5DECA

Crystal structure of the small alarmone synthetase 1 from bacillus subtilis
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
195
structure length
188
Chain Sequence
DDKWERFLVPYRQAVEELKVKLKGIRTLYEDDHSPIEFVTGRVKPVASILEKARRKSIPLHEIETMQDIAGLRIMCQFVDDIQIVKEMLFARKDFTVVDQRDYIAGYRSYHLVVLYPLQTVSGEKHVLVEIQIRTLAMNFWATIEHSLNYKYSGNIPEKVKLRLQRASEAASRLDEEMSEIRGEVQEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Catalytic mechanism and allosteric regulation of an oligomeric (p)ppGpp synthetase by an alarmone.
pubmed doi rcsb
source organism Bacillus subtilis (strain 168)
molecule tags Transferase
molecule keywords GTP pyrophosphokinase YjbM
total genus 64
structure length 188
sequence length 195
chains with identical sequence B, C, D
ec nomenclature ec 2.7.6.5: GTP diphosphokinase.
pdb deposition date 2015-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04607 RelA_SpoT Region found in RelA / SpoT proteins
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.860 Mainly Alpha Orthogonal Bundle Helix Hairpins Nucleotidyltransferase 5decA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5decA01
1MIVA 1RZTA 1R8CA 4F5OA 5DDMA 4R65A 2IHMA 3WFSC 8ICIA 3V72A 2DRAA 3MDCA 3H37A 3JPTA 4RWOA 2HHPA 2ZH7A 4X4SA 4RQ1A 5J0XA 1ZQDA 4IQWA 1JN3A 4R66A 4WBYA 5J2BA 5HRGA 4NM2A 5CB1A 5D46A 4RQ5A 1ZQFA 4IQUA 4K4GA 9ICXA 4QZ9A 8ICXA 3C5GA 3OGUA 9ICSA 4P4MA 4KLLA 5BOMA 3MGHA 3RJEA 4WC3A 4MFAA 2BCQA 1ZQNA 1TFWA 1ZQMA 8ICJA 2ZH4A 5IIKA 3JPQA 5J0SA 1UETA 5CA7A 2FMSA 8ICZA 4KLDA 2I9GA 4FHVA 3HWTA 4QZFA 4X4NA 3AQMA 8ICRA 3MGIA 1RPLA 4QZGA 3C5FA 2ZH5A 2ISOA 1MQ2A 5CWRA 2NRKA 5J0PA 4K4HA 2PFOA 4PGYA 2BCUA 3JPSA 2DR7A 9ICGA 4O9MA 3HIYA 4ATBB 3PMLA 1YLQA 3UPSA 1XSLA 5HRHA 4K4IA 4RPXA 4GXKA 4RWNA 4RT3A 1ZQTA 4RQ7A 7ICOA 2M2WA 5F2VO 4RWPA 4FHYA 3RJIA 4PH5A 5HREA 3HX0A 9ICVA 1OU5A 9ICNA 4GXIA 3B0YA 2ZH8A 4X4VA 4WC5A 4M9LA 4NLZA 3V7JA 4X4UA 4RQ2A 4AT7B 2BCRA 4YD1A 4RQ0A 4R64A 1ZQAA 4I2CA 4I2BA 5IINA 7ICPA 1VFGA 2BCVA 1JAJA 4M0AA 3AQKA 5CHGA 5J2FA 3LQCB 3NYBA 4QZDA 4X4OA 4AT8B 4M9NA 1XSPA 5IIOA 4PGXA 2BPCA 4Z6EA 2PXIA 4KLSA 4AT9A 5J29A 2M2UA 8ICYA 4R63A 4QZIA 4XUSA 4EBJA 4UAWA 4M5DA 1TFYA 3PNCA 4FO6A 7ICLA 3JYYA 9ICHA 4QZAA 4YCXA 2RFFA 5HRBA 1R8BA 3JPNA 8ICPA 1JQRA 4IG8A 4KLFA 4YN4A 2VANA 3AU6A 4I29A 1PX5A 3OUYA 4KLOA 3JZ0A 4MFFA 4FHPA 1R89A 8ICBA 4UBCA 1ZJNA 3WFRE 8ICHA 4TURA 3RJHA 4DO9A 1FA0A 4I2HA 1ZQRA 5D49A 8ICNA 4M04A 4X4QA 2ZH2A 8ICKA 1KEJA 4YMMA 4Z6DA 1ZQHA 4I28A 1F5AA 4FH3A 1NO5A 1MIYA 5J0RA 4JWNA 3WFOA 4UBBA 7ICJA 1Q79A 3C2MA 2PBEA 3MDAA 4UD5A 4IQTA 4RPZA 5CJ7A 5IIMA 4AT8A 2DR9A 4MFCA 7ICSA 1HUZA 4WC6A 1ZQOA 1ZQXA 3C66A 3UXOA 2BPFA 1ZQYA 5HR9A 4M9HA 1ZQSA 8ICQA 5D4BA 4I2GA 2BCSA 4Z6FA 5HRIA 4KLGA 2M2VA 4E8FA 4DOBA 9ICUA 1UEUA 4I2FA 4QZHA 4TUSA 4WC4A 3UPQA 8ICVA 5TZVA 7ICKA 1WOTA 2PFNA 8ICGA 1XSNA 1ZQGA 1BPYA 4UAZA 4QZBA 4UB1A 4UD4A 7ICFA 2ZH9A 2PFPA 9ICIA 5EOZA 5DEDA 9ICWA 1JMSA 5J0WA 2M2TA 5IILA 1TV9A 1TVAA 5DBBA 3ISBA 3TFRA 3H38A 3UXNA 1KNYA 4MF8A 4EP7A 3RH5A 1ZQUA 3OVAA 2DVIA 4NLKA 4F5QA 2ZH1A 5J2IA 3MBYA 1HUOA 1BPEA 4WC0A 4I2JA 5J0OA 4KLUA 4IQVA 1BPDA 9ICKA 4P2HA 8ICAA 5J0TA 4O5EA 5DB8A 5HC9A 3RJFA 5J0YA 1BPZA 3RH4A 8ICWA 5HHHA 3UQ2A 1ZQKA 4YMNA 5DECA 4JWMA 4QZ8A 4NXZA 5BOLA 9ICAA 4QZCA 2DR5A 4M47A 4I2IA 7ICHA 9ICPA 3OVSA 4E7XA 4FHWA 4AT9B 2P66A 1ZQJA 4WBZA 4XQ7A 7ICEA 4O5CA 5J2CA 3RJKA 4KLEA 4LZGA 1ZQCA 9ICCA 5DBCA 1UEVA 4E80A 4I27A 8ICTA 4ATBA 4UB2A 4UB4A 4DOAA 5CR0A 7ICTA 4UB3A 3V7LA 4F5PA 4X0AA 4PHDA 3AQLA 1R8AA 3RJGA 1MQ3A 2FMPA 4YD2A 4UAYA 5DBAA 5CP2A 3WFPA 4S3NA 3RH6A 3LK9A 8ICSA 5J2HA 4X4PA 4NY8A 8ICCA 1ZJMA 1NOMA 5DB6A 9ICJA 5DB7A 4LVSA 1BPBA 5HRKA 7ICGA 5J2DA 4TUQA 4P4OA 3UQ0A 4PGQA 8ICEA 3JPOA 1ZQQA 2GWSA 7ICRA 4KLIA 2O1PA 2ZH6A 3AUOA 3HJ4A 1ZQVA 2PFQA 5HRLA 4RT2A 3ISDA 4Z6CA 4WC7A 4P4PA 3PMNA 8ICFA 1Q78A 4RQ8A 3AU2A 4F5NA 8ICUA 4UB5A 5BPCA 4RQ3A 4X4RA 7ICNA 3JPPA 9ICQA 2DR8A 4WC2A 3RJJA 4DOCA 4RWQA 4WC1A 4X4TA 3C2LA 2FMQA 4FHXA 2DRBA 4F5RA 9ICOA 2ZHAA 1V4AA 4KLHA 9ICRA 9ICMA 4RPYA 1ZQEA 2ID1A 4LT6A 4NKUA 7ICQA 2O5AA 1VJ7A 5HRFA 9ICEA 4QZEA 5J2AA 1ZQLA 3JPRA 3GDXA 5IIIA 4MF2A 3WFQE 7ICVA 5J0QA 2ISPA 1ZQWA 4NKTA 4NLNA 4LZDA 3HJ1A 3B0XA 4KLJA 1MIWA 3AQNA 5HHIA 1ZQBA 4RQ4A 4I2AA 5IIJA 5DB9A 4PPXA 2ZHBA 9ICTA 4NM1A 4XRHA 9ICBA 4M2YA 8ICOA 9ICLA 2W9MA 3HW8A 3V7KA 7ICMA 4FH5A 4I2DA 4X5VA 8ICMA 4PHEA 4PHPA 2BPGA 3TFSA 5DKWA 4WCWA 4O5KA 5J2KA 4KLMA 4YMOA 7ICUA 4KLQA 4XA5A 4AT7A 3OUYB 3H39A 1ZQZA 4TUPA 1BPXA 3ISCA 4PHAA 2BE3A 3K75D 3OV7A 5HRDA 3UXPA 1ZQPA 4GXJA 1KDHA 2ZH3A 3OVBA 8ICLA 1ZQIA 5DDYA 3C18A 5J2EA 4RQ6A 2Q66A 5J2JA 4KLTA 3C2KA 7ICIA 5J2GA 4M9GA 3H3AA 4I2EA 3L9DA 4XQ8A 5J0UA 4X0BA 4M9JA 9ICFA 4EBKA
