA 4KLLA 5GW7A 1IZ3A 2WA4A 1NTZH 5EIBD 3K59A 2P7TC 1PM9A 5LGNA 4RWNA 4P4PA 4UAWA 1TV9A 2UXDO 1K4DC 4JGSA 4FH3A 3MD0A 3ABUA 1NO5A 3AQKA 1NTKH 5FPRA 3HJ4A 1EFRG 2ZKOA 3ABMC 1VQNV 4XDKA 4KLUA 4GX1A 1M56C 5H6RA 4UB1A 4I2EA 2M2UA 1XMQO 4DO2A 1N8RW 4DV0O 3HPLC 5JTGA 2QKSA 5L3BA 4MVSA 3X2QB 4JV5O 5JH7A 1KMIZ 4X62O 1G1XB 2NNUA 4JI5O 4KLTA 1AI5A 2Q68A 3ZEDA 4DK0A 1DGSA 2IBZH 4X89A 5CBFA 2R72A 1ZQCA 1MOFA 4LC1A 4DV7B 2QKAA 3UQ2A 4XQ8A 4LT6A 4BW5A 4C7UA 1SC5B 3TFSA 3OMAB 4TUYB 1KNYA 2H3OA 1NVPB 2Q0OC 1RPOA 3A8TA 1BHBA 3VQWA 4QNHB 2PI4A 2FTKA 3GVMA 4H0LB 4JI6B 1Q6HA 2ID1A 1RZTA 3X2QC 1V4AA 4FHVA 4RPZA 1JMKC 1WP8A 2AW9A 1PX5A 3P3PA 3RYCB 4DV1O 1P7BA 3ZRXA 2ZNIA 4NXMO 1L0NH 3VQYA 5HHIA 1SESA 2LO1A 1ZQHA 3RGBA 3AEIA 4F6RB 3K5LA 3JAKB 3SYCA 5IIKA 3RH6A 4KLHA 3E2EA 1EN5A 2ZH1A 1U97A 1KDHA 3UCSC 2Q7GA 4JAVA 2N05A 1HNXB 4K4GA 2XUMA 3L73H 3I55V 3FFQA 3TJTA 8ICWA 4GT1A 3K3WA 2EIJB 3AG1B 5LHIA 2WLKA 4NLZA 1YCIA 1F7YA 2E5LB 5J0SA 5J2GA 2Q5ZA 1NQTA 2M2TA 8ICFA 4LF8B 3MGIA 3RWRD 4LR3A 5FLXN 2JEXA 3R66A 1JQ0A 1E1RG 5L3CA 4WF9V 1AP5A 1QHTA 3RYHB 4HBNA 1NKDA 1EN4A 1I94O 4U3FH 4RQEA 9ICAA 5AG2A 1HNZO 2RJZA 4CH6A 3JALB 1FFTB 1NR7A 2XAQA 2DYSB 3C2LA 3SPCA 1RSOA 1HUZA 4CH4A 2ZD9A 4CH5A 1N4CA 3CCVV 2ISOA 4UAYA 2EIJC 1MMMA 3OMNB 1XNQB 3SPJA 2JRIA 4AHCA 2JS3A 3STLC 1S72V 1Y76A 2HFEC 4DR6O 2CGOA 5IIOA 3MCRA 2BTOA 1XQ8A 4OAFA 1G4YB 2Q69A 2IJHA 2ZH6A 5JVDA 3TGUH 7ICTA 2HN2A 5E1AC 2HVKC 4JI1O 3CEIA 3LSSA 4X64O 5HFMA 1NT2B 4S3NA 2A7WA 1GAXA 5KUKA 3SYPA 4LVSA 4GYCB 2VQFO 2DYSC 4NXUA 5D63A 3G67A 4FLTA 1QR9A 5K1PA 1R6TA 2DW4A 2YEVA 4OAHA 4IQUA 1ROPA 1ZL8A 5J0XA 1KP2A 1V9PA 2A0LA 5KMGA 3JARA 4DR1O 5LP6A 4FMTA 1VF6A 4XJEA 3RT3C 5HREA 1VQ5V 2EINB 4FLYA 5KX5B 3MGHA 3CMEV 1SA0B 2ATKC 2BTQB 2O5AA 3JCZA 4IIJA 1P84F 4ICGA 4TV9B 3E8FA 4NXXA 4I2CA 5ITZB 4Q6GA 4X4UA 2F1MA 4RWPA 2LQTA 5DN6G 1I7FA 2V1DA 4O5KA 3ZN1A 2QM7A 2DQ3A 1JFFA 4O4LB 4EB6A 4TT3G 3B4SA 4BWAA 3K08A 4LNUA 2X6CA 2M2WA 1QBZA 4XQ7A 2CE4A 2ZDIA 4K0KB 4DR7O 4DR2O 1OV9A 4O68A 4FZ1A 1X59A 4X4TA 4I7ZB 4JYCA 3WB1A 4XUSA 9ICQA 2VANA 5J2UB 3A0BZ 3B09A 4MFCA 1BT8A 7ICFA 5JH7B 1ZJNA 4WFHA 9ICPA 1N33B 1YI2V 3AG7A 4CC5A 5D4BA 5IILA 4NY8A 4LEYA 4RQ3A 3K0DA 1XDCA 3G6EV 3JSNA 5CFTA 2JIZG 2YI8A 3FAVA 4JI3B 1KU9A 2WLLA 4TOIA 1TVKB 4RQ1A 3BRCA 1RP3B 1B06A 1WB8A 2Q9LA 3UXOA 5CA1A 4DOAA 3JATA 1BZKA 4BAYA 4UD4A 5LYJA 4CS4A 1KC8W 1KKDA 4M9HA 1K73W 4MW8A 3OVBA 4DK1A 4F4LA 2W9MA 5TZVA 4CH3A 3R65A 3VQXA 4O6AA 2ISPA 4LP8A 4JYAO 4KL1A 8ICEA 1TUEB 2EZOA 3NR7A 1ZAUA 2WA3A 1ZTEA 5D61A 2UXDB 1PNKA 3F7YC 2PYLA 3MBYA 1LR1A 2HHHB 1D5AA 9ICUA 4X1IA 4P9OA 3JCFA 5J2CA 1ZQPA 4X4NA 1SQGA 2P5OA 4DV6O 5DDYA 3H9VA 3J7AU 2B5UA 2EIKC 2V4DA 4DOBA 3AQMA 4DV0B 1YVWA 1QCEA 2ZH5A 1AR1B 2BPCA 3IAYA 3HW8A 4JV5B 3BA9A 2JGUA 3N27A 2JJ1G 4IHJA 3OVAA 2GDSA 2ADQB 3U10A 4B7EA 2RNBA 1AJQA 3ETEA 2IHOA 1XSNA 5IYCO 1XHZA 4OPAA 5JCOA 3CRAA 3PJSK 4LEZA 5EYPA 4O4IA 4PA4A 3E8GA 1NVPD 4B3RB 5H6QA 2KSDA 3ER9B 5FL7G 1KYOF 4GKJB 3K5MA 1PPJH 1JQRA 1S3JA 4O2AA 2PZSA 2F95B 1OZ0A 2PFNA 4ZI7A 2DR9A 9ICLA 4QZCA 3GWOA 3WG7B 3FYIB 4J9ZB 1RM1B 5J0RA 4DUYB 4PJ0Z 4Z2WA 1NTMH 4TUSA 2DMXA 4UCOA 1Q8IA 9ICBA 5J2TA 2QWPB 4O9MA 3SJCC 5J0QA 2P6JA 2NLJC 4DV5O 2Q6AA 1WOTA 3RJGA 2E74B 4NTXA 3GB7C 1CEZA 4P4MA 1V54B 4FJCC 3BY6A 1MSDA 2I9GA 1P4RA 4K96A 4P2ZA 1GTOA 3ZMTA 4JI6O 2YEVB 4NXNO 1YEWA 1ZL8B 5LBQA 1RM1C 5IINA 4WBNB 2UU9O 3HKCA 2JGDA 7ICGA 4PA6A 2VWJA 5J0WA 5C8YA 3SYQA 3L71H 4O4HA 1HNZB 3K06A 5LP6B 1DTOA 1GN4A 2OTLV 1M93A 1OJHA 7ICRA 2JS5A 8ICMA 2EILB 4IIJB 4NKUA 3ZHUA 4ZHQA 1HNXO 3N2KA 5IWAB 3ICXA 5L3DA 1V54C 1FFXA 3JPRA 5HFLA 2XAGA 4KLQA 5C93A 4QZEA 4K8XA 3C3TA 1SS3A 2ZQMA 2H8PC 4WC1A 2IHMA 2QJ1A 2B1IA 3RJFA 3EFFK 1F4MA 2GV9A 1E1QG 4X64B 5J2EA 1TVAA 5LP6C 4B3SB 1VF6C 3PN1A 4WBZA 1CP9A 2UXXA 1H2KA 5HRBA 4DUZO 4PA9A 3L70H 5JQGA 5CHGA 1AR4A 2VQEO 2EILC 3AQLA 3ZIAG 2ZIMA 4RO2A 5KAFZ 1XMOB 1IBMO 2GA9D 4EEDA 1YHQV 1J5EB 2ZH9A 2AXTZ 3TK1A 4UCUA 3FAVB 3OR6C 2XASA 1WN7A 2Y48A 4OPHA 2WLLB 4RPYA 2B9ZA 1F23A 5HRHA 1ZQFA 3FB5C 1N32O 2HN1A 4KLEA 5B1NA 5DDMA 4MW3A 3FB6C 4BW9A 3ZRVA 5CA1B 3JATB 3WFRE 2ZDIC 5IT9N 3A2FA 4PGQA 2F93B 5LYJB 4B3TB 1R8CA 2UXCB 3B77A 2DR7A 2YIBD 4N7RA 5J2DA 2WSSG 5BY1A 1R8BA
chains in the Genus database with same CATH topology
5CB1A 4I2BA 4M5DA 4XRHA 8ICNA 4UBCA 1ZQEA 4KLTA 4MF2A 1ZQCA 2ZH3A 2M2VA 4ATBA 3UQ2A 3L9DA 4XQ8A 4LT6A 1ZQXA 4RWOA 4UB5A 3TFSA 1R8AA 1KNYA 5HRGA 3PNCA 5HHHA 1BPZA 4NKTA 3RJHA 3B0YA 4X4RA 4Z6FA 1UETA 4TUQA 3HX0A 7ICOA 2FMPA 5HRFA 5J2AA 2ID1A 5J0PA 1RZTA 1V4AA 4FHVA 5DB8A 4RPZA 5D49A 4RT2A 4WC5A 4GXJA 3V72A 1PX5A 2ZH7A 5J2FA 9ICIA 3V7JA 7ICUA 4E8FA 1ZQHA 5HHIA 3HIYA 4I2AA 4R65A 5DEDA 4RQ4A 4M47A 4KLGA 4R64A 5IIKA 3RH6A 4KLHA 5J29A 4M9GA 2ZH1A 1KDHA 3WFOA 4PHPA 3C2MA 7ICKA 1MIYA 1ZQAA 4K4GA 4E80A 4X5VA 8ICWA 3C66A 4MFAA 3ISDA 9ICEA 3C5FA 4UAZA 3WFQE 4NLZA 2HHPA 4O5CA 5J0SA 2BPFA 4RQ8A 5J2GA 4I2DA 3OVSA 8ICFA 2M2TA 4YD1A 3MGIA 1ZQNA 4KLMA 5DB9A 2ZH8A 4PPXA 4LZDA 9ICHA 4EBKA 4WC3A 4NM2A 3UXNA 1MIWA 5DKWA 4PHDA 1ZQKA 5HRKA 9ICNA 8ICJA 5BPCA 9ICAA 3UQ0A 2ZH4A 5J0TA 3WFSC 4WBYA 9ICJA 3C2LA 9ICWA 1HUZA 4AT8A 2PFPA 3H37A 1MQ3A 2BCSA 4X4PA 3TFRA 5DB6A 2ISOA 9ICKA 4UAYA 3RJEA 1ZQOA 3JPSA 5CP2A 1YLQA 1TFWA 4XA5A 5EOZA 5IIOA 5DBBA 1FA0A 8ICRA 4IQVA 2ZH6A 