chains in the Genus database with same CATH superfamily
2AXTZ 1RZTA 1R8CA 1JJOA 4F5OA 2IHMA 3WFSC 2JDIG 3AK1A 3V72A 3HB3B 1MABG 3OT7A 4RWOA 5CFSA 2HHPA 4PHZA 2CK3G 1DF5A 5AG2A 4RQ1A 3ABKB 1JFFA 2F1MA 3CXHF 1BL8A 4R66A 1S5HC 4UCOA 4NM2A 5CB1A 2Q7HA 2ZXWC 4J7KA 4NXMB 5B1BC 4FLYA 1ZQFA 5FPRA 4IQUA 4K4GA 1I7FA 5H9CA 5CFTA 4K9BA 5D62A 4F6EA 4ZHQB 1CEZA 9ICSA 1WNSA 4KLLA 3CCSV 2UUAO 4GKJB 3K06A 3WU2Z 1XL4A 4I0UA 2ITCC 2V1DA 5LOVB 4MFAA 3FFQA 1ZQMA 2ZIOA 8ICJA 5IY5C 3UO2A 3AG1B 2DYSC 1L8DA 1UJWB 2RNBA 5J0SA 2YIDA 4JI4B 1COWG 4Q6GA 4KLDA 4GKJO 1RM1B 5H6QA 2IHOA 3ZRVA 2ZDIC 3E86A 4QZFA 3MGIA 3HR0A 4FPPA 3SPCA 3SPIA 4U7NA 3G4SV 1IXMA 9ICGA 3QF7A 3HIYA 1QCEA 4ATBB 3PMLA 2ZD9A 2E3CA 2ZE7A 4RPXA 4MVOA 2GAFD 2Y4TA 1AP5A 4RQ7A 4QE7A 1FFXA 4JI8O 2EILB 2DQ0A 4FHYA 4FK5C 4PH5A 4DO2A 5HREA 3FAVA 3CP1A 3VBBA 1BT8A 4PDVA 3ABLB 1XQ8A 2JEXA 1NBMG 1PP9H 4NTWA 2LW7A 3ZRWB 3FAVB 5C93A 4AT7B 1Y67A 2QWRB 1Y76A 3K5NA 3MAQA 1KD1W 4JPRA 2Y69B 2FTKA 4YJ2A 3OMNB 2BCVA 3SGIA 2P06A 4DV1B 4O4JB 1G4YB 1ZTEA 4JLZA 3BPZA 4GX1A 4ASUG 4QZDA 5LHIA 2UUAB 4M9NA 3RYIB 4UVBA 3B8NA 1XSPA 3I56V 4PGXA 5EC1C 4NB5A 2BPCA 3LDDA 2Z3YA 4QNHB 1ZUQA 4AT9A 5J29A 2DYRB 3UM7A 2XTAA 3AG1C 4MW3A 1PD3A 1V9PA 4DK1A 1FAFA 4XUSA 1MOFA 1QLEB 2ADPA 3RYHB 4GLXA 3PNCA 4AILC 2WWWA 3JYYA 2AGAA 2QM8A 2Y0IA 4DR5B 4TT3G 2QEXV 1KKDA 5HRBA 1R8BA 2IJHA 3EHBB 1JQRA 3ABLC 3U11A 2E5LO 2X6AA 1I94B 1AJQA 2IJIA 1CP9A 3BABA 1FPOA 5H2FZ 3AU6A 2NN4A 4I29A 3WB2A 2XHBA 4KLOA 2Y69C 1GN2A 1R89A 5EZYB 1XI1A 3E8FA 3IC9A 5JTGA 3E8HA 1WLEA 3VQVA 1ZQRA 1RSOB 4MTXA 4BIZA 2ZH2A 8ICKA 3LUTB 5JWPA 4HAMA 4LEVA 5CA1A 3LSSA 3OMIB 4Z6DA 1WB7A 1SRYA 2DYRC 1ZQHA 4I28A 3HPLC 1F5AA 1MIYA 1EN6A 4JWNA 1VQ8V 4K8VA 3JSLA 3KG2A 2B1GA 4NXVA 4LWSA 4NXXA 3MHHC 3JSNA 5A9GA 4FIPC 4KHPB 4FVMA 1BHAA 4K8ZA 2PTMA 4RPZA 2Q4PA 2QKSA 4MFCA 4K35A 4HBNA 3DXRB 4F6RA 3JCFA 1HUZA 3TXQA 2HVJC 3UXOA 4K3AA 1QVFU 1M5IA 5HR9A 4YY3O 4IYHA 2QM7A 1E79G 1QU7A 1SESA 4I2GA 3J7AU 5B3PA 5HRIA 2Q7EA 4U7OA 4OAFA 5GTIZ 4DOBA 4LEYA 3E35A 5LYJA 5A2QN 1GM8A 4X89A 3CCQV 1P7GA 4I55B 3RYFA 4MTFA 4HX0A 4QZBA 1H2SB 4DV5O 2PFPA 5EOZA 4GCZA 4MVRA 4B7EA 5E79Z 9ICWA 5IILA 2M2TA 1TV9A 3ICXA 2ZE8A 2Q6AA 3H38A 3D3IA 2PYJA 4I4TA 4JF3A 1SQBH 1ZQUA 4NLKA 1XNQB 2VQFB 1LNQA 4DR6O 3ZHVA 1WPXA 1Y76B 1GMGA 1U96A 2ZM6B 3C3TA 3JAKA 3T4ZA 5J0OA 5JQGB 2Q67A 1VQ4V 4KLUA 4JI6O 2JGUA 1K73W 5LGNA 2N05A 4O2BA 4AI8A 5JQGA 2UXNA 1Y74A 3JARA 2HKOA 2EIKB 4PV1B 3J80N 4MSWC 1WPBA 4JI1O 2IH3C 3GWKC 2UXDO 1NR1A 4G27B 3S3XA 2H8PC 3JATB 4IL6Z 7ICHA 3OVSA 3M99B 4X9QA 1JCHA 2ZCEA 5J9PC 4WBZA 2CTWA 4XQ7A 4O5CA 4LZGA 1HR0O 3CS5A 2KQXA 1Q90D 4KUMA 1NTKH 1K9MW 4UXNA 3P3NA 3ER8C 4DK0A 1B6QA 4KB6A 1AI4A 4UB4A 1SKVA 5CMUA 4UB3A 4NTYA 3V7LA 3OFNG 1VMGA 2ETNA 1Y4MA 1VQNV 1MQ3A 4MVMA 1I08A 2IJKA 5DBAA 3E83A 3LK9A 2Z0AA 5LP6C 5IJ0B 1YJNV 2QR4A 3IJ4A 1OCZC 4GX5A 1NOMA 1XMQB 4WFGA 2VQEB 2EINC 1H38A 1S76D 9ICJA 1BS3A 2P5OA 5DB7A 1BPBA 4CS3A 7ICGA 1V55B 4MTGA 3W7SA 2IU3A 1G6UA 3B77A 1HP8A 1ZQQA 4IYIA 3JCUZ 2Y4UA 4OX9B 1X59A 2O1PA 3AUOA 1QLEC 1IVSA 4KHPO 2BOBC 5ITZA 3NXSA 3HKEB 4B08A 4P4PA 3PMNA 4TV8A 4DV1O 4F5NA 8ICUA 4UB5A 2P67A 5BPCA 1N33O 4I0XB 4LF8O 2YIBA 2DR8A 1AJPA 5B1OA 1F23A 2BTQA 2X6BA 5HFMA 1JA8A 3CXCU 1NT2B 1K3EA 1NVPD 3C2LA 2FMQA 2RDCA 3W7XA 3ZMTA 2ZHAA 4KLHA 1MG1A 9ICRA 1JPXA 1SERA 4RPYA 1VF6C 2VQEO 5CFUA 1M9NA 5JH7B 1VJ7A 1ZQLA 3JPRA 1XNQO 4DV6O 3ASOC 4BIOA 3S3WA 4X64O 5KAIZ 5J0QA 4UCTA 2ISPA 2R70A 5LXTA 3OM3B 3P30A 4PDRA 4LZDA 2NLJC 3RYCB 1ZSPA 3B0XA 4DR7B 5LP6A 1ZQBA 4JI7B 9ICTA 4B3TO 4NM1A 3M8AA 5LP6B 8ICOA 2CDYA 4WFFA 4J10A 2QE7G 1HR0B 1BE3H 1AVMA 4FH5A 2W6JG 1TAEA 5J2TB 4YHHO 8ICMA 4PHEA 3TFSA 1K97A 2JGDB 4RUEA 4AT7A 4Z2WA 1KQSU 1H2NA 5B3SB 5CB4A 5JJNB 4WQLA 1MNGA 1DLBA 4EKWA 3ISCA 4N23A 4PHAA 2BE3A 1S0VA 3K75D 3OV7A 3JD3A 3K9SA 5DDYA 4IGGA 5J2EA 1YITV 5J2JA 3AG4B 5D63A 3ABTA 2KSDA 5BMVB 4H13B 3H3AA 4KM5A 4I2EA 2MW2B 4X0BA 4B3MB 3AK2A 1WB8A 4YIOA 1MIVA 5LMNO 4O4IA 2O57A 3J81N 2LGWA 3AEIA 5L3BA 1VEWA 5DDMA 8ICIA 2UUBO 2EIJB 4H0LB 3B40A 1SQQH 3K5MA 4DV4B 3JPTA 3MDCA 1EBOA 2ZH7A 4X4SA 4JASA 4JTAB 1BZKA 3NR7A 3K79A 1R3IC 3JASA 5EBLC 5D46A 4RQ5A 2V4DA 4JTDB 1N8RW 2EJ7A 4QZ9A 3HKBA 2IBZH 1Q3EA 3FYIB 2M6YA 3MHSC 4QIWF 3OGUA 2OIEA 2WLLB 3PJSK 4PI0A 2QTOA 4FFKA 2XAJA 3EF2A 4DR1B 1ZQNA 5LA6B 2ZH4A 2DE0X 2YEVA 5IIKA 4UFZA 4LF5O 4B3RO 3SJQC 1Y74B 2N74A 1N34B 5L3CA 2QA4V 4KP4A 3AQMA 3FYEB 3G71V 3C5FA 3CCUV 2ZH5A 2GUZA 1Q6HA 4UB6Z 3SDLA 1EFRG 1MMMA 4UCVA 4DUZB 4PGYA 2BCUA 3JPSA 2DR7A 2BBJA 4O9MA 4UCSA 1GK9A 4MTOA 1NU1H 3QO5A 1VQMV 3UPSA 3FB5C 4DRXB 3ZHRA 4MVUA 1SA0A 4X20A 1N36B 4RT3A 1ZQTA 1OHHG 1DF4A 1FYJA 1MZFA 7ICOA 2M2WA 2YIBD 5F2VO 3ZBHA 2UUCO 1TA8A 3QG5A 3SJAC 5BY1A 2FCLA 4EEDA 3E89A 1HNZO 1NH2B 5FNVB 2EIJC 2OWOA 4JI8B 4IHJB 4X62B 2WPDG 4YD1A 4R64A 3CMEV 3OR6C 1P7BA 1XL6A 3IAYA 1XHXA 5CHGA 1HDJA 2WAMA 5J2FA 1PPJH 3UKMA 1VQPV 2PGGA 2UXCO 4LEWA 3A0BZ 4FM0A 1K4CC 3H1LH 4AQYB 4X20B 2Y48A 1Q6IA 3EFFK 1GN3A 8ICYA 1QQCA 5CN0A 4PA3A 2DOSA 1FJGO 4QZIA 5LHHA 2W0FC 5EBMC 1TFYA 7ICLA 4IIJB 3CPWU 2GBOA 3DC5A 3K04A 4K0KO 3ZIAG 3PHZA 1Q43A 4FM1A 4J9YB 4LF7O 3JPNA 4NKGB 4O2BB 3ABMB 4YN4A 3DGEA 2VANA 1R6TA 2UXBO 1N32O 1VF7A 3D36C 2JEUA 1AI6A 2ZINA 3OAAG 4MFFA 4LNUB 4JI3B 3WFRE 4TURA 1FA0A 4I4TB 4EEBA 4I2HA 3BRCA 4P9PA 5EIBD 4M04A 3WB0A 3N2KB 2AHZA 1KMIZ 3H1HH 1M1KW 4O4HB 4YMMA 1DTOA 4ZBMA 3CCLV 1NO5A 4CH3A 4JZGA 3WFOA 5B5EZ 1NR7A 3E2EA 4UBBA 4TV9B 3F5WC 2PBEA 4UD5A 2RMKB 5LXTB 2HJFC 1UFIA 2LGQA 4IQTA 1ZL8A 3ZEDA 5CJ7A 5IIMA 1K7DA 7ICSA 2HFEC 2B51A 4P30A 4X65O 4NXUA 5D4BA 4DYLA 2CTQA 2BCSA 5EYPA 4MKPA 3FD9A 2A9HA 1DGSA 3FB8C 4U3JB 2HLDG 1E1QG 4E8FA 1UEUA 2GV9A 4I2FA 4WC4A 2IUBA 3UPQA 4QJFB 4JYYA 3OEHG 1SA0B 7ICKA 8ICGA 1KECA 4DV0B 1ZQGA 4UAZA 4JYCA 2JRIA 1ROPA 4NXMO 4KXRA 1EM1A 4CH6A 1T5EA 1H2MA 1I5YA 4O4IB 4R7CA 3CC2V 5CA3A 2QGNA 3UXNA 4EV6A 4EP7A 2ODMA 4DV0O 3OVAA 2DVIA 5CBGA 3OMAB 1H2KA 1O9HA 1QBZA 3MBYA 1B06A 3ZRXA 1BPEA 3AG2B 2ZR3A 4I2JA 1LUWA 3CCEV 1Q7YW 1A32A 1OCCC 9ICKA 3GVMA 2YDEA 8ICAA 5J0TA 1K33A 5K1PA 3RJFA 5J0YA 3JD0A 3CRQA 2B56A 3RH4A 1I0HA 8ICWA 2ZIMA 1VQ7V 5HHHA 4UUJC 2WLJA 3CRCA 1SQGA 5DECA 4JWMA 2F43G 2HR3A 2ADQB 4M47A 3KCXA 4LEZA 3L74H 9ICPA 4AT9B 2P66A 3AG7A 4CH4A 1ZQJA 7ICEA 1FXKB 1ZQCA 2A3QA 1J5EO 9ICCA 4FLVA 1D5NA 1IDSA 3JCZA 2CAZC 3BAAA 2PZSA 1S5JA 4UB2A 1YIJV 5L3GA 3MD0A 3SPJA 2BCCH 3T1YO 1RP3B 7ICTA 4C7UA 4LF4O 2E74B 4X0AA 4JAVA 3MCRA 3IGAC 1KYOF 4TUYB 3AQLA 2HP8A 1OCOB 1R8AA 3RJGA 3JD1A 1VQKV 2F23A 2HHHB 1YVWA 3ABUA 3K5LA 3ZMVA 4OAHA 4GX0A 3U0ZA 2QDOA 4PA6A 4LFBB 2W6IG 8ICCA 3KZIZ 3CB2A 4CH5A 1Q86W 3FX7A 3ABKC 5DN6G 3EVKA 2R9IA 4DV2O 1IXBA 5J2DA 1DK1A 4PGQA 2A06H 1GN4A 3JPOA 1MA1A 2IU0A 7ICRA 4DR6B 2ZH6A 1XNRB 3VQWA 1PL4A 3WG7C 4DR3B 3BA9A 2PFQA 3K5OA 4RT2A 1R3JC 5EBWC 4PA4A 4P2ZA 4WC7A 4CS4A 4BW5A 2E76B 4O68A 3N2GB 4F4LA 1XUQA 2PUSA 5BR8B 4JYAO 1GH6A 2NR5A 4ZI7A 5EZYA 2XAGA 1IBMB 2HEPA 1OCOC 4WCEV 4JAAA 2P7TC 1PKXA 4FHXA 9ICOA 2YXHA 1BGYH 2CE4A 4DV7B 5LL6Y 1V4AA 4FJCC 1RFYA 1JVMA 1VQLV 4JI4O 3Q4HA 4LT6A 1V54B 4GUNA 5LYJB 4D6TH 4QZEA 1IBKB 2CTPA 2YUAA 4BAYA 4JI5B 4ZI7B 3WFQE 4I9QA 2NNUA 4NLNA 2XNDG 3CJHB 5KHHA 3HJ1A 2EINB 3ETGA 2BSKA 4KLJA 1SF9A 3SPHA 1MIWA 1IX9A 2UXXA 4JGSA 3LNNA 1IURA 4LFAO 1XMOO 4ZKIA 3OTOO 4O69A 3RYIA 4XRHA 1HNXB 2W9MA 3HW8A 2AW9A 1G8MA 7ICMA 1H8HG 4X5VA 4D7SA 3IFXA 4PHPA 3SYPA 4DR4B 5DKWA 1R3LC 5GONA 4O5KA 5J2KA 2X7RB 1KBHA 4XA5A 1RSOA 5LBQA 5LHGA 2F66C 1FS0G 2ZQMA 3CYOA 1CXZB 5IE9A 1IBKO 3OEEG 1BPXA 3GWOA 3OUFA 5KUKA 3H1KH 3UXPA 1ZQPA 2M7WA 2DN9A 4GXJA 4CC6A 3OVBA 1UPGA 1ORQC 2WA3A 1NTMH 4U3JA 1I94O 3C18A 4RQ6A 2E5LB 4X8AA 1O9GA 3C2KA 7ICIA 2CGNA 3E8BA 5EYPB 4M9GA 5KA5A 3ML0A 3L9DA 4XQ8A 2WA4A 3JASB 4TQFA 4EFEA 4M9JA 4TQDA 5LMUB 4EBKA 3SJBC 1EN5A 1FXVA 3WFVA 2ZE5A 3H1IH 3CCMV 4R65A 4G28B 2DRAA 3E22A 3FB7C 4DR2O 1ZX3A 4MW8A 4WFBV 5J0XA 2XUMA 3AG2C 2BOCC 3LSUA 4RQFA 2L6LA 4FZ1A 2UU9B 3RW0A 1NZ6A 2X0LA 3TK1A 1M90W 5KMGA 8ICXA 1GN6A 3C5GA 1EN4A 3QO7A 1QR9A 1TUBB 4X1IA 1M57B 4LF9B 3JARB 5BOMA 3MGHA 4WC3A 1ZLZA 4LNUA 2BCQA 4QE9A 1Y66A 3ZHSA 4CS2A 2YC0A 1UETA 3RVZA 3F5TA 4FFBB 4OPAA 1URFA 4JI2O 2FMSA 8ICZA 2JJ2G 2I9GA 1FXKC 5J2UA 1BQ0A 4FHVA 2C2AA 2ZR2A 4DV3O 5BZBA 1Q8IA 2KG7B 1GM9A 4QZGA 4DV7O 1MQ2A 2YS8A 5GTHZ 1WAZA 5J0PA 4K4HA 4TV8B 1FJGB 3AG4C 3ZRSA 4X88A 2W0XA 5D5PA 1GRJA 3RWRD 4LBEC 4WQKA 1OZ0A 2EWRA 5IYDO 3K59A 1XOUA 4LH7A 3TGUH 1AI5A 2WLKA 1FKAO 1VQOV 1ZAUA 2WLIA 4LP8A 1Z5WA 1Y6XA 1YTFB 3LDCA 3RBZA 3D8CA 4LFCB 3P32A 3B4SA 2RN9A 4DV6B 2X6CA 4I55A 1VQ5V 3B0YA 2Q0AA 4X4VA 2XT9A 3UO3A 4ZIBA 4O6AA 5H5NA 3B2EE 4WFAV 3TCUA 4X66B 2GA9D 3V7JA 4X4UA 1U97A 4RQ2A 3DXRA 4F6RB 1S3JA 3ZX6A 4RQEA 4DV2B 4WBNA 3OD4A 2BCRA 3K9AA 1ZQAA 4I2CA 1OCRB 2YI8A 3VQXA 7ICPA 1AR5A 5IINA 5KHIA 1JAJA 4M0AA 3AQKA 5JJEB 3ZHTA 3LQCB 1NQTA 1YJWV 1OV9A 4GKKB 2YICA 1BQZA 3NYBA 2JGDA 4NYKA 4JI0O 3QVNA 4Z6EA 5IT9N 2QKCA 