5HRLA 4AT9B 4R66A 7ICTA 1ZQUA 4PHEA 4FHPA 2BCUA 4NXZA 4NLNA 4S3NA 4RQ7A 4MF8A 4LVSA 8ICBA 3GDXA 5D46A 3HWTA 1KEJA 4I28A 1ZQDA 9ICFA 4IQUA 4X4QA 5J0XA 1BPXA 9ICRA 4QZBA 4FHYA 1ZQLA 5J2HA 7ICVA 4PHAA 4O5EA 4RPXA 4MFFA 5HREA 5HRIA 1HUOA 3MGHA 2NRKA 2Q66A 4M04A 2O5AA 4I2CA 3C18A 2DRAA 9ICVA 3OUYB 1RPLA 4QZ8A 4X4UA 3UPQA 4DOCA 2DR8A 5F2VO 4RWPA 3RJJA 3RH4A 4O5KA 8ICHA 1ZQVA 9ICTA 1VJ7A 4M9LA 4I2IA 4Z6DA 3UXPA 2M2WA 8ICOA 4XQ7A 3H3AA 5J2KA 3LK9A 4X4TA 3C5GA 4M9NA 2DRBA 4XUSA 9ICQA 2VANA 4UB3A 5DBCA 4FO6A 4F5OA 4MFCA 4AT7B 4YD2A 3AU6A 1ZQRA 3ISCA 7ICFA 7ICHA 4E7XA 1ZJNA 9ICPA 8ICYA 4WCWA 5D4BA 5IILA 4IQWA 4NY8A 4RQ3A 4Z6EA 4I27A 1UEVA 8ICQA 5CWRA 4P2HA 5BOLA 2PXIA 1VFGA 4ATBB 4KLFA 4RQ1A 2ZH2A 3UXOA 4DOAA 1ZQBA 3AQNA 4RQ5A 8ICAA 4JWMA 1NOMA 4UD4A 1XSLA 9ICSA 5IIMA 4M9HA 8ICSA 4TURA 3OVBA 2W9MA 5TZVA 2FMSA 3ISBA 5HR9A 1ZQQA 4QZ9A 5J2JA 2ISPA 3C2KA 4F5NA 8ICEA 4QZHA 3MDAA 4P4OA 8ICKA 4X4VA 5DB7A 3MBYA 4IQTA 7ICEA 1XSPA 9ICUA 5J2CA 5J0UA 1TFYA 1OU5A 4FHWA 1BPDA 1ZQPA 4X4NA 1ZQGA 4RQ6A 4YMMA 5DDYA 3MDCA 4F5QA 4DOBA 3AQMA 3AUOA 4RQ2A 4WC4A 2BCQA 2O1PA 2ZH5A 2BPCA 1Q78A 3V7LA 4R63A 3HW8A 4QZGA 4F5RA 3OUYA 8ICVA 4GXIA 1JAJA 4RT3A 4GXKA 5J0YA 5J2BA 4UB4A 3H38A 3OGUA 1MQ2A 3JPTA 3OVAA 2PBEA 4WC7A 3AU2A 3WFPA 7ICPA 3JZ0A 1ZQTA 3JPPA 1ZQJA 4I29A 4WC2A 1XSNA 2GWSA 2BCVA 3H39A 5CR0A 5J0OA 4KLDA 4X4OA 3JPOA 3PMNA 4X0BA 4FHXA 5BOMA 4M9JA 4K4HA 7ICJA 1JQRA 1ZQYA 4NM1A 3V7KA 5CA7A 2DR5A 4AT8B 1BPEA 2PFNA 2DR9A 4PGYA 9ICLA 8ICCA 4QZCA 4PH5A 2RFFA 3LQCB 5J0RA 4QZAA 4TUSA 1JN3A 9ICBA 4JWNA 4O9MA 8ICZA 8ICLA 5J0QA 7ICLA 5J2IA 4FH5A 5HRDA 1F5AA 2DVIA 1WOTA 4I2FA 5CJ7A 4I2JA 3RJGA 9ICCA 4F5PA 9ICXA 4WC6A 5IIIA 1MIVA 5HC9A 4QZDA 4P4MA 9ICGA 3NYBA 2I9GA 2ZHBA 7ICMA 4UB2A 4YN4A 1BPBA 5DECA 2ZHAA 1ZJMA 2PFQA 3RH5A 5IINA 4IG8A 4KLJA 8ICUA 4RQ0A 4QZIA 7ICGA 5J0WA 1Q79A 3JPNA 4I2GA 8ICPA 9ICMA 4QZFA 4AT9A 1JMSA 4EP7A 1ZQMA 2BE3A 1UEUA 7ICRA 8ICMA 4X0AA 4NKUA 4LZGA 3OV7A 2P66A 7ICIA 1ZQZA 3RJKA 7ICSA 9ICOA 4PGXA 4YMOA 3JPRA 4KLIA 4YCXA 3RJIA 4KLQA 4TUPA 4QZEA 2FMQA 2BCRA 8ICXA 7ICQA 4KLSA 1BPYA 4WC0A 4WC1A 4M2YA 2IHMA 3RJFA 7ICNA 8ICGA 4K4IA 4NLKA 4UBBA 4Z6CA 3K75D 3JPQA 1TVAA 5J2EA 3PMLA 4WBZA 4KLLA 5HRBA 1R89A 4UD5A 4EBJA 5CHGA 5IIJA 1ZQIA 3AQLA 3B0XA 1ZQWA 4M0AA 2PFOA 4RWNA 4P4PA 4UAWA 1TV9A 2ZH9A 4I2HA 4FH3A 1NO5A 4RPYA 3AQKA 8ICIA 3UPSA 3HJ4A 5HRHA 1ZQFA 4DO9A 3JYYA 5DBAA 4KLEA 4KLOA 5DDMA 1ZQSA 4KLUA 4UB1A 3WFRE 2M2UA 4I2EA 4PGQA 1R8CA 8ICTA 2DR7A 2BPGA 4AT7A 5J2DA 4X4SA 4YMNA 3HJ1A 4RWQA 1R8BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CB1 A;  4I2B A;  4M5D A;  4XRH A;  8ICN A;  4UBC A;  1ZQE A;  4KLT A;  4MF2 A;  1ZQC A;  2ZH3 A;  2M2V A;  4ATB A;  3UQ2 A;  3L9D A;  4XQ8 A;  4LT6 A;  1ZQX A;  4RWO A;  4UB5 A;  3TFS A;  1R8A A;  1KNY A;  5HRG A;  3PNC A;  5HHH A;  1BPZ A;  4NKT A;  3RJH A;  3B0Y A;  4X4R A;  4Z6F A;  1UET A;  4TUQ A;  3HX0 A;  7ICO A;  2FMP A;  5HRF A;  5J2A A;  2ID1 A;  5J0P A;  1RZT A;  1V4A A;  4FHV A;  5DB8 A;  4RPZ A;  5D49 A;  4RT2 A;  4WC5 A;  4GXJ A;  3V72 A;  1PX5 A;  2ZH7 A;  5J2F A;  9ICI A;  3V7J A;  7ICU A;  4E8F A;  1ZQH A;  5HHI A;  3HIY A;  4I2A A;  4R65 A;  5DED A;  4RQ4 A;  4M47 A;  4KLG A;  4R64 A;  5IIK A;  3RH6 A;  4KLH A;  5J29 A;  4M9G A;  2ZH1 A;  1KDH A;  3WFO A;  4PHP A;  3C2M A;  7ICK A;  1MIY A;  1ZQA A;  4K4G A;  4E80 A;  4X5V A;  8ICW A;  3C66 A;  4MFA A;  3ISD A;  9ICE A;  3C5F A;  4UAZ A;  3WFQ E;  4NLZ A;  2HHP A;  4O5C A;  5J0S A;  2BPF A;  4RQ8 A;  5J2G A;  4I2D A;  3OVS A;  8ICF A;  2M2T A;  4YD1 A;  3MGI A;  1ZQN A;  4KLM A;  5DB9 A;  2ZH8 A;  4PPX A;  4LZD A;  9ICH A;  4EBK A;  4WC3 A;  4NM2 A;  3UXN A;  1MIW A;  5DKW A;  4PHD A;  1ZQK A;  5HRK A;  9ICN A;  8ICJ A;  5BPC A;  9ICA A;  3UQ0 A;  2ZH4 A;  5J0T A;  3WFS C;  4WBY A;  9ICJ A;  3C2L A;  9ICW A;  1HUZ A;  4AT8 A;  2PFP A;  3H37 A;  1MQ3 A;  2BCS A;  4X4P A;  3TFR A;  5DB6 A;  2ISO A;  9ICK A;  4UAY A;  3RJE A;  1ZQO A;  3JPS A;  5CP2 A;  1YLQ A;  1TFW A;  4XA5 A;  5EOZ A;  5IIO A;  5DBB A;  1FA0 A;  8ICR A;  4IQV A;  2ZH6 A;  5HRL A;  4AT9 B;  4R66 A;  7ICT A;  1ZQU A;  4PHE A;  4FHP A;  2BCU A;  4NXZ A;  4NLN A;  4S3N A;  4RQ7 A;  4MF8 A;  4LVS A;  8ICB A;  3GDX A;  5D46 A;  3HWT A;  1KEJ A;  4I28 A;  1ZQD A;  9ICF A;  4IQU A;  4X4Q A;  5J0X A;  1BPX A;  9ICR A;  4QZB A;  4FHY A;  1ZQL A;  5J2H A;  7ICV A;  4PHA A;  4O5E A;  4RPX A;  4MFF A;  5HRE A;  5HRI A;  1HUO A;  3MGH A;  2NRK A;  2Q66 A;  4M04 A;  2O5A A;  4I2C A;  3C18 A;  2DRA A;  9ICV A;  3OUY B;  1RPL A;  4QZ8 A;  4X4U A;  3UPQ A;  4DOC A;  2DR8 A;  5F2V O;  4RWP A;  3RJJ A;  3RH4 A;  4O5K A;  8ICH A;  1ZQV A;  9ICT A;  1VJ7 A;  4M9L A;  4I2I A;  4Z6D A;  3UXP A;  2M2W A;  8ICO A;  4XQ7 A;  3H3A A;  5J2K A;  3LK9 A;  4X4T A;  3C5G A;  4M9N A;  2DRB A;  4XUS A;  9ICQ A;  2VAN A;  4UB3 A;  5DBC A;  4FO6 A;  4F5O A;  4MFC A;  4AT7 B;  4YD2 A;  3AU6 A;  1ZQR A;  3ISC A;  7ICF A;  7ICH A;  4E7X A;  1ZJN A;  9ICP A;  8ICY A;  4WCW A;  5D4B A;  5IIL A;  4IQW A;  4NY8 A;  4RQ3 A;  4Z6E A;  4I27 A;  1UEV A;  8ICQ A;  5CWR A;  4P2H A;  5BOL A;  2PXI A;  1VFG A;  4ATB B;  4KLF A;  4RQ1 A;  2ZH2 A;  3UXO A;  4DOA A;  1ZQB A;  3AQN A;  4RQ5 A;  8ICA A;  4JWM