3W7UA 1SZXA 5L3DA 3O9OA 2M2UA 4R63A 2FB5A 2IH1C 4R6ZA 4DUZO 4BIUA 2ZDIA 3L75H 4NXNB 4UVCA 2F4VB 2A79B 3HKCB 1GM7A 2H94A 1V54C 1J5EB 1YTFD 2VWJA 1Q5OA 9ICHA 4QZAA 4YCXA 2FMLA 1IBLB 2GUZB 2RFFA 1WP7A 8ICPA 4U3FH 4IG8A 1AR4A 4I9WA 3G67A 4HNAA 4JTCB 4DW1A 5JCOA 2JK5C 4J7JA 4UV8A 1AILA 1SETA 5JH7A 5LGUA 3SPGA 4UBCA 1ZJNA 3L71H 8ICHA 4H44B 3RJHA 4DO9A 3CX5F 8ICNA 4X4QA 2B9ZA 3ZHUA 4PI2A 4LFAB 4FO1A 2BTQB 1VF6A 2IJJA 4CC5A 4FH3A 3STZC 1S77D 1JMKC 3DSQA 7ICJA 1WA8B 1Q79A 3SYCA 4HYOA 2RQ6A 4UCRA 5ITZB 1OCRC 3ASNC 4BWAA 2QWNB 4CZZA 4AT8A 3N2KA 1SC5B 1GAXA 3TETA 1EZVH 4WC6A 2BBHA 3C66A 2Q8VA 2BPFA 3ZMSA 1TUEB 8ICQA 2P22C 4Z6FA 3JAKB 1ZWIC 1N4CA 2M2VA 4KLGA 3BA8A 2XAFA 9ICUA 3OTFA 3ABMC 5LA6A 1XDCA 1M4UA 1YXBA 3T1YB 1BHBA 1WOTA 3OWGA 2HN1A 3X2QB 4E4EA 1KC8W 1BPYA 4H37A 3A0HZ 4FLWA 4UB1A 4UD4A 5CBHA 4JLXA 1AI7A 1KP2A 3C90A 3H1JH 1YDXA 1K34A 5DEDA 1JMSA 4PD4F 1JOYA 4J41A 3TFRA 2D2CB 3DC6A 1KNYA 4MF8A 3UT5B 3RH5A 5FPOA 5B3QA 1SQXH 5B3SC 4B3SB 2EILC 4WC0A 1R1BA 2P6JA 4O4JA 2R72A 3ZHQA 1NTZH 5KHGA 4LH6A 5IJ0A 1BPDA 1E1RG 4YIPA 5LOVA 1L1FA 4IHJA 3ETQA 4O5EA 2OCHA 1BPZA 3UCSC 3FKSG 1KU9A 3CHXA 1ZQKA 5TISZ 1ZL8B 4QZ8A 2GHYA 5BOLA 4QZCA 4DUYB 2DR5A 2GDSA 4I2IA 3APOA 3ASNB 4DW0A 2OCCB 2MK3A 1JFFB 3RN4A 3CCVV 4E7XA 4FHWA 4LF7B 1N33B 1US6A 4IIJA 5IYCO 4I7ZB 3RJKA 4AHCA 4O4HA 4GYCB 2FL4A 3R65A 4TWKA 2EZOA 4N7RA 1UEVA 8ICTA 1XILA 2CGOA 1Z2GA 1Q82W 3E8GA 2Q5ZA 1J95A 4YJ2B 5EK0A 4DOAA 1NJIW 4DR2B 5CR0A 2F95B 3AK3A 4F5PA 4GT1A 2EIMC 1KP3A 4BW9A 2FMPA 4FLUA 1P84F 5CP2A 5B1BB 3WFPA 4S3NA 4B3RB 8ICSA 1MSWD 4X4PA 2DJVA 1AP6A 4NY8A 1ZJMA 4UVAA 4XDJA 1YEWA 5DB6A 5HFLA 2YXYA 5JVDB 2YEVB 1JR9A 5FNVA 4TUQA 1XBLA 4P4OA 2HN2A 2PI5A 2Q73A 5J2TA 8ICEA 4RWUA 2DYSB 2GWSA 4KLIA 3MDSA 3HJ4A 1ZQVA 1JQ0A 3CSXA 3HKBB 1AROP 4GKKO 5JJJB 3K57A 1Q78A 4RQ8A 4DUYO 3AU2A 1K92A 1N0NA 2LFRA 4HZ3A 5KUMA 5CBFA 2KKWA 4FMTA 1N36O 4PELA 4RQ3A 7ICNA 3JPPA 1B04A 1HNXO 4WC2A 4B3MO 1HNWB 4DOCA 5EIBC 1H8EG 2A7WA 3CEIA 4RWQA 4JI0B 4X4TA 2UXDB 4RO2A 3JD2A 2EBOA 4WFHA 2DRBA 1Q81W 3SYQA 3JAMN 4X1KB 5B1NA 4LF6B 9ICMA 1ZQEA 4B3SO 2ID1A 4NKUA 7ICQA 2O5AA 3D3QA 2GTAA 4FFBA 9ICEA 2P4VA 1QHTA 4EEQA 1FFXB 1ENVA 5IIIA 2ZNIA 4MF2A 7ICVA 4LF5B 4K97A 4X66O 4J42A 1PM9A 1X4TA 1K4DC 3UT5A 4QPJA 3BEHA 3O65A 3THOA 2HG5C 4NXTA 3RVYA 4YHHB 1QNMA 2EIMB 3JAWA 2CTRA 2B4VA 3SYAA 5IIJA 5DB9A 4PPXA 2ZHBA 2N04A 3OR7C 3HKEA 5FLXN 3T1HO 3G80A 4EGWA 3JAWB 9ICBA 9ICLA 1F4NA 3G6BA 3JYCA 3ZJZA 3ERCC 4I2DA 2BPGA 4UV9A 5CHEA 1SZTA 3CMAV 1YCIA 4ZOLB 4KLMA 4YMOA 1H2GA 4KLQA 4JV5B 3C3SA 3H39A 1XNRO 3TXSA 1RM1C 4X1YA 3OGCC 1M56C 3X2QC 2WLLA 2ZH3A 1KDHA 8ICLA 5D61A 2E75B 1L0LH 1ZQIA 1YSCA 2Q66A 2Q69A 2XAHA 5B66Z 5J2GA 1SS3A 2H3OA 1FFTB 2ITDC 1N32B 2F93B 2HJDA 2IW5A 4MVZA 4FLXA 5CA0A 4DXWA 1YJ9V 3CE2A 1PV0A 2Q9LA 2GTSA 4I50A 2ZXWB 1YI2V 2CUGA 4XDLA 1VF5B 4PA7A 3H37A 4LF4B 2Q7GA 2GSMB 2DMXA 3G6EV 1ZQDA 1W59A 4DRXA 4IQWA 1JN3A 4PJ0Z 3JATA 3L73H 1XHZA 1S72V 4WBYA 5HRGA 1Z5VA 5J2BA 2K1EA 2RCVA 4X62O 1WJZA 2EX3A 9ICXA 5B1AC 5IYZA 4YXWG 5JVDA 4ICGA 4JZ2A 4OAIZ 4P4MA 5D5QA 2VWKA 3RJEA 3CWBH 4LR3A 3SR2C 1TFWA 4J7ZA 3A0RA 2OTJV 2A0LA 3JPQA 1GKFA 1OCZB 4KFMA 3OE7G 5CA7A 1N0JA 5L3EA 4NXNO 4OGQB 4OPHA 4XJEA 2QWQB 3HKCA 3HWTA 3ZCCA 4X4NA 4RUFA 1W2BU 8ICRA 2ISOA 4WH5A 3ZS8C 5CWRA 2NRKA 4K96A 3ZN1A 2PFOA 3APQA 3M7MX 2IM9A 4XBFA 3CCJV 3BFRA 1YHQV 2YXLA 4I0XA 1YLQA 5DM6V 1XSLA 2YI9A 2P90A 3K0GA 4E2LA 1P4RA 5BXZA 1L0NH 4O4LB 3CK6A 5HRHA 3K3WA 4K4IA 4GXKA 1JJ2U 4RWNA 4KL1A 1R6NA 2ZNJA 1AJNA 1OJHA 5CA1B 4GZRB 4WBNB 5IWAO 5LMUO 5C8YA 3TJTA 4RWPA 1XMOB 1Q6UA 3RJIA 3HX0A 3K08A 9ICVA 1OU5A 2B1IA 2WSSG 9ICNA 4GXIA 2ZH8A 4OX9O 1CPYA 5J2UB 1F4MA 1SQPH 3T2MA 4WC5A 4M9LA 4NLZA 1MZEA 1IBMO 4JI6B 3STLC 2LFSA 3L72H 5IYZB 2R9RB 4RQ0A 4I2BA 4W4KA 1VFGA 4CBCA 2VQFO 5B1AB 3OW2U 4TUYA 2UUBB 4L87A 2WLNA 1KB9F 1F7YA 4AT8B 4X4OA 5IIOA 1AB3A 1BCCH 1NH2D 4FLTA 5IDJA 3RYHA 2PXIA 4KLSA 2EZPA 5LGTA 1S5LZ 4P9OA 4DV3B 4DV5B 4JI7O 4YJ3B 1SQVH 2AZ2A 3OTOB 5CA0B 1LR1A 4JYAB 3ER9B 4EBJA 1QR8A 3QNEA 3HKDA 4UAWA 3L70H 4M5DA 4J9ZB 4FO6A 3OGIB 1NKDA 3NKUA 5KHJA 4W4LA 4B7KA 2LW1A 2KB1A 2ZE6A 1H2LA 5KX5A 4JI5O 3RYFB 3UQ8A 4X1YB 4KLFA 4LF9O 2XAQA 3JALA 4LCUC 2AHYA 4O67A 4NR1A 4D7TA 3KCYA 1PX5A 3OUYA 2R9AA 4YY3B 2RJZA 1K8AW 1TUBA 2VS0A 3JZ0A 4FHPA 5KLVH 1XEQA 3B8MA 8ICBA 4JAUA 4JV5O 4LFBO 2ILMA 1KUQA 2AZ0A 2Y0PA 4LFCO 3VQYA 5D49A 3WG7B 1D5AA 1KEJA 3I55V 4K0KB 5BR8O 3SJCC 4I5SA 3ZN0A 5J0RA 3T1HB 4IT5A 3W7WA 2JIZG 5KAFZ 3C2MA 3W7TA 3MDAA 4K98A 2XASA 1THZA 3ZMZA 1M56B 4AQYO 2DR9A 1IZ3A 3RFRA 4B3TB 1HNZB 3CC4V 1ZQOA 1R6KA 1ZQXA 2UXCB 3FB6C 4O2AA 4K9AA 1ZQYA 2JVDA 4M9HA 1ZQSA 4J11A 4JI2B 1KKCA 2WLMA 1SQFA 2L35A 2K9PA 3B09A 1WN7A 4O2AB 4Z1VA 3PN1A 5CB4B 4X64B 4R8CA 3K7DA 4LF6O 4TOIA 4QZHA 4TUSA 4EB6A 4LF8B 3BY6A 8ICVA 1W0JG 1MSDA 3VOUA 5TZVA 2QTSA 3BHPA 2PFNA 4A5UB 1TVKA 3NWIA 1XSNA 1HNWO 1VIBA 4QGPA 4ZHQA 5C8YB 7ICFA 2ZH9A 3CRRA 2QWPB 9ICIA 1K5SA 2OTLV 2DQ3A 3ETEA 3RGBA 1PNMA 1BMFG 2Q0OC 5J0WA 4Q20A 3ZMUA 4I50B 2JS5A 1TVAA 5DBBA 5KHKA 2XOKG 3AG3C 4YJ3A 3ISBA 1PNKA 3CJHA 1PL0A 2ARHA 2EULA 4NXWA 1TGOA 2PF4E 4UCUA 4F5QA 2PYLA 1VARA 2ZH1A 1BSMA 5J2IA 3BCCH 3H9VA 1HUOA 2EIKC 4JI1B 2QJ1A 4RAIA 4IQVA 3OUSA 3P3PA 1FXHA 1GO3F 1WP8A 2CH7A 5BMVA 1RPRA 4P2HA 4EB6B 3KKYA 5DB8A 5HC9A 4WOYA 1GTOA 1AR1B 5FL7G 2LP7A 1PNLA 1N34O 3UQ2A 5GONB 4YMNA 5GW7A 3LNMB 2CH7B 1XMQO 2WLIB 3HKDB 4NXZA 1IBLO 9ICAA 3LSQA 1B3QA 4DR1O 4BR6A 4DR4O 1YZBA 2V7QG 2Z5UA 3K0DA 4X65B 2F4VO 4L8JA 4ABMA 3ETDA 5J2CA 5KMGB 4KLEA 4PDLA 4O4LA 3GB7C 4G2KA 4Z1MG 2Q68A 4MT8A 2ZKOA 4EFBA 4QPKA 2DW4A 2BSKB 5DBCA 4E80A 4I27A 4ATBA 1FXKA 3WB1A 4PDMA 4DV4O 4PHDA 3K03A 3T4DA 3RYCA 4YD2A 4UAYA 5LMNB 1VQ9V 2HHHO 1V55C 3Q4HB 3RH6A 5JCOC 1FD9A 4K8XA 5J2HA 3CC7V 3U10A 2ZM6O 2QSAA 5KA6A 3IC7A 5EC2C 3CRAA 3F7YC 2OIGA 2HVKC 4LVSA 2PY5A 1D2DA 2BTOA 3ZRWA 5HRKA 4HNAB 3UQ0A 4LC1A 2FYUH 5L3FA 2P4KA 3RT3C 1HWYA 3CRMA 4TV9A 3N2GA 1M57C 3QO8A 1LUVA 3CCRV 4NTXA 5HRLA 3QTCA 4DR7O 3A8TA 4Z6CA 3ISDA 2QKAA 8ICFA 4OAGA 3D36A 4LWSB 4MVQA 2DWDC 1TVKB 4UB8Z 4X4RA 2EJRA 2WLHA 9ICQA 4DR3O 2OT5A 2B5UA 3H01A 3EXAA 2FKXA 3RJJA 1GPJA 2JS3A 4WC1A 3SYOA 2DWEC 4JI3O 2QM4A 5H6RA 4F5RA 4FZ0A 3ASOB 1NS1A 2OYQA 3A2FA 5HRFA 1HW7A 2UXBB 3NVOA 4GX2A 5J2AA 4X1IB 2PI4A 2ZT9B 5E1AC 3GDXA 3JALB 1K5QA 3DTUB 1W0KG 1ZQWA 5IWAB 3CD6V 4NKTA 1JX9A 4XDKA 4TSFG 4FLZA 2ATKC 1F51A 4N21A 4ZOLA 4FM2A 1R3KC 1OCCB 3AQNA 1P49A 1YF2A 5HHIA 2UU9O 2YIAA 4RQ4A 3E22B 4I2AA 4H33A 1EZJA 4R50A 3T1CA 4M2YA 1RPOA 1WA8A 4PA9A 1R73A 4K99A 2QWOB 2LJ2A 3V7KA 2YSUB 3LDEA 4WCWA 4JYBA 7ICUA 1XREA 3OUYB 1M93A 2KG7A 2LO1A 4OXSA 1ZQZA 1NI8A 4TUPA 4MS2A 5IJ9B 1VP7A 1QVGU 3F7VC 5HRDA 5KX5B 4NVPA 5IY5B 3JD4A 4DR5O 4J80A 2OCCC 4WFEA 4MVSA 3BVOA 1I5XA 2G38A 4KLTA 5K1XA 3I5DA 1NVPB 3K58A 4WF9V 3N27A 5IJ9A 2LQTA 2UUCB 5J0UA 1VQ6V 4X1KA 1QLNA 2VRZA 5IYBO 9ICFA 2D3OW 1G1XB 3AG3B 3R66A 2JJ1G 1RPLA
chains in the Genus database with same CATH topology
1MIVA 1RZTA 1R8CA 4F5OA 5DDMA 4R65A 2IHMA 3WFSC 8ICIA 3V72A 2DRAA 3MDCA 3H37A 3JPTA 4RWOA 2HHPA 2ZH7A 4X4SA 4RQ1A 5J0XA 1ZQDA 4IQWA 1JN3A 4R66A 4WBYA 5J2BA 5HRGA 4NM2A 5CB1A 5D46A 4RQ5A 1ZQFA 4IQUA 4K4GA 9ICXA 4QZ9A 8ICXA 3C5GA 3OGUA 9ICSA 4P4MA 4KLLA 5BOMA 3MGHA 3RJEA 4WC3A 4MFAA 2BCQA 1ZQNA 1TFWA 1ZQMA 8ICJA 2ZH4A 5IIKA 3JPQA 5J0SA 1UETA 5CA7A 2FMSA 8ICZA 4KLDA 2I9GA 4FHVA 3HWTA 4QZFA 4X4NA 3AQMA 8ICRA 3MGIA 1RPLA 4QZGA 3C5FA 2ZH5A 2ISOA 1MQ2A 5CWRA 2NRKA 5J0PA 4K4HA 2PFOA 4PGYA 2BCUA 3JPSA 2DR7A 9ICGA 4O9MA 3HIYA 4ATBB 3PMLA 1YLQA 3UPSA 1XSLA 5HRHA 4K4IA 4RPXA 4GXKA 4RWNA 4RT3A 1ZQTA 4RQ7A 7ICOA 2M2WA 5F2VO 4RWPA 4FHYA 3RJIA 4PH5A 5HREA 3HX0A 9ICVA 1OU5A 9ICNA 4GXIA 3B0YA 2ZH8A 4X4VA 4WC5A 4M9LA 4NLZA 3V7JA 4X4UA 4RQ2A 4AT7B 2BCRA 4YD1A 4RQ0A 4R64A 1ZQAA 4I2CA 4I2BA 5IINA 7ICPA 1VFGA 2BCVA 1JAJA 4M0AA 3AQKA 5CHGA 5J2FA 3LQCB 3NYBA 4QZDA 4X4OA 4AT8B 4M9NA 1XSPA 5IIOA 4PGXA 2BPCA 4Z6EA 2PXIA 4KLSA 4AT9A 5J29A 2M2UA 8ICYA 4R63A 4QZIA 4XUSA 4EBJA 4UAWA 4M5DA 1TFYA 3PNCA 4FO6A 7ICLA 3JYYA 9ICHA 4QZAA 4YCXA 2RFFA 5HRBA 1R8BA 3JPNA 8ICPA 1JQRA 4IG8A 4KLFA 4YN4A 2VANA 3AU6A 4I29A 1PX5A 3OUYA 4KLOA 3JZ0A 4MFFA 4FHPA 1R89A 8ICBA 4UBCA 1ZJNA 3WFRE 8ICHA 4TURA 3RJHA 4DO9A 1FA0A 4I2HA 1ZQRA 5D49A 8ICNA 4M04A 4X4QA 2ZH2A 8ICKA 1KEJA 4YMMA 4Z6DA 1ZQHA 4I28A 1F5AA 4FH3A 1NO5A 1MIYA 5J0RA 4JWNA 3WFOA 4UBBA 7ICJA 1Q79A 3C2MA 2PBEA 3MDAA 4UD5A 4IQTA 4RPZA 5CJ7A 5IIMA 4AT8A 2DR9A 4MFCA 7ICSA 1HUZA 4WC6A 1ZQOA 1ZQXA 3C66A 3UXOA 2BPFA 1ZQYA 5HR9A 4M9HA 1ZQSA 8ICQA 5D4BA 4I2GA 2BCSA 4Z6FA 5HRIA 4KLGA 2M2VA 4E8FA 4DOBA 9ICUA 1UEUA 4I2FA 4QZHA 4TUSA 4WC4A 3UPQA 8ICVA 5TZVA 7ICKA 1WOTA 2PFNA 8ICGA 1XSNA 1ZQGA 1BPYA 4UAZA 4QZBA 4UB1A 4UD4A 7ICFA 2ZH9A 2PFPA 9ICIA 5EOZA 5DEDA 9ICWA 1JMSA 5J0WA 2M2TA 5IILA 1TV9A 1TVAA 5DBBA 3ISBA 3TFRA 3H38A 3UXNA 1KNYA 4MF8A 4EP7A 3RH5A 1ZQUA 3OVAA 2DVIA 4NLKA 4F5QA 2ZH1A 5J2IA 3MBYA 1HUOA 1BPEA 4WC0A 4I2JA 5J0OA 4KLUA 4IQVA 1BPDA 9ICKA 4P2HA 8ICAA 5J0TA 4O5EA 5DB8A 5HC9A 3RJFA 5J0YA 1BPZA 3RH4A 8ICWA 5HHHA 3UQ2A 1ZQKA 4YMNA 5DECA 4JWMA 4QZ8A 4NXZA 5BOLA 9ICAA 4QZCA 2DR5A 4M47A 