A;  1NOM A;  4UD4 A;  1XSL A;  9ICS A;  5IIM A;  4M9H A;  8ICS A;  4TUR A;  3OVB A;  2W9M A;  5TZV A;  2FMS A;  3ISB A;  5HR9 A;  1ZQQ A;  4QZ9 A;  5J2J A;  2ISP A;  3C2K A;  4F5N A;  8ICE A;  4QZH A;  3MDA A;  4P4O A;  8ICK A;  4X4V A;  5DB7 A;  3MBY A;  4IQT A;  7ICE A;  1XSP A;  9ICU A;  5J2C A;  5J0U A;  1TFY A;  1OU5 A;  4FHW A;  1BPD A;  1ZQP A;  4X4N A;  1ZQG A;  4RQ6 A;  4YMM A;  5DDY A;  3MDC A;  4F5Q A;  4DOB A;  3AQM A;  3AUO A;  4RQ2 A;  4WC4 A;  2BCQ A;  2O1P A;  2ZH5 A;  2BPC A;  1Q78 A;  3V7L A;  4R63 A;  3HW8 A;  4QZG A;  4F5R A;  3OUY A;  8ICV A;  4GXI A;  1JAJ A;  4RT3 A;  4GXK A;  5J0Y A;  5J2B A;  4UB4 A;  3H38 A;  3OGU A;  1MQ2 A;  3JPT A;  3OVA A;  2PBE A;  4WC7 A;  3AU2 A;  3WFP A;  7ICP A;  3JZ0 A;  1ZQT A;  3JPP A;  1ZQJ A;  4I29 A;  4WC2 A;  1XSN A;  2GWS A;  2BCV A;  3H39 A;  5CR0 A;  5J0O A;  4KLD A;  4X4O A;  3JPO A;  3PMN A;  4X0B A;  4FHX A;  5BOM A;  4M9J A;  4K4H A;  7ICJ A;  1JQR A;  1ZQY A;  4NM1 A;  3V7K A;  5CA7 A;  2DR5 A;  4AT8 B;  1BPE A;  2PFN A;  2DR9 A;  4PGY A;  9ICL A;  8ICC A;  4QZC A;  4PH5 A;  2RFF A;  3LQC B;  5J0R A;  4QZA A;  4TUS A;  1JN3 A;  9ICB A;  4JWN A;  4O9M A;  8ICZ A;  8ICL A;  5J0Q A;  7ICL A;  5J2I A;  4FH5 A;  5HRD A;  1F5A A;  2DVI A;  1WOT A;  4I2F A;  5CJ7 A;  4I2J A;  3RJG A;  9ICC A;  4F5P A;  9ICX A;  4WC6 A;  5III A;  1MIV A;  5HC9 A;  4QZD A;  4P4M A;  9ICG A;  3NYB A;  2I9G A;  2ZHB A;  7ICM A;  4UB2 A;  4YN4 A;  1BPB A;  5DEC A;  2ZHA A;  1ZJM A;  2PFQ A;  3RH5 A;  5IIN A;  4IG8 A;  4KLJ A;  8ICU A;  4RQ0 A;  4QZI A;  7ICG A;  5J0W A;  1Q79 A;  3JPN A;  4I2G A;  8ICP A;  9ICM A;  4QZF A;  4AT9 A;  1JMS A;  4EP7 A;  1ZQM A;  2BE3 A;  1UEU A;  7ICR A;  8ICM A;  4X0A A;  4NKU A;  4LZG A;  3OV7 A;  2P66 A;  7ICI A;  1ZQZ A;  3RJK A;  7ICS A;  9ICO A;  4PGX A;  4YMO A;  3JPR A;  4KLI A;  4YCX A;  3RJI A;  4KLQ A;  4TUP A;  4QZE A;  2FMQ A;  2BCR A;  8ICX A;  7ICQ A;  4KLS A;  1BPY A;  4WC0 A;  4WC1 A;  4M2Y A;  2IHM A;  3RJF A;  7ICN A;  8ICG A;  4K4I A;  4NLK A;  4UBB A;  4Z6C A;  3K75 D;  3JPQ A;  1TVA A;  5J2E A;  3PML A;  4WBZ A;  4KLL A;  5HRB A;  1R89 A;  4UD5 A;  4EBJ A;  5CHG A;  5IIJ A;  1ZQI A;  3AQL A;  3B0X A;  1ZQW A;  4M0A A;  2PFO A;  4RWN A;  4P4P A;  4UAW A;  1TV9 A;  2ZH9 A;  4I2H A;  4FH3 A;  1NO5 A;  4RPY A;  3AQK A;  8ICI A;  3UPS A;  3HJ4 A;  5HRH A;  1ZQF A;  4DO9 A;  3JYY A;  5DBA A;  4KLE A;  4KLO A;  5DDM A;  1ZQS A;  4KLU A;  4UB1 A;  3WFR E;  2M2U A;  4I2E A;  4PGQ A;  1R8C A;  8ICT A;  2DR7 A;  2BPG A;  4AT7 A;  5J2D A;  4X4S A;  4YMN A;  3HJ1 A;  4RWQ A;  1R8B A; 
#chains in the Genus database with same CATH topology
 3QO7 A;  1QQC A;  3BAB A;  5IY5 B;  3C3S A;  5CB1 A;  1Z5V A;  4XDJ A;  8ICN A;  4UBC A;  4MF2 A;  4IT5 A;  3OFN G;  4X1I B;  3ZMV A;  4BIO A;  1QVG U;  4I4T A;  4DR7 B;  4NXV A;  2ZH3 A;  5KHK A;  1GN3 A;  2M2V A;  4NXW A;  4QPJ A;  3SPI A;  1SQP H;  3L9D A;  2ZR2 A;  4RWO A;  4LF5 B;  4B3M B;  2LGW A;  1TUB B;  2VWK A;  2QWR B;  5IDJ A;  2UUC B;  3PNC A;  3EXA A;  3RJH A;  2X7R B;  4FM2 A;  1KD1 W;  1GMG A;  1MG1 A;  1BGY H;  1UET A;  1N0J A;  2FMP A;  4GLX A;  4KUM A;  4IHJ B;  5J0P A;  2CGN A;  2LW1 A;  5DB8 A;  3L72 H;  5D49 A;  2OCC B;  1XNR O;  4WC5 A;  5LXT A;  3N2G A;  4X88 A;  5IY5 C;  2ZH7 A;  2WPD G;  1IBK B;  3JYC A;  3UT5 A;  5J2F A;  1Q82 W;  9ICI A;  7ICU A;  4FM0 A;  4BIU A;  2ITC C;  1UJW B;  4E8F A;  2QGN A;  4DRX A;  2AHZ A;  1DLB A;  4I2A A;  1S5H C;  5DED A;  4M47 A;  1AJP A;  4KLG A;  4P30 A;  3CX5 F;  1FJG O;  3W7U A;  1KB9 F;  1WPB A;  3RW0 A;  4LEV A;  3C66 A;  3I56 V;  3ISD A;  4JZ2 A;  4ZI7 B;  4O5C A;  3HKE A;  4JI2 O;  5CA3 A;  4MTF A;  1FAF A;  1KKC A;  3CP1 A;  4AQY O;  2Q0A A;  1ZQN A;  2ZH8 A;  3JAS A;  2OCC C;  4UCR A;  4PPX A;  1Q6I A;  2IU0 A;  1DF5 A;  1BL8 A;  4EBK A;  3ABM B;  4PA3 A;  4EFE A;  2CUG A;  1MIW A;  4JI3 O;  1QNM A;  4PHD A;  1YTF D;  1ZQK A;  1QLN A;  1F51 A;  5HRK A;  8ICJ A;  1N0N A;  3ML0 A;  1VQL V;  4WBY A;  9ICJ A;  1NI8 A;  2PFP A;  4ZIB A;  1MQ3 A;  1GK9 A;  4X4P A;  3TFR A;  3OD4 A;  5LA6 B;  3IC7 A;  3CCR V;  4UB8 Z;  1WLE A;  3RJE A;  3VBB A;  3RYI A;  1K97 A;  3VOU A;  3AG4 B;  3ZMU A;  1AJN A;  2YXY A;  4MVQ A;  4HX0 A;  3T1Y O;  1H8H G;  2HHH O;  2Q73 A;  4PI0 A;  4EGW A;  1XIL A;  4NTW A;  5C8Y B;  2ZIN A;  1TGO A;  5HRL A;  1IVS A;  4R66 A;  3ER8 C;  1QR8 A;  1N34 B;  1Z5W A;  3K5O A;  2H94 A;  4K98 A;  2ETN A;  1SF9 A;  4NXZ A;  4QPK A;  1WA8 A;  2WLI B;  2XND G;  3QG5 A;  4LF7 B;  4DYL A;  4ZHQ B;  2M6Y A;  3N2K B;  1NH2 B;  3NXS A;  1K8A W;  1KEJ A;  4I28 A;  4XDL A;  3CRM A;  5LHG A;  1FFX B;  1BS3 A;  2N74 A;  1U96 A;  1L1F A;  3BVO A;  2OIG A;  9ICR A;  2X6A A;  4A5U B;  3CC2 V;  1ZQL A;  3E22 A;  4DV5 B;  3AG4 C;  7ICV A;  2P67 A;  4RPX A;  1VF5 B;  2EJ7 A;  1SQV H;  2F4V O;  5KHJ A;  1AI4 A;  2NRK A;  3M99 B;  2IM9 A;  4I55 A;  1LUV A;  2R70 A;  4B3R O;  2R9R B;  4DV4 B;  4MVU A;  3OUY B;  1RPL A;  3UPQ A;  3ZHR A;  4ZOL B;  2QTS A;  4GKJ O;  2ZE8 A;  4FK5 C;  5F2V O;  4NYK A;  3JSL A;  5CA0 B;  5GTI Z;  4DW0 A;  3HKD B;  4NXN B;  1B04 A;  1R3I C;  2Q67 A;  4I2I A;  4Z6D A;  2UU9 B;  4YJ3 A;  3UO2 A;  1IDS A;  3EVK