4I2IA 7ICHA 9ICPA 3OVSA 4E7XA 4FHWA 4AT9B 2P66A 1ZQJA 4WBZA 4XQ7A 7ICEA 4O5CA 5J2CA 3RJKA 4KLEA 4LZGA 1ZQCA 9ICCA 5DBCA 1UEVA 4E80A 4I27A 8ICTA 4ATBA 4UB2A 4UB4A 4DOAA 5CR0A 7ICTA 4UB3A 3V7LA 4F5PA 4X0AA 4PHDA 3AQLA 1R8AA 3RJGA 1MQ3A 2FMPA 4YD2A 4UAYA 5DBAA 5CP2A 3WFPA 4S3NA 3RH6A 3LK9A 8ICSA 5J2HA 4X4PA 4NY8A 8ICCA 1ZJMA 1NOMA 5DB6A 9ICJA 5DB7A 4LVSA 1BPBA 5HRKA 7ICGA 5J2DA 4TUQA 4P4OA 3UQ0A 4PGQA 8ICEA 3JPOA 1ZQQA 2GWSA 7ICRA 4KLIA 2O1PA 2ZH6A 3AUOA 3HJ4A 1ZQVA 2PFQA 5HRLA 4RT2A 3ISDA 4Z6CA 4WC7A 4P4PA 3PMNA 8ICFA 1Q78A 4RQ8A 3AU2A 4F5NA 8ICUA 4UB5A 5BPCA 4RQ3A 4X4RA 7ICNA 3JPPA 9ICQA 2DR8A 4WC2A 3RJJA 4DOCA 4RWQA 4WC1A 4X4TA 3C2LA 2FMQA 4FHXA 2DRBA 4F5RA 9ICOA 2ZHAA 1V4AA 4KLHA 9ICRA 9ICMA 4RPYA 1ZQEA 2ID1A 4LT6A 4NKUA 7ICQA 2O5AA 1VJ7A 5HRFA 9ICEA 4QZEA 5J2AA 1ZQLA 3JPRA 3GDXA 5IIIA 4MF2A 3WFQE 7ICVA 5J0QA 2ISPA 1ZQWA 4NKTA 4NLNA 4LZDA 3HJ1A 3B0XA 4KLJA 1MIWA 3AQNA 5HHIA 1ZQBA 4RQ4A 4I2AA 5IIJA 5DB9A 4PPXA 2ZHBA 9ICTA 4NM1A 4XRHA 9ICBA 4M2YA 8ICOA 9ICLA 2W9MA 3HW8A 3V7KA 7ICMA 4FH5A 4I2DA 4X5VA 8ICMA 4PHEA 4PHPA 2BPGA 3TFSA 5DKWA 4WCWA 4O5KA 5J2KA 4KLMA 4YMOA 7ICUA 4KLQA 4XA5A 4AT7A 3OUYB 3H39A 1ZQZA 4TUPA 1BPXA 3ISCA 4PHAA 2BE3A 3K75D 3OV7A 5HRDA 3UXPA 1ZQPA 4GXJA 1KDHA 2ZH3A 3OVBA 8ICLA 1ZQIA 5DDYA 3C18A 5J2EA 4RQ6A 2Q66A 5J2JA 4KLTA 3C2KA 7ICIA 5J2GA 4M9GA 3H3AA 4I2EA 3L9DA 4XQ8A 5J0UA 4X0BA 4M9JA 9ICFA 4EBKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MIV A;  1RZT A;  1R8C A;  4F5O A;  5DDM A;  4R65 A;  2IHM A;  3WFS C;  8ICI A;  3V72 A;  2DRA A;  3MDC A;  3H37 A;  3JPT A;  4RWO A;  2HHP A;  2ZH7 A;  4X4S A;  4RQ1 A;  5J0X A;  1ZQD A;  4IQW A;  1JN3 A;  4R66 A;  4WBY A;  5J2B A;  5HRG A;  4NM2 A;  5CB1 A;  5D46 A;  4RQ5 A;  1ZQF A;  4IQU A;  4K4G A;  9ICX A;  4QZ9 A;  8ICX A;  3C5G A;  3OGU A;  9ICS A;  4P4M A;  4KLL A;  5BOM A;  3MGH A;  3RJE A;  4WC3 A;  4MFA A;  2BCQ A;  1ZQN A;  1TFW A;  1ZQM A;  8ICJ A;  2ZH4 A;  5IIK A;  3JPQ A;  5J0S A;  1UET A;  5CA7 A;  2FMS A;  8ICZ A;  4KLD A;  2I9G A;  4FHV A;  3HWT A;  4QZF A;  4X4N A;  3AQM A;  8ICR A;  3MGI A;  1RPL A;  4QZG A;  3C5F A;  2ZH5 A;  2ISO A;  1MQ2 A;  5CWR A;  2NRK A;  5J0P A;  4K4H A;  2PFO A;  4PGY A;  2BCU A;  3JPS A;  2DR7 A;  9ICG A;  4O9M A;  3HIY A;  4ATB B;  3PML A;  1YLQ A;  3UPS A;  1XSL A;  5HRH A;  4K4I A;  4RPX A;  4GXK A;  4RWN A;  4RT3 A;  1ZQT A;  4RQ7 A;  7ICO A;  2M2W A;  5F2V O;  4RWP A;  4FHY A;  3RJI A;  4PH5 A;  5HRE A;  3HX0 A;  9ICV A;  1OU5 A;  9ICN A;  4GXI A;  3B0Y A;  2ZH8 A;  4X4V A;  4WC5 A;  4M9L A;  4NLZ A;  3V7J A;  4X4U A;  4RQ2 A;  4AT7 B;  2BCR A;  4YD1 A;  4RQ0 A;  4R64 A;  1ZQA A;  4I2C A;  4I2B A;  5IIN A;  7ICP A;  1VFG A;  2BCV A;  1JAJ A;  4M0A A;  3AQK A;  5CHG A;  5J2F A;  3LQC B;  3NYB A;  4QZD A;  4X4O A;  4AT8 B;  4M9N A;  1XSP A;  5IIO A;  4PGX A;  2BPC A;  4Z6E A;  2PXI A;  4KLS A;  4AT9 A;  5J29 A;  2M2U A;  8ICY A;  4R63 A;  4QZI A;  4XUS A;  4EBJ A;  4UAW A;  4M5D A;  1TFY A;  3PNC A;  4FO6 A;  7ICL A;  3JYY A;  9ICH A;  4QZA A;  4YCX A;  2RFF A;  5HRB A;  1R8B A;  3JPN A;  8ICP A;  1JQR A;  4IG8 A;  4KLF A;  4YN4 A;  2VAN A;  3AU6 A;  4I29 A;  1PX5 A;  3OUY A;  4KLO A;  3JZ0 A;  4MFF A;  4FHP A;  1R89 A;  8ICB A;  4UBC A;  1ZJN A;  3WFR E;  8ICH A;  4TUR A;  3RJH A;  4DO9 A;  1FA0 A;  4I2H A;  1ZQR A;  5D49 A;  8ICN A;  4M04 A;  4X4Q A;  2ZH2 A;  8ICK A;  1KEJ A;  4YMM A;  4Z6D A;  1ZQH A;  4I28 A;  1F5A A;  4FH3 A;  1NO5 A;  1MIY A;  5J0R A;  4JWN A;  3WFO A;  4UBB A;  7ICJ A;  1Q79 A;  3C2M A;  2PBE A;  3MDA A;  4UD5 A;  4IQT A;  4RPZ A;  5CJ7 A;  5IIM A;  4AT8 A;  2DR9 A;  4MFC A;  7ICS A;  1HUZ A;  4WC6 A;  1ZQO A;  1ZQX A;  3C66 A;  3UXO A;  2BPF A;  1ZQY A;  5HR9 A;  4M9H A;  1ZQS A;  8ICQ A;  5D4B A;  4I2G A;  2BCS A;  4Z6F A;  5HRI A;  4KLG A;  2M2V A;  4E8F A;  4DOB A;  9ICU A;  1UEU A;  4I2F A;  4QZH A;  4TUS A;  4WC4 A;  3UPQ A;  8ICV A;  5TZV A;  7ICK A;  1WOT A;  2PFN A;  8ICG A;  1XSN A;  1ZQG A;  1BPY A;  4UAZ A;  4QZB A;  4UB1 A;  4UD4 A;  7ICF A;  2ZH9 A;  2PFP A;  9ICI A;  5EOZ A;  5DED A;  9ICW A;  1JMS A;  5J0W A;  2M2T A;  5IIL A;  1TV9 A;  1TVA A;  5DBB A;  3ISB A;  3TFR A;  3H38 A;  3UXN A;  1KNY A;  4MF8 A;  4EP7 A;  3RH5 A;  1ZQU A;  3OVA A;  2DVI A;  4NLK A;  4F5Q A;  2ZH1 A;  5J2I A;  3MBY A;  1HUO A;  1BPE A;  4WC0 A;  4I2J A;  5J0O A;  4KLU A;  4IQV A;  1BPD A;  9ICK A;  4P2H A;  8ICA A;  5J0T A;  4O5E A;  5DB8 A;  5HC9 A;  3RJF A;  5J0Y A;  1BPZ A;  3RH4 A;  8ICW A;  5HHH A;  3UQ2 A;  1ZQK A;  4YMN A;  5DEC A;  4JWM A;  4QZ8 A;  4NXZ A;  5BOL A;  9ICA A;  4QZC A;  2DR5 A;  4M47 A;  4I2I A;  7ICH A;  9ICP A;  3OVS A;  4E7X A;  4FHW A;  4AT9 B;  2P66 A;  1ZQJ A;  4WBZ A;  4XQ7 A;  7ICE A;  4O5C A;  5J2C A;  3RJK A;  4KLE A;  4LZG A;  1ZQC A;  9ICC A;  5DBC A;  1UEV A;  4E80 A;  4I27 A;  8ICT A;  4ATB A;  4UB2 A;  4UB4 A;  4DOA A;  5CR0 A;  7ICT A;  4UB3 A;  3V7L A;  4F5P A;  4X0A A;  4PHD A;  3AQL A;  1R8A A;  3RJG A;  1MQ3 A;  2FMP A;  4YD2 A;  4UAY A;  5DBA A;  5CP2 A;  3WFP A;  4S3N A;  3RH6 A;  3LK9 A;  8ICS A;  5J2H A;  4X4P A;  4NY8 A;  8ICC A;  1ZJM A;  1NOM A;  5DB6 A;  9ICJ A;  5DB7 A;  4LVS A;  1BPB A;  5HRK A;  7ICG A;  5J2D A;  4TUQ A;  4P4O A;  3UQ0 A;  4PGQ A;  8ICE A;  3JPO A;  1ZQQ A;  2GWS A;  7ICR A;  4KLI A;  2O1P A;  2ZH6 A;  3AUO A;  3HJ4 A;  1ZQV A;  2PFQ A;  5HRL A;  4RT2 A;  3ISD A;  4Z6C A;  4WC7 A;  4P4P A;  3PMN A;  8ICF A;  1Q78 A;  4RQ8 A;  3AU2 A;  4F5N A;  8ICU A;  4UB5 A;  5BPC A;  4RQ3 A;  4X4R A;  7ICN A;  3JPP A;  9ICQ A;  2DR8 A;  4WC2 A;  3RJJ A;  4DOC A;  4RWQ A;  4WC1 A;  4X4T A;  3C2L A;  2FMQ A;  4FHX A;  2DRB A;  4F5R A;  9ICO A;  2ZHA A;  1V4A A;  4KLH A;  9ICR A;  9ICM A;  4RPY A;  1ZQE A;  2ID1 A;  4LT6 A;  4NKU A;  7ICQ A;  2O5A A;  1VJ7 A;  5HRF A;  9ICE A;  4QZE A;  5J2A A;  1ZQL A;  3JPR A;  3GDX A;  5III A;  4MF2 A;  3WFQ E;  7ICV A;  5J0Q A;  2ISP A;  1ZQW A;  4NKT A;  4NLN A;  4LZD A;  3HJ1 A;  3B0X A;  4KLJ A;  1MIW A;  3AQN A;  5HHI A;  1ZQB A;  4RQ4 A;  4I2A A;  5IIJ A;  5DB9 A;  4PPX A;  2ZHB A;  9ICT A;  4NM1 A;  4XRH A;  9ICB A;  4M2Y A;  8ICO A;  9ICL A;  2W9M A;  3HW8 A;  3V7K A;  7ICM A;  4FH5 A;  4I2D A;  4X5V A;  8ICM A;  4PHE A;  4PHP A;  2BPG A;  3TFS A;  5DKW A;  4WCW A;  4O5K A;  5J2K A;  4KLM A;  4YMO A;  7ICU A;  4KLQ A;  4XA5 A;  4AT7 A;  3OUY B;  3H39 A;  1ZQZ A;  4TUP A;  1BPX A;  3ISC A;  4PHA A;  2BE3 A;  3K75 D;  3OV7 A;  5HRD A;  3UXP A;  1ZQP A;  4GXJ A;  1KDH A;  2ZH3 A;  3OVB A;  8ICL A;  1ZQI A;  5DDY A;  3C18 A;  5J2E A;  4RQ6 A;  2Q66 A;  5J2J A;  4KLT A;  3C2K A;  7ICI A;  5J2G A;  4M9G A;  3H3A A;  4I2E A;  3L9D A;  4XQ8 A;  5J0U A;  4X0B A;  4M9J A;  9ICF A;  4EBK A; 
#chains in the Genus database with same CATH topology
 2AXT Z;  1RZT A;  1R8C A;  1JJO A;  4F5O A;  2IHM A;  3WFS C;  2JDI G;  3AK1 A;  3V72 A;  3HB3 B;  1MAB G;  3OT7 A;  4RWO A;  5CFS A;  2HHP A;  4PHZ A;  2CK3 G;  1DF5 A;  5AG2 A;  4RQ1 A;  3ABK B;  1JFF A;  2F1M A;  3CXH F;  1BL8 A;  4R66 A;  1S5H C;  4UCO A;  4NM2 A;  5CB1 A;  2Q7H A;  2ZXW C;  4J7K A;  4NXM B;  5B1B C;  4FLY A;  1ZQF A;  5FPR A;  4IQU A;  4K4G A;  1I7F A;  5H9C A;  5CFT A;  4K9B A;  5D62 A;  4F6E A;  4ZHQ B;  1CEZ A;  9ICS A;  1WNS A;  4KLL A;  3CCS V;  2UUA O;  4GKJ B;  3K06 A;  3WU2 Z;  1XL4 A;  4I0U A;  2ITC C;  2V1D A;  5LOV B;  4MFA A;  3FFQ A;  1ZQM A;  2ZIO A;  8ICJ A;  5IY5 C;  3UO2 A;  3AG1 B;  2DYS C;  1L8D A;  1UJW B;  2RNB A;  5J0S A;  2YID A;  4JI4 B;  1COW G;  4Q6G A;  4KLD A;  4GKJ O;  1RM1 B;  5H6Q A;  2IHO A;  3ZRV A;  2ZDI C;  3E86 A;  4QZF A;  3MGI A;  3HR0 A;  4FPP A;  3SPC A;  3SPI A;  4U7N A;  3G4S V;  1IXM A;  9ICG A;  3QF7 A;  3HIY A;  1QCE A;  4ATB B;  3PML A;  2ZD9 A;  2E3C A;  2ZE7 A;  4RPX A;  4MVO A;  2GAF D;  2Y4T A;  1AP5 A;  4RQ7 A;  4QE7 A;  1FFX A;  4JI8 O;  2EIL B;  2DQ0 A;  4FHY A;  4FK5 C;  4PH5 A;  4DO2 A;  5HRE A;  3FAV A;  3CP1 A;  3VBB A;  1BT8 A;  4PDV A;  3ABL B;  1XQ8 A;  2JEX A;  1NBM G;  1PP9 H;  4NTW A;  2LW7 A;  3ZRW B;  3FAV B;  5C93 A;  4AT7 B;  1Y67 A;  2QWR B;  1Y76 A;  3K5N A;  3MAQ A;  1KD1 W;  4JPR A;  2Y69 B;  2FTK A;  4YJ2 A;  3OMN B;  2BCV A;  3SGI A;  2P06 A;  4DV1 B;  4O4J B;  1G4Y B;  1ZTE A;  4JLZ A;  3BPZ A;  4GX1 A;  4ASU G;  4QZD A;  5LHI A;  2UUA B;  4M9N A;  3RYI B;  4UVB A;  3B8N A;  1XSP A;  3I56 V;  4PGX A;  5EC1 C;  4NB5 A;  2BPC A;  3LDD A;  2Z3Y A;  4QNH B;  1ZUQ A;  4AT9 A;  5J29 A;  2DYR B;  3UM7 A;  2XTA A;  3AG1 C;  4MW3 A;  1PD3 A;  1V9P A;  4DK1 A;  1FAF A;  4XUS A;  1MOF A;  1QLE B;  2ADP A;  3RYH B;  4GLX A;  3PNC A;  4AIL C;  2WWW A;  3JYY A;  2AGA A;  2QM8 A;  2Y0I A;  4DR5 B;  4TT3 G;  2QEX V;  1KKD A;  5HRB A;  1R8B A;  2IJH A;  3EHB B;  1JQR A;  3ABL C;  3U11 A;  2E5L O;  2X6A A;  1I94 B;  1AJQ A;  2IJI A;  1CP9 A;  3BAB A;  1FPO A;  5H2F Z;  3AU6 A;  2NN4 A;  4I29 A;  3WB2 A;  2XHB A;  4KLO A;  2Y69 C;  1GN2 A;  1R89 A;  5EZY B;  1XI1 A;  3E8F A;  3IC9 