A;  1VQ7 V;  1Y74 B;  4DUY O;  1B3Q A;  3AK2 A;  3T4Z A;  1YXB A;  3LK9 A;  2LW7 A;  4DR4 O;  3LDC A;  4WH5 A;  4M9N A;  2Q7E A;  1D5N A;  1RPR A;  2AHY A;  4F5O A;  3Q4H A;  5CFU A;  3ISC A;  4E7X A;  3RVZ A;  2P22 C;  2QSA A;  4FLU A;  2DQ0 A;  5B1O A;  2ZNJ A;  3ZRS A;  3J80 N;  2XAH A;  2QTO A;  3UO3 A;  1GO3 F;  1VQO V;  4I4T B;  4FPP A;  4AI8 A;  5CB4 B;  2PXI A;  1VFG A;  1VP7 A;  3AG2 B;  2ZH2 A;  4JAA A;  1ZQB A;  4RQ5 A;  4JWM A;  3K5N A;  4PV1 B;  8ICS A;  4DR5 B;  1Z2G A;  4DUZ B;  2WAM A;  2ZE7 A;  3ZX6 A;  2VQE B;  3AK1 A;  2R9I A;  1E79 G;  1IBM B;  1R3K C;  1NU1 H;  4PDM A;  4JZG A;  8ICK A;  4X4V A;  5DB7 A;  7ICE A;  5LXT B;  2XT9 A;  4IQT A;  2UUA B;  4EFB A;  5JJN B;  4D7T A;  1TFY A;  1EZJ A;  4JLX A;  1BPD A;  5IWA O;  3ABT A;  1N32 B;  4DRX B;  5KA6 A;  4WFF A;  4LEW A;  4WC4 A;  2XAJ A;  3AG2 C;  1BHA A;  2BCQ A;  1UPG A;  4EEB A;  2F66 C;  4MTO A;  3WFV A;  1M5I A;  4CBC A;  4FFB B;  4RUE A;  2BBH A;  8ICV A;  1THZ A;  3WB2 A;  3B40 A;  4EEQ A;  3W7X A;  2EZP A;  1NJI W;  1MQ2 A;  4UVB A;  4B3S O;  3HKE B;  3JZ0 A;  1PKX A;  5LHH A;  1ZQJ A;  4I29 A;  1Y67 A;  4WC2 A;  3JAS B;  1XMO O;  2CH7 A;  4TSF G;  2BCV A;  3E83 A;  5FNV A;  2DN9 A;  1J5E O;  5CR0 A;  5CFS A;  3CCS V;  5KHI A;  4E4E A;  5BXZ A;  1EN6 A;  5BOM A;  2GAF D;  4G28 B;  1YJ9 V;  4M9J A;  1GM9 A;  4JLZ A;  2FYU H;  3FKS G;  4B3T O;  4NM1 A;  2UXC O;  1XNR B;  4I0X A;  3E35 A;  5H5N A;  4PGY A;  3E86 A;  2GHY A;  1ARO P;  3ETD A;  3RYI B;  1JN3 A;  1XI1 A;  2RN9 A;  4O67 A;  2NR5 A;  1CXZ B;  1XRE A;  8ICZ A;  2F43 G;  1FJG B;  5J2I A;  3W7T A;  4FLV A;  1BSM A;  2DVI A;  5BR8 O;  3O9O A;  2Y69 B;  2A3Q A;  1AP6 A;  4LF5 O;  4B3M O;  5A9G A;  1Q90 D;  3SJQ C;  4RUF A;  2UUC O;  4TWK A;  4JI2 B;  1WA8 B;  3U0Z A;  4K8Z A;  1H2G A;  4AQY B;  3CJH A;  4GKK O;  1OCR B;  5TIS Z;  3QO5 A;  2PFQ A;  4TQD A;  4NTY A;  1EBO A;  3K04 A;  1PV0 A;  3DC5 A;  2B4V A;  1H8E G;  2EIK B;  1IBK O;  4KHP O;  4LF4 B;  4QZF A;  4LH7 A;  4AT9 A;  2OCH A;  1JMS A;  4EP7 A;  2IJJ A;  2FKX A;  2XTA A;  2KQX A;  3H1K H;  1ZQM A;  4JTC B;  1UEU A;  2Y69 C;  5L3E A;  1XEQ A;  4LZG A;  3TXQ A;  3ASN B;  7ICI A;  2GSM B;  4Q20 A;  1ZQZ A;  2YXH A;  3T1H B;  5B3Q A;  1GN6 A;  1I5X A;  2KB1 A;  4J7K A;  3BFR A;  4QJF B;  4YHH B;  2BBJ A;  4YMO A;  4JI8 B;  4WQL A;  2IU3 A;  3ETG A;  3T1Y B;  4YJ3 B;  3RJI A;  3SJB C;  2IH1 C;  1HNW O;  1OCR C;  1IUR A;  1K92 A;  2Q8V A;  2MW2 B;  3WU2 Z;  8ICX A;  3ABL B;  3BPZ A;  2DYR B;  4YJ2 A;  2HLD G;  4KLS A;  4B7K A;  4WC0 A;  5LOV A;  4KB6 A;  8ICG A;  4UBB A;  1XHX A;  3CCM V;  3Q4H B;  3RVY A;  1SQF A;  3JD1 A;  5IIJ A;  4FIP C;  3F5T A;  1NH2 D;  1AR5 A;  5KUM A;  3B0X A;  4U7O A;  3ASN C;  3G71 V;  1K9M W;  3CHX A;  4J7Z A;  2QEX V;  1AVM A;  2EIM C;  2Z0A A;  4X65 B;  3UPS A;  8ICI A;  2M7W A;  2P06 A;  1K5S A;  3DC6 A;  4DO9 A;  3JYY A;  5DBA A;  2F4V B;  1WPX A;  3APQ A;  3QF7 A;  4R6Z A;  3ABL C;  1SRY A;  1URF A;  2DYR C;  3RYF A;  4RQF A;  4K99 A;  3RFR A;  3OWG A;  4AT7 A;  3CCJ V;  4UCV A;  4YMN A;  5B3S B;  1N34 O;  3HJ1 A;  4RWQ A;  3JD4 A;  1VQM V;  4I2B A;  1RSO B;  4M5D A;  4XRH A;  4YIO A;  1O9G A;  1ZQE A;  1YIJ V;  1K34 A;  4LF7 O;  1P49 A;  4FLX A;  1S76 D;  2ADP A;  3H1H H;  3CC7 V;  4PI2 A;  1W0J G;  1K7D A;  4KXR A;  1H2N A;  1JPX A;  3SGI A;  2WLJ A;  4JYB A;  4J80 A;  4DR4 B;  5IE9 A;  1ZQX A;  3T4D A;  1YIT V;  4UB5 A;  2Y0I A;  4G27 B;  1VQ6 V;  1Y76 B;  2QA4 V;  1COW G;  1HR0 O;  2G38 A;  1R8A A;  2GUZ A;  5HRG A;  1WP7 A;  2QWN B;  2HJF C;  4NKT A;  1SKV A;  1BE3 H;  5JVD B;  2W6J G;  1QLE B;  2YIA A;  1V55 B;  3KZI Z;  4X4R A;  2XHB A;  4Z6F A;  4TUQ A;  1I0H A;  3K0G A;  2GTA A;  5BMV A;  5HRF A;  3HKB A;  1FYJ A;  4WFE A;  4LCU C;  4RT2 A;  5B3S C;  4DV4 O;  4AIL C;  3OM3 B;  2IJK A;  3V7J A;  3ZMS A;  2CH7 B;  4H33 A;  4KM5 A;  1K3E A;  2E76 B;  1PD3 A;  4MKP A;  1VQ9 V;  4R65 A;  3ZRW A;  4YY3 O;  1OCC B;  3JAR B;  5KMG B;  2DE0 X;  3ZHT A;  3WFO A;  4I50 A;  1FXV A;  2CTQ A;  4J42 A;  3CCL V;  1G8M A;  1FPO A;  2ODM A;  1IX9 A;  1Q43 A;  1QLE C;  3OTF A;  1V55 C;  4EKW A;  4I0X B;  3OUF A;  2HHP A;  1MZF A;  2BPF A;  4RQ8 A;  1SZX A;  4LWS A;  5LGT A;  4I2D A;  1NZ6 A;  1RFY A;  2EWR A;  2ZT9 B;  4KLM A;  2KG7 A;  5DB9 A;  4FFK A;  4OGQ B;  1JFF B;  4EB6 B;  4LZD A;  3OR7 C;  4LNU B;  5DKW A;  5D5Q A;  5EC2 C;  1JJ2 U;  4J7J A;  1S77 D;  5BPC A;  3FYE B;  3ZHQ A;  1OCC C;  9ICW A;  1MSW D;  2AGA A;  3PHZ A;  1K4C C;  2BCS A;  4DR5 O;  5DB6 A;  3CJH B;  4P9P A;  3OUS A;  3OTO B;  5CP2 A;  2LFS A;  2PI5 A;  3HR0 A;  1US6 A;  4FLW A;  4JI7 O;  2UUA O;  4NXT A;  1KBH A;  5EOZ A;  4TUY A;  2D3O W;  1Q7Y W;  1FA0 A;  4PD4 F;  5CBG A;  8ICR A;  4AT9 B;  4DV2 B;  2F23 A;  3F7V C;  3IJ4 A;  1PL4 A;  2Z5U A;  1ZQU A;  5H9C A;  2EUL A;  4PHE A;  3HB3 B;  4MTX A;  5GON A;  2UXB O;  4FHP A;  2BCU A;  1FS0 G;  2R9A A;  1ENV A;  2OWO A;  2CTW A;  4MF8 A;  1XL6 A;  5KHG A;  3CS5 A;  2B56 A;  2ZXW B;  3GDX A;  1WAZ A;  4HYO A;  1YJN V;  2JEU A;  1L0L H;  3H1I H;  2BOC C;  4X4Q A;  4IYI A;  3CCE V;  4H37 A;  4MTG A;  2O57 A;  3OMI B;  3AK3 A;  4QZB A;  4FHY A;  3APO A;  5J2H A;  3F5W C;  4F6R A;  3K79 A;  5JJJ B;  1O9H A;  2V7Q G;  5JJE B;  5BR8 B;  4I9W A;  3W7W A;  3ETQ A;  2GTS A;  4Z1M G;  5HRI A;  1W2B U;  5LOV B;  2E75 B;  1HUO A;  1ZLZ A;  2LP7 A;  1VEW A;  1PNL A;  4X9Q A;  2WWW A;  3C18 A;  3ZS8 C;  4L87 A;  4QZ8 A;  4DOC A;  2DR8 A;  3T2M A;  4GKK B;  1ZSP A;  3RJJ A;  8ICH A;  3E8H A;  1FXK A;  1VJ7 A;  4M9L A;  4H44 B;  2JVD A;  5KHH A;  3UXP A;  4PDV A;  2ZXW C;  3C90 A;  8ICO A;  4KHP B;  4LF6 B;  3H3A A;  5LMU B;  4K35 A;  5J2K A;  2YXL A;  3MDS A;  5EYP B;  4O4I B;  4OAG A;  3E8B A;  5B3P A;  1JVM A;  4JI4 O;  2DRB A;  4J10 A;  3D3I A;  5DBC A;  2ZE5 A;  2RDC A;  2VS0 A;  1MAB G;  4AT7 B;  3AU6 A;  1ZQR A;  1GKF A;  4J41 A;  3H1J H;  4O2A B;  1VQ4 V;  1N36 B;  4IQW A;  2P4K A;  2EBO A;  1GRJ A;  1HNW B;  1ORQ C;  4Z6E A;  2CTP A;  4LH6 A;  1UEV A;  3P32 A;  4CS2 A;  8ICQ A;  4G2K A;  2PUS A;  4UXN A;  3ZBH A;  2ZM6 B;  1WNS A;  2XAF A;  1A32 A;  2AZ0 A;  3AQN A;  8ICA A;  1D2D A;  5J2T B;  1VMG A;  2GUZ B;  3G6B A;  1JX9 A;  4QIW F;  5JCO C;  3OGC C;  4TUR A;  4LF9 O;  3OGI B;  2LGQ A;  2FMS A;  4LF4 O;  1KP3 A;  4X66 O;  1B6Q A;  2A9H A;  3CK6 A;  3ISB A;  1ZQQ A;  4OX9 B;  5J2J A;  3C2K A;  3LSU A;  4F5N A;  5BMV B;  1OCZ B;  4QZH A;  4UUJ C;  3MDA A;  5LMN O;  4UCT A;  3FX7 A;  3T1H O;  3LUT B;  1SQQ H;  3ZHS A;  1OU5 A;  4FHW A;  3M7M X;  4YHH O;  1XL4 A;  4JI8 O;  2CAZ C;  2X6B A;  1TA8 A;  4CC6 A;  3MDC A;  4F5Q A;  3HKC B;  1LNQ A;  2JGD B;  2HR3 A;  1SA0 A;  2MK3 A;  1AI6 A;  4O4H B;  2RQ6 A;  1VIB A;  3V7L A;  1Q78 A;  4R63 A;  4TV8 A;  4QZG A;  2Q4P A;  3A0R A;  4JPR A;  3B2E E;  1JAJ A;  4RT3 A;  3CE2 A;  5L3F A;  5J2B A;  2DJV A;  3JPT A;  3JD0 A;  1YF2 A;  3JCU Z;  4O4L A;  1SER A;  4UB6 Z;  2PBE A;  4WC7 A;  7ICP A;  3J81 N;  1ZQT A;  2YSU B;  1OCZ C;  4LWS B;  3KCX A;  5A2Q N;  2KG7 B;  1DF4 A;  4PA7 A;  4LFC B;  3LSQ A;  4O2B A;  3STZ C;  5J0O A;  1HR0 B;  4X4O A;  4RWU A;  3BA8 A;  4HZ3 A;  4F6E A;  2UXN A;  5J2U A;  4X65 O;  3PMN A;  4R8C A;  3EF2 A;  4FHX A;  4L8J A;  4GX0 A;  4R50 A;  4WOY A;  4K4H A;  7ICJ A;  2NN4 A;  4ASU G;  2ARH A;  2OTJ V;  1ZQY A;  3NVO A;  4MT8 A;  2HKO A;  4PHZ A;  3V7K A;  2DR5 A;  1TAE A;  4LFB B;  2GBO A;  8ICC A;  5CN0 A;  2RFF A;  3ABK B;  5JQG B;  4K9B A;  1BMF G;  2OIE A;  3OT7 A;  4QGP A;  4QZA A;  1H2M A;  1IBL B;  1TVK A;  5IYD O;  3THO A;  5KA5 A;  1PNM A;  3B8N A;  3BCC H;  3SDL A;  1AI7 A;  4YY3 B;  1JJO A;  4JWN A;  2FML A;  3A0H Z;  4X1Y A;  4I2F A;  5E79 Z;  4I2J A;  2HVJ C;  4ABM A;  5GON B;  4CS3 A;  1MIV A;  5HC9 A;  2JDI G;  9ICG A;  3NYB A;  2ZHB A;  4UB2 A;  4YN4 A;  4FM1 A;  2K1E A;  4MVR A;  4GZR B;  5B66 Z;  1ZJM A;  5J9P C;  3RH5 A;  1ZUQ A;  2D2C B;  3BAA A;  3ABK C;  5H2F Z;  3QNE A;  4FZ0 A;  3CC4 V;  4KLJ A;  3P3N A;  1EZV H;  1R73 A;  1S0V A;  1Q79 A;  4J9Y B;  4I5S A;  4HAM A;  2ZIO A;  1CPY A;  4X8A A;  2P66 A;  1FKA O;  7ICS A;  2AZ2 A;  9ICO A;  2C2A A;  4UV9 A;  1FXK B;  2UUB B;  4D7S A;  1OHH G;  3G80 A;  4JI7 B;  4YCX A;  3K9A A;  3N2G B;  4HNA A;  4TUP A;  2LJ2 A;  1P7G A;  3QTC A;  2FMQ A;  2BCR A;  1BQ0 A;  4H13 B;  4WQK A;  3UT5 B;  4LBE C;  5LL6 Y;  2HG5 C;  2QR4 A;  3SYO A;  4M2Y A;  2DWE C;  2LFR A;  4JYY A;  5EBM C;  4MSW C;  1H38 A;  2UXB B;  4K4I A;  4NLK A;  4Z6C A;  5IYB O;  2JK5 C;  1I08 A;  3MHH C;  1GM8 A;  1J95 A;  3OE7 G;  4DXW A;  1R89 A;  4UD5 A;  3JAW A;  4EBJ A;  2E3C A;  3AG1 C;  4JF3 A;  1ZQI A;  4X20 A;  4YIP A;  1ZQW A;  4M0A A;  2PFO A;  3IGA C;  3L74 H;  3D36 A;  3ZHV A;  4NB5 A;  4X1K A;  4DV3 B;  4I2H A;  4PDR A;  1FXK C;  4JAS A;  3MAQ A;  1L8D A;  3OTO O;  5JWP A;  4KLO A;  1ZQS A;  1R6N A;  4I9Q A;  4UVA A;  4D6T H;  8ICT A;  2WLH A;  3BEH A;  4JI0 B;  2EX3 A;  1K33 A;  2BPG A;  2B51 A;  3U11 A;  4DR3 O;  4O4J A;  4X4S A;  4DV2 O;  5D62 A;  2HP8 A;  4IGG A;  4UFZ A;  2IH3 C;  4U3J A;  5IJ9 A;  2OYQ A;  1YJW V;  2IW5 A;  3TCU A;  4WBN A;  1SZT A;  2PF4 E;  4LFA B;  4R7C A;  4NKG B;  4OAI Z;  4W4K A;  4ATB A;  4CZZ A;  4JTD B;  3T1C A;  1XBL A;  5EC1 C;  1JOY A;  4JI4 B;  2Y0P A;  1W59 A;  2YIC A;  1VQ8 V;  3CRC A;  5HHH A;  1BPZ A;  1Q6U A;  1PP9 H;  4TV8 B;  3B0Y A;  1Q5O A;  1YSC A;  2DOS A;  3HX0 A;  7ICO A;  1K5Q A;  1PL0 A;  1GPJ A;  5J2A A;  1KEC A;  4GXJ A;  1Q3E A;  3LNM B;  5KLV H;  3V72 A;  2Q7H A;  2ZE6 A;  4O69 A;  3IC9 A;  4K3A A;  4O2B B;  5BZB A;  1JA8 A;  3ZMZ A;  2QE7 G;  3HIY A;  4RQ4 A;  1FD9 A;  3E22 B;  3K57 A;  3EHB B;  5DM6 V;  4LF9 B;  4R64 A;  5J29 A;  4LF6 O;  4M9G A;  4X66 B;  3TXS A;  5LMU O;  2W6I G;  4PHP A;  2EIN C;  4IL6 Z;  3ZJZ A;  3C2M A;  7ICK A;  4N21 A;  1MIY A;  1ZQA A;  4E80 A;  1S5J A;  4X5V A;  4I55 B;  4MFA A;  5LMN B;  5LGU A;  1M9N A;  9ICE A;  3C5F A;  4UAZ A;  1YZB A;  3WFQ E;  1X4T A;  3I5D A;  3SPG A;  1AIL A;  5FPO A;  1SQX H;  3OVS A;  5B5E Z;  4YD1 A;  2PY5 A;  2EIM B;  1N36 O;  3B8M A;  9ICH A;  4WC3 A;  3D8C A;  4MVM A;  4NM2 A;  3UXN A;  4GX2 A;  1YDX A;  3W7S A;  5EZY A;  2L6L A;  1ZX3 A;  2BOB C;  9ICN A;  1DK1 A;  1GM7 A;  2Y4U A;  4X1Y B;  3LDE A;  2ZM6 O;  1R3L C;  3UQ0 A;  2ZH4 A;  3UKM A;  5J0T A;  1BQZ A;  3WFS C;  2ZCE A;  3OW2 U;  2FB5 A;  4AT8 A;  4UV8 A;  3H37 A;  4FVM A;  1WB7 A;  5B1B B;  4OX9 O;  2QWO B;  2YC0 A;  9ICK A;  1HP8 A;  4GCZ A;  1KUQ A;  1ZQO A;  3JAM N;  3JPS A;  3G4S V;  3CRQ A;  1YLQ A;  3S3X A;  4IYH A;  1TFW A;  1XMQ B;  1TUB A;  2BCC H;  4XA5 A;  1NBM G;  1HW7 A;  5DBB A;  1YTF B;  3CXC U;  3CWB H;  1R3J C;  5B1A B;  4WFG A;  5IJ0 A;  4IQV A;  4EV6 A;  1BCC H;  4X62 B;  4BR6 A;  4JI5 B;  4NR1 A;  2ITD C;  1M1K W;  3CPW U;  4NLN A;  1IXB A;  4RQ7 A;  2CTR A;  8ICB A;  2YID A;  1VQK V;  3DXR A;  5D46 A;  3HWT A;  3RBZ A;  1H2S B;  1ZQD A;  1MA1 A;  9ICF A;  2XOK G;  5B1B C;  4J11 A;  4GUN A;  1BPX A;  4HNA B;  3K58 A;  5L3G A;  5CHE A;  2KKW A;  3FB7 C;  1VF7 A;  4JAU A;  4PHA A;  4O5E A;  1H2L A;  2CK3 G;  4LFC O;  3QVN A;  4MFF A;  3AG3 B;  1OCO B;  4WCE V;  3CYO A;  4WFB V;  5B1A C;  2Q66 A;  4M04 A;  1VAR A;  2YDE A;  1I5Y A;  2YUA A;  3CCQ V;  3BHP A;  3D3Q A;  2DRA A;  9ICV A;  3JAW B;  4UCS A;  3SR2 C;  4DV1 B;  1W0K G;  3RH4 A;  2OT5 A;  4X20 B;  1ZQV A;  9ICT A;  2WLM A;  1LUW A;  2BSK A;  4NXM B;  4LFB O;  5EIB C;  1VQP V;  3CRR A;  4MVO A;  2PTM A;  4ZKI A;  5IYZ A;  2P4V A;  4X1K B;  2K9P A;  1R1B A;  4NVP A;  4DV7 O;  5CBH A;  1Y6X A;  1XOU A;  5FNV B;  1IBL O;  3C5G A;  4YXW G;  2ZR3 A;  2DWD C;  1GH6 A;  4UB3 A;  4FO6 A;  3AG3 C;  1OCO C;  4YD2 A;  4O4J B;  7ICH A;  1Y66 A;  5LA6 A;  4WCW A;  8ICY A;  2VRZ A;  1JCH A;  4U3J B;  4K9A A;  5IJ9 B;  2CDY A;  3O65 A;  3WG7 C;  1G6U A;  3LNN A;  4XBF A;  4I27 A;  5CWR A;  4P2H A;  5BOL A;  4ATB B;  4KLF A;  3D36 C;  1I94 B;  3UQ8 A;  4K97 A;  1SQB H;  3ZN0 A;  3SYA A;  1NOM A;  1XSL A;  9ICS A;  1GN2 A;  3KKY A;  4TQF A;  2L35 A;  5K1X A;  3ASO B;  5IIM A;  2PGG A;  1MZE A;  2WLI A;  5HR9 A;  2X0L A;  4QZ9 A;  2QDO A;  5EBL C;  2W0F C;  3KG2 A;  3MHS C;  3CSX A;  1T5E A;  4P4O A;  3ERC C;  2RCV A;  3JD3 A;  4PEL A;  2E5L O;  1XSP A;  4DR6 B;  4E2L A;  5J0U A;  4LF8 O;  2Y4T A;  3WB0 A;  3DTU B;  5D5P A;  2UUB O;  1ZQG A;  4QE7 A;  4RQ6 A;  3OEH G;  4YMM A;  1HWY A;  3RN4 A;  4ZBM A;  3AUO A;  4KP4 A;  3SJA C;  4RQ2 A;  3K03 A;  1M57 B;  2B1G A;  4MVZ A;  4JI1 B;  2O1P A;  4DR3 B;  1Y4M A;  4F5R A;  3OUY A;  4QE9 A;  2VQF B;  4ZOL A;  4GXI A;  3E89 A;  3NKU A;  3ASO C;  4GXK A;  2A79 B;  5J0Y A;  3P30 A;  3M8A A;  4OXS A;  3H38 A;  4UB4 A;  3OGU A;  3SPH A;  2WLN A;  5CA0 A;  1SET A;  3HKD A;  2IJI A;  2A06 H;  3H01 A;  3AU2 A;  3WFP A;  3DSQ A;  3JPP A;  3RYC A;  1Y74 A;  1Q86 W;  3GWK C;  2GWS A;  2IUB A;  4DR1 B;  3L75 H;  3H39 A;  1XNQ O;  3FD9 A;  4KLD A;  3H1L H;  2FCL A;  4UVC A;  4DV3 O;  3NWI A;  4Z1V A;  3JPO A;  3JAK A;  5EZY B;  4X0B A;  4YJ2 B;  4WFA V;  4GX5 A;  1M57 C;  3CCU V;  3OEE G;  4FLZ A;  2QM8 A;  5CA7 A;  4DW1 A;  3CMA V;  1BPE A;  4AT8 B;  4JI0 O;  1MNG A;  4PDL A;  4BIZ A;  4PH5 A;  3LQC B;  1IXM A;  4JTA B;  4DR2 B;  2N04 A;  5CB4 A;  2ILM A;  4I0U A;  1QU7 A;  2EJR A;  3RYH A;  4LFA O;  1M4U A;  8ICL A;  3LDD A;  7ICL A;  3OAA G;  2W0X A;  4FH5 A;  5IJ0 B;  5HRD A;  1F5A A;  1EM1 A;  3JAL A;  3S3W A;  5CJ7 A;  4K8V A;  1F4N A;  9ICC A;  4F5P A;  2RMK B;  9ICX A;  4WC6 A;  5III A;  3RYF B;  1R6K A;  4QZD A;  3FB8 C;  7ICM A;  5EK0 A;  2QKC A;  3UM7 A;  3ZCC A;  1BPB A;  4W4L A;  3DXR B;  1KQS U;  5DEC A;  2ZHA A;  2QWQ B;  4MS2 A;  3IFX A;  4IG8 A;  4RAI A;  8ICU A;  4RQ0 A;  1ZWI C;  4QZI A;  1NS1 A;  3CXH F;  2FL4 A;  3JPN A;  4I2G A;  1JR9 A;  3QO8 A;  4K0K O;  3K9S A;  8ICP A;  2YI9 A;  9ICM A;  2PYJ A;  1UFI A;  1FXH A;  4FFB A;  3VQV A;  2QM4 A;  1HDJ A;  3JD2 A;  5GTH Z;  4JYA B;  1AB3 A;  2BE3 A;  2HEP A;  4N23 A;  1QVF U;  2Z3Y A;  1Q81 W;  3CD6 V;  4X0A A;  1WJZ A;  3OV7 A;  2JJ2 G;  4B08 A;  3RJK A;  4PGX A;  1XUQ A;  3HKB B;  3TET A;  1N33 O;  5CMU A;  4DV6 B;  3K7D A;  2BSK B;  4KLI A;  3CB2 A;  5IYZ B;  1M56 B;  4FO1 A;  1S5L Z;  2YS8 A;  7ICQ A;  5KAI Z;  3DGE A;  1BPY A;  4KFM A;  2HJD A;  1M90 W;  3KCY A;  5KX5 A;  7ICN A;  1NR1 A;  2BTQ A;  3ZRW B;  3K75 D;  3JPQ A;  3PML A;  4TV9 A;  5EBW C;  5ITZ A;  2YIB A;  4I50 B;  2P90 A;  4U7N A;  4KLL A;  5GW7 A;  1IZ3 A;  2WA4 A;  1NTZ H;  5EIB D;  3K59 A;  2P7T C;  1PM9 A;  5LGN A;  4RWN A;  4P4P A;  4UAW A;  1TV9 A;  2UXD O;  1K4D C;  4JGS A;  4FH3 A;  3MD0 A;  3ABU A;  1NO5 A;  3AQK A;  1NTK H;  5FPR A;  3HJ4 A;  1EFR G;  2ZKO A;  3ABM C;  1VQN V;  4XDK A;  4KLU A;  4GX1 A;  1M56 C;  5H6R A;  4UB1 A;  4I2E A;  2M2U A;  1XMQ O;  4DO2 A;  1N8R W;  4DV0 O;  3HPL C;  5JTG A;  2QKS A;  5L3B A;  4MVS A;  3X2Q B;  4JV5 O;  5JH7 A;  1KMI Z;  4X62 O;  1G1X B;  2NNU A;  4JI5 O;  4KLT A;  1AI5 A;  2Q68 A;  3ZED A;  4DK0 A;  1DGS A;  2IBZ H;  4X89 A;  5CBF A;  2R72 A;  1ZQC A;  1MOF A;  4LC1 A;  4DV7 B;  2QKA A;  3UQ2 A;  4XQ8 A;  4LT6 A;  4BW5 A;  4C7U A;  1SC5 B;  3TFS A;  3OMA B;  4TUY B;  1KNY A;  2H3O A;  1NVP B;  2Q0O C;  1RPO A;  3A8T A;  1BHB A;  3VQW A;  4QNH B;  2PI4 A;  2FTK A;  3GVM A;  4H0L B;  4JI6 B;  1Q6H A;  2ID1 A;  1RZT A;  3X2Q C;  1V4A A;  4FHV A;  4RPZ A;  1JMK C;  1WP8 A;  2AW9 A;  1PX5 A;  3P3P A;  3RYC B;  4DV1 O;  1P7B A;  3ZRX A;  2ZNI A;  4NXM O;  1L0N H;  3VQY A;  5HHI A;  1SES A;  2LO1 A;  1ZQH A;  3RGB A;  3AEI A;  4F6R B;  3K5L A;  3JAK B;  3SYC A;  5IIK A;  3RH6 A;  4KLH A;  3E2E A;  1EN5 A;  2ZH1 A;  1U97 A;  1KDH A;  3UCS C;  2Q7G A;  4JAV A;  2N05 A;  1HNX B;  4K4G A;  2XUM A;  3L73 H;  3I55 V;  3FFQ A;  3TJT A;  8ICW A;  4GT1 A;  3K3W A;  2EIJ B;  3AG1 B;  5LHI A;  2WLK A;  4NLZ A;  1YCI A;  1F7Y A;  2E5L B;  5J0S A;  5J2G A;  2Q5Z A;  1NQT A;  2M2T A;  8ICF A;  4LF8 B;  3MGI A;  3RWR D;  4LR3 A;  5FLX N;  2JEX A;  3R66 A;  1JQ0 A;  1E1R G;  5L3C A;  4WF9 V;  1AP5 A;  1QHT A;  3RYH B;  4HBN A;  1NKD A;  1EN4 A;  1I94 O;  4U3F H;  4RQE A;  9ICA A;  5AG2 A;  1HNZ O;  2RJZ A;  4CH6 A;  3JAL B;  1FFT B;  1NR7 A;  2XAQ A;  2DYS B;  3C2L A;  3SPC A;  1RSO A;  1HUZ A;  4CH4 A;  2ZD9 A;  4CH5 A;  1N4C A;  3CCV V;  2ISO A;  4UAY A;  2EIJ C;  1MMM A;  3OMN B;  1XNQ B;  3SPJ A;  2JRI A;  4AHC A;  2JS3 A;  3STL C;  1S72 V;  1Y76 A;  2HFE C;  4DR6 O;  2CGO A;  5IIO A;  3MCR A;  2BTO A;  1XQ8 A;  4OAF A;  1G4Y B;  2Q69 A;  2IJH A;  2ZH6 A;  5JVD A;  3TGU H;  7ICT A;  2HN2 A;  5E1A C;  2HVK C;  4JI1 O;  3CEI A;  3LSS A;  4X64 O;  5HFM A;  1NT2 B;  4S3N A;  2A7W A;  1GAX A;  5KUK A;  3SYP A;  4LVS A;  4GYC B;  2VQF O;  2DYS C;  4NXU A;  5D63 A;  3G67 A;  4FLT A;  1QR9 A;  5K1P A;  1R6T A;  2DW4 A;  2YEV A;  4OAH A;  4IQU A;  1ROP A;  1ZL8 A;  5J0X A;  1KP2 A;  1V9P A;  2A0L A;  5KMG A;  3JAR A;  4DR1 O;  5LP6 A;  4FMT A;  1VF6 A;  4XJE A;  3RT3 C;  5HRE A;  1VQ5 V;  2EIN B;  4FLY A;  5KX5 B;  3MGH A;  3CME V;  1SA0 B;  2ATK C;  2BTQ B;  2O5A A;  3JCZ A;  4IIJ A;  1P84 F;  4ICG A;  4TV9 B;  3E8F A;  4NXX A;  4I2C A;  5ITZ B;  4Q6G A;  4X4U A;  2F1M A;  4RWP A;  2LQT A;  5DN6 G;  1I7F A;  2V1D A;  4O5K A;  3ZN1 A;  2QM7 A;  2DQ3 A;  1JFF A;  4O4L B;  4EB6 A;  4TT3 G;  3B4S A;  4BWA A;  3K08 A;  4LNU A;  2X6C A;  2M2W A;  1QBZ A;  4XQ7 A;  2CE4 A;  2ZDI A;  4K0K B;  4DR7 O;  4DR2 O;  1OV9 A;  4O68 A;  4FZ1 A;  1X59 A;  4X4T A;  4I7Z B;  4JYC A;  3WB1 A;  4XUS A;  9ICQ A;  2VAN A;  5J2U B;  3A0B Z;  3B09 A;  4MFC A;  1BT8 A;  7ICF A;  5JH7 B;  1ZJN A;  4WFH A;  9ICP A;  1N33 B;  1YI2 V;  3AG7 A;  4CC5 A;  5D4B A;  5IIL A;  4NY8 A;  4LEY A;  4RQ3 A;  3K0D A;  1XDC A;  3G6E V;  3JSN A;  5CFT A;  2JIZ G;  2YI8 A;  3FAV A;  4JI3 B;  1KU9 A;  2WLL A;  4TOI A;  1TVK B;  4RQ1 A;  3BRC A;  1RP3 B;  1B06 A;  1WB8 A;  2Q9L A;  3UXO A;  5CA1 A;  4DOA A;  3JAT A;  1BZK A;  4BAY A;  4UD4 A;  5LYJ A;  4CS4 A;  1KC8 W;  1KKD A;  4M9H A;  1K73 W;  4MW8 A;  3OVB A;  4DK1 A;  4F4L A;  2W9M A;  5TZV A;  4CH3 A;  3R65 A;  3VQX A;  4O6A A;  2ISP A;  4LP8 A;  4JYA O;  4KL1 A;  8ICE A;  1TUE B;  2EZO A;  3NR7 A;  1ZAU A;  2WA3 A;  1ZTE A;  5D61 A;  2UXD B;  1PNK A;  3F7Y C;  2PYL A;  3MBY A;  1LR1 A;  2HHH B;  1D5A A;  9ICU A;  4X1I A;  4P9O A;  3JCF A;  5J2C A;  1ZQP A;  4X4N A;  1SQG A;  2P5O A;  4DV6 O;  5DDY A;  3H9V A;  3J7A U;  2B5U A;  2EIK C;  2V4D A;  4DOB A;  3AQM A;  4DV0 B;  1YVW A;  1QCE A;  2ZH5 A;  1AR1 B;  2BPC A;  3IAY A;  3HW8 A;  4JV5 B;  3BA9 A;  2JGU A;  3N27 A;  2JJ1 G;  4IHJ A;  3OVA A;  2GDS A;  2ADQ B;  3U10 A;  4B7E A;  2RNB A;  1AJQ A;  3ETE A;  2IHO A;  1XSN A;  5IYC O;  1XHZ A;  4OPA A;  5JCO A;  3CRA A;  3PJS K;  4LEZ A;  5EYP A;  4O4I A;  4PA4 A;  3E8G A;  1NVP D;  4B3R B;  5H6Q A;  2KSD A;  3ER9 B;  5FL7 G;  1KYO F;  4GKJ B;  3K5M A;  1PPJ H;  1JQR A;  1S3J A;  4O2A A;  2PZS A;  2F95 B;  1OZ0 A;  2PFN A;  4ZI7 A;  2DR9 A;  9ICL A;  4QZC A;  3GWO A;  3WG7 B;  3FYI B;  4J9Z B;  1RM1 B;  5J0R A;  4DUY B;  4PJ0 Z;  4Z2W A;  1NTM H;  4TUS A;  2DMX A;  4UCO A;  1Q8I A;  9ICB A;  5J2T A;  2QWP B;  4O9M A;  3SJC C;  5J0Q A;  2P6J A;  2NLJ C;  4DV5 O;  2Q6A A;  1WOT A;  3RJG A;  2E74 B;  4NTX A;  3GB7 C;  1CEZ A;  4P4M A;  1V54 B;  4FJC C;  3BY6 A;  1MSD A;  2I9G A;  1P4R A;  4K96 A;  4P2Z A;  1GTO A;  3ZMT A;  4JI6 O;  2YEV B;  4NXN O;  1YEW A;  1ZL8 B;  5LBQ A;  1RM1 C;  5IIN A;  4WBN B;  2UU9 O;  3HKC A;  2JGD A;  7ICG A;  4PA6 A;  2VWJ A;  5J0W A;  5C8Y A;  3SYQ A;  3L71 H;  4O4H A;  1HNZ B;  3K06 A;  5LP6 B;  1DTO A;  1GN4 A;  2OTL V;  1M93 A;  1OJH A;  7ICR A;  2JS5 A;  8ICM A;  2EIL B;  4IIJ B;  4NKU A;  3ZHU A;  4ZHQ A;  1HNX O;  3N2K A;  5IWA B;  3ICX A;  5L3D A;  1V54 C;  1FFX A;  3JPR A;  5HFL A;  2XAG A;  4KLQ A;  5C93 A;  4QZE A;  4K8X A;  3C3T A;  1SS3 A;  2ZQM A;  2H8P C;  4WC1 A;  2IHM A;  2QJ1 A;  2B1I A;  3RJF A;  3EFF K;  1F4M A;  2GV9 A;  1E1Q G;  4X64 B;  5J2E A;  1TVA A;  5LP6 C;  4B3S B;  1VF6 C;  3PN1 A;  4WBZ A;  1CP9 A;  2UXX A;  1H2K A;  5HRB A;  4DUZ O;  4PA9 A;  3L70 H;  5JQG A;  5CHG A;  1AR4 A;  2VQE O;  2EIL C;  3AQL A;  3ZIA G;  2ZIM A;  4RO2 A;  5KAF Z;  1XMO B;  1IBM O;  2GA9 D;  4EED A;  1YHQ V;  1J5E B;  2ZH9 A;  2AXT Z;  3TK1 A;  4UCU A;  3FAV B;  3OR6 C;  2XAS A;  1WN7 A;  2Y48 A;  4OPH A;  2WLL B;  4RPY A;  2B9Z A;  1F23 A;  5HRH A;  1ZQF A;  3FB5 C;  1N32 O;  2HN1 A;  4KLE A;  5B1N A;  5DDM A;  4MW3 A;  3FB6 C;  4BW9 A;  3ZRV A;  5CA1 B;  3JAT B;  3WFR E;  2ZDI C;  5IT9 N;  3A2F A;  4PGQ A;  2F93 B;  5LYJ B;  4B3T B;  1R8C A;  2UXC B;  3B77 A;  2DR7 A;  2YIB D;  4N7R A;  5J2D A;  2WSS G;  5BY1 A;  1R8B A; 
#chains in the Genus database with same CATH homology
 5CB1 A;  4I2B A;  4M5D A;  4XRH A;  8ICN A;  4UBC A;  1ZQE A;  4KLT A;  4MF2 A;  1ZQC A;  2ZH3 A;  2M2V A;  4ATB A;  3UQ2 A;  3L9D A;  4XQ8 A;  4LT6 A;  1ZQX A;  4RWO A;  4UB5 A;  3TFS A;  1R8A A;  1KNY A;  5HRG A;  3PNC A;  5HHH A;  1BPZ A;  4NKT A;  3RJH A;  3B0Y A;  4X4R A;  4Z6F A;  1UET A;  4TUQ A;  3HX0 A;  7ICO A;  2FMP A;  5HRF A;  5J2A A;  2ID1 A;  5J0P A;  1RZT A;  1V4A A;  4FHV A;  5DB8 A;  4RPZ A;  5D49 A;  4RT2 A;  4WC5 A;  4GXJ A;  3V72 A;  1PX5 A;  2ZH7 A;  5J2F A;  9ICI A;  3V7J A;  7ICU A;  4E8F A;  1ZQH A;  5HHI A;  3HIY A;  4I2A A;  4R65 A;  5DED A;  4RQ4 A;  4M47 A;  4KLG A;  4R64 A;  5IIK A;  3RH6 A;  4KLH A;  5J29 A;  4M9G A;  2ZH1 A;  1KDH A;  3WFO A;  4PHP A;  3C2M A;  7ICK A;  1MIY A;  1ZQA A;  4K4G A;  4E80 A;  4X5V A;  8ICW A;  3C66 A;  4MFA A;  3ISD A;  9ICE A;  3C5F A;  4UAZ A;  3WFQ E;  4NLZ A;  2HHP A;  4O5C A;  5J0S A;  2BPF A;  4RQ8 A;  5J2G A;  4I2D A;  3OVS A;  8ICF A;  2M2T A;  4YD1 A;  3MGI A;  1ZQN A;  4KLM A;  5DB9 A;  2ZH8 A;  4PPX A;  4LZD A;  9ICH A;  4EBK A;  4WC3 A;  4NM2 A;  3UXN A;  1MIW A;  5DKW A;  4PHD A;  1ZQK A;  5HRK A;  9ICN A;  8ICJ A;  5BPC A;  9ICA A;  3UQ0 A;  2ZH4 A;  5J0T A;  3WFS C;  4WBY A;  9ICJ A;  3C2L A;  9ICW A;  1HUZ A;  4AT8 A;  2PFP A;  3H37 A;  1MQ3 A;  2BCS A;  4X4P A;  3TFR A;  5DB6 A;  2ISO A;  9ICK A;  4UAY A;  3RJE A;  1ZQO A;  3JPS A;  5CP2 A;  1YLQ A;  1TFW A;  4XA5 A;  5EOZ A;  5IIO A;  5DBB A;  1FA0 A;  8ICR A;  4IQV A;  2ZH6 A;  5HRL A;  4AT9 B;  4R66 A;  7ICT A;  1ZQU A;  4PHE A;  4FHP A;  2BCU A;  4NXZ A;  4NLN A;  4S3N A;  4RQ7 A;  4MF8 A;  4LVS A;  8ICB A;  3GDX A;  5D46 A;  3HWT A;  1KEJ A;  4I28 A;  1ZQD A;  9ICF A;  4IQU A;  4X4Q A;  5J0X A;  1BPX A;  9ICR A;  4QZB A;  4FHY A;  1ZQL A;  5J2H A;  7ICV A;  4PHA A;  4O5E A;  4RPX A;  4MFF A;  5HRE A;  5HRI A;  1HUO A;  3MGH A;  2NRK A;  2Q66 A;  4M04 A;  2O5A A;  4I2C A;  3C18 A;  2DRA A;  9ICV A;  3OUY B;  1RPL A;  4QZ8 A;  4X4U A;  3UPQ A;  4DOC A;  2DR8 A;  5F2V O;  4RWP A;  3RJJ A;  3RH4 A;  4O5K A;  8ICH A;  1ZQV A;  9ICT A;  1VJ7 A;  4M9L A;  4I2I A;  4Z6D A;  3UXP A;  2M2W A;  8ICO A;  4XQ7 A;  3H3A A;  5J2K A;  3LK9 A;  4X4T A;  3C5G A;  4M9N A;  2DRB A;  4XUS A;  9ICQ A;  2VAN A;  4UB3 A;  5DBC A;  4FO6 A;  4F5O A;  4MFC A;  4AT7 B;  4YD2 A;  3AU6 A;  1ZQR A;  3ISC A;  7ICF A;  7ICH A;  4E7X A;  1ZJN A;  9ICP A;  8ICY A;  4WCW A;  5D4B A;  5IIL A;  4IQW A;  4NY8 A;  4RQ3 A;  4Z6E A;  4I27 A;  1UEV A;  8ICQ A;  5CWR A;  4P2H A;  5BOL A;  2PXI A;  1VFG A;  4ATB B;  4KLF A;  4RQ1 A;  2ZH2 A;  3UXO A;  4DOA A;  1ZQB A;  3AQN A;  4RQ5 A;  8ICA A;  4JWM A;  1NOM A;  4UD4 A;  1XSL A;  9ICS A;  5IIM A;  4M9H A;  8ICS A;  4TUR A;  3OVB A;  2W9M A;  5TZV A;  2FMS A;  3ISB A;  5HR9 A;  1ZQQ A;  4QZ9 A;  5J2J A;  2ISP A;  3C2K A;  4F5N A;  8ICE A;  4QZH A;  3MDA A;  4P4O A;  8ICK A;  4X4V A;  5DB7 A;  3MBY A;  4IQT A;  7ICE A;  1XSP A;  9ICU A;  5J2C A;  5J0U A;  1TFY A;  1OU5 A;  4FHW A;  1BPD A;  1ZQP A;  4X4N A;  1ZQG A;  4RQ6 A;  4YMM A;  5DDY A;  3MDC A;  4F5Q A;  4DOB A;  3AQM A;  3AUO A;  4RQ2 A;  4WC4 A;  2BCQ A;  2O1P A;  2ZH5 A;  2BPC A;  1Q78 A;  3V7L A;  4R63 A;  3HW8 A;  4QZG A;  4F5R A;  3OUY A;  8ICV A;  4GXI A;  1JAJ A;  4RT3 A;  4GXK A;  5J0Y A;  5J2B A;  4UB4 A;  3H38 A;  3OGU A;  1MQ2 A;  3JPT A;  3OVA A;  2PBE A;  4WC7 A;  3AU2 A;  3WFP A;  7ICP A;  3JZ0 A;  1ZQT A;  3JPP A;  1ZQJ A;  4I29 A;  4WC2 A;  1XSN A;  2GWS A;  2BCV A;  3H39 A;  5CR0 A;  5J0O A;  4KLD A;  4X4O A;  3JPO A;  3PMN A;  4X0B A;  4FHX A;  5BOM A;  4M9J A;  4K4H A;  7ICJ A;  1JQR A;  1ZQY A;  4NM1 A;  3V7K A;  5CA7 A;  2DR5 A;  4AT8 B;  1BPE A;  2PFN A;  2DR9 A;  4PGY A;  9ICL A;  8ICC A;  4QZC A;  4PH5 A;  2RFF A;  3LQC B;  5J0R A;  4QZA A;  4TUS A;  1JN3 A;  9ICB A;  4JWN A;  4O9M A;  8ICZ A;  8ICL A;  5J0Q A;  7ICL A;  5J2I A;  4FH5 A;  5HRD A;  1F5A A;  2DVI A;  1WOT A;  4I2F A;  5CJ7 A;  4I2J A;  3RJG A;  9ICC A;  4F5P A;  9ICX A;  4WC6 A;  5III A;  1MIV A;  5HC9 A;  4QZD A;  4P4M A;  9ICG A;  3NYB A;  2I9G A;  2ZHB A;  7ICM A;  4UB2 A;  4YN4 A;  1BPB A;  5DEC A;  2ZHA A;  1ZJM A;  2PFQ A;  3RH5 A;  5IIN A;  4IG8 A;  4KLJ A;  8ICU A;  4RQ0 A;  4QZI A;  7ICG A;  5J0W A;  1Q79 A;  3JPN A;  4I2G A;  8ICP A;  9ICM A;  4QZF A;  4AT9 A;  1JMS A;  4EP7 A;  1ZQM A;  2BE3 A;  1UEU A;  7ICR A;  8ICM A;  4X0A A;  4NKU A;  4LZG A;  3OV7 A;  2P66 A;  7ICI A;  1ZQZ A;  3RJK A;  7ICS A;  9ICO A;  4PGX A;  4YMO A;  3JPR A;  4KLI A;  4YCX A;  3RJI A;  4KLQ A;  4TUP A;  4QZE A;  2FMQ A;  2BCR A;  8ICX A;  7ICQ A;  4KLS A;  1BPY A;  4WC0 A;  4WC1 A;  4M2Y A;  2IHM A;  3RJF A;  7ICN A;  8ICG A;  4K4I A;  4NLK A;  4UBB A;  4Z6C A;  3K75 D;  3JPQ A;  1TVA A;  5J2E A;  3PML A;  4WBZ A;  4KLL A;  5HRB A;  1R89 A;  4UD5 A;  4EBJ A;  5CHG A;  5IIJ A;  1ZQI A;  3AQL A;  3B0X A;  1ZQW A;  4M0A A;  2PFO A;  4RWN A;  4P4P A;  4UAW A;  1TV9 A;  2ZH9 A;  4I2H A;  4FH3 A;  1NO5 A;  4RPY A;  3AQK A;  8ICI A;  3UPS A;  3HJ4 A;  5HRH A;  1ZQF A;  4DO9 A;  3JYY A;  5DBA A;  4KLE A;  4KLO A;  5DDM A;  1ZQS A;  4KLU A;  4UB1 A;  3WFR E;  2M2U A;  4I2E A;  4PGQ A;  1R8C A;  8ICT A;  2DR7 A;  2BPG A;  4AT7 A;  5J2D A;  4X4S A;  4YMN A;  3HJ1 A;  4RWQ A;  1R8B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...