A;  5JTG A;  3E8H A;  1WLE A;  3VQV A;  1ZQR A;  1RSO B;  4MTX A;  4BIZ A;  2ZH2 A;  8ICK A;  3LUT B;  5JWP A;  4HAM A;  4LEV A;  5CA1 A;  3LSS A;  3OMI B;  4Z6D A;  1WB7 A;  1SRY A;  2DYR C;  1ZQH A;  4I28 A;  3HPL C;  1F5A A;  1MIY A;  1EN6 A;  4JWN A;  1VQ8 V;  4K8V A;  3JSL A;  3KG2 A;  2B1G A;  4NXV A;  4LWS A;  4NXX A;  3MHH C;  3JSN A;  5A9G A;  4FIP C;  4KHP B;  4FVM A;  1BHA A;  4K8Z A;  2PTM A;  4RPZ A;  2Q4P A;  2QKS A;  4MFC A;  4K35 A;  4HBN A;  3DXR B;  4F6R A;  3JCF A;  1HUZ A;  3TXQ A;  2HVJ C;  3UXO A;  4K3A A;  1QVF U;  1M5I A;  5HR9 A;  4YY3 O;  4IYH A;  2QM7 A;  1E79 G;  1QU7 A;  1SES A;  4I2G A;  3J7A U;  5B3P A;  5HRI A;  2Q7E A;  4U7O A;  4OAF A;  5GTI Z;  4DOB A;  4LEY A;  3E35 A;  5LYJ A;  5A2Q N;  1GM8 A;  4X89 A;  3CCQ V;  1P7G A;  4I55 B;  3RYF A;  4MTF A;  4HX0 A;  4QZB A;  1H2S B;  4DV5 O;  2PFP A;  5EOZ A;  4GCZ A;  4MVR A;  4B7E A;  5E79 Z;  9ICW A;  5IIL A;  2M2T A;  1TV9 A;  3ICX A;  2ZE8 A;  2Q6A A;  3H38 A;  3D3I A;  2PYJ A;  4I4T A;  4JF3 A;  1SQB H;  1ZQU A;  4NLK A;  1XNQ B;  2VQF B;  1LNQ A;  4DR6 O;  3ZHV A;  1WPX A;  1Y76 B;  1GMG A;  1U96 A;  2ZM6 B;  3C3T A;  3JAK A;  3T4Z A;  5J0O A;  5JQG B;  2Q67 A;  1VQ4 V;  4KLU A;  4JI6 O;  2JGU A;  1K73 W;  5LGN A;  2N05 A;  4O2B A;  4AI8 A;  5JQG A;  2UXN A;  1Y74 A;  3JAR A;  2HKO A;  2EIK B;  4PV1 B;  3J80 N;  4MSW C;  1WPB A;  4JI1 O;  2IH3 C;  3GWK C;  2UXD O;  1NR1 A;  4G27 B;  3S3X A;  2H8P C;  3JAT B;  4IL6 Z;  7ICH A;  3OVS A;  3M99 B;  4X9Q A;  1JCH A;  2ZCE A;  5J9P C;  4WBZ A;  2CTW A;  4XQ7 A;  4O5C A;  4LZG A;  1HR0 O;  3CS5 A;  2KQX A;  1Q90 D;  4KUM A;  1NTK H;  1K9M W;  4UXN A;  3P3N A;  3ER8 C;  4DK0 A;  1B6Q A;  4KB6 A;  1AI4 A;  4UB4 A;  1SKV A;  5CMU A;  4UB3 A;  4NTY A;  3V7L A;  3OFN G;  1VMG A;  2ETN A;  1Y4M A;  1VQN V;  1MQ3 A;  4MVM A;  1I08 A;  2IJK A;  5DBA A;  3E83 A;  3LK9 A;  2Z0A A;  5LP6 C;  5IJ0 B;  1YJN V;  2QR4 A;  3IJ4 A;  1OCZ C;  4GX5 A;  1NOM A;  1XMQ B;  4WFG A;  2VQE B;  2EIN C;  1H38 A;  1S76 D;  9ICJ A;  1BS3 A;  2P5O A;  5DB7 A;  1BPB A;  4CS3 A;  7ICG A;  1V55 B;  4MTG A;  3W7S A;  2IU3 A;  1G6U A;  3B77 A;  1HP8 A;  1ZQQ A;  4IYI A;  3JCU Z;  2Y4U A;  4OX9 B;  1X59 A;  2O1P A;  3AUO A;  1QLE C;  1IVS A;  4KHP O;  2BOB C;  5ITZ A;  3NXS A;  3HKE B;  4B08 A;  4P4P A;  3PMN A;  4TV8 A;  4DV1 O;  4F5N A;  8ICU A;  4UB5 A;  2P67 A;  5BPC A;  1N33 O;  4I0X B;  4LF8 O;  2YIB A;  2DR8 A;  1AJP A;  5B1O A;  1F23 A;  2BTQ A;  2X6B A;  5HFM A;  1JA8 A;  3CXC U;  1NT2 B;  1K3E A;  1NVP D;  3C2L A;  2FMQ A;  2RDC A;  3W7X A;  3ZMT A;  2ZHA A;  4KLH A;  1MG1 A;  9ICR A;  1JPX A;  1SER A;  4RPY A;  1VF6 C;  2VQE O;  5CFU A;  1M9N A;  5JH7 B;  1VJ7 A;  1ZQL A;  3JPR A;  1XNQ O;  4DV6 O;  3ASO C;  4BIO A;  3S3W A;  4X64 O;  5KAI Z;  5J0Q A;  4UCT A;  2ISP A;  2R70 A;  5LXT A;  3OM3 B;  3P30 A;  4PDR A;  4LZD A;  2NLJ C;  3RYC B;  1ZSP A;  3B0X A;  4DR7 B;  5LP6 A;  1ZQB A;  4JI7 B;  9ICT A;  4B3T O;  4NM1 A;  3M8A A;  5LP6 B;  8ICO A;  2CDY A;  4WFF A;  4J10 A;  2QE7 G;  1HR0 B;  1BE3 H;  1AVM A;  4FH5 A;  2W6J G;  1TAE A;  5J2T B;  4YHH O;  8ICM A;  4PHE A;  3TFS A;  1K97 A;  2JGD B;  4RUE A;  4AT7 A;  4Z2W A;  1KQS U;  1H2N A;  5B3S B;  5CB4 A;  5JJN B;  4WQL A;  1MNG A;  1DLB A;  4EKW A;  3ISC A;  4N23 A;  4PHA A;  2BE3 A;  1S0V A;  3K75 D;  3OV7 A;  3JD3 A;  3K9S A;  5DDY A;  4IGG A;  5J2E A;  1YIT V;  5J2J A;  3AG4 B;  5D63 A;  3ABT A;  2KSD A;  5BMV B;  4H13 B;  3H3A A;  4KM5 A;  4I2E A;  2MW2 B;  4X0B A;  4B3M B;  3AK2 A;  1WB8 A;  4YIO A;  1MIV A;  5LMN O;  4O4I A;  2O57 A;  3J81 N;  2LGW A;  3AEI A;  5L3B A;  1VEW A;  5DDM A;  8ICI A;  2UUB O;  2EIJ B;  4H0L B;  3B40 A;  1SQQ H;  3K5M A;  4DV4 B;  3JPT A;  3MDC A;  1EBO A;  2ZH7 A;  4X4S A;  4JAS A;  4JTA B;  1BZK A;  3NR7 A;  3K79 A;  1R3I C;  3JAS A;  5EBL C;  5D46 A;  4RQ5 A;  2V4D A;  4JTD B;  1N8R W;  2EJ7 A;  4QZ9 A;  3HKB A;  2IBZ H;  1Q3E A;  3FYI B;  2M6Y A;  3MHS C;  4QIW F;  3OGU A;  2OIE A;  2WLL B;  3PJS K;  4PI0 A;  2QTO A;  4FFK A;  2XAJ A;  3EF2 A;  4DR1 B;  1ZQN A;  5LA6 B;  2ZH4 A;  2DE0 X;  2YEV A;  5IIK A;  4UFZ A;  4LF5 O;  4B3R O;  3SJQ C;  1Y74 B;  2N74 A;  1N34 B;  5L3C A;  2QA4 V;  4KP4 A;  3AQM A;  3FYE B;  3G71 V;  3C5F A;  3CCU V;  2ZH5 A;  2GUZ A;  1Q6H A;  4UB6 Z;  3SDL A;  1EFR G;  1MMM A;  4UCV A;  4DUZ B;  4PGY A;  2BCU A;  3JPS A;  2DR7 A;  2BBJ A;  4O9M A;  4UCS A;  1GK9 A;  4MTO A;  1NU1 H;  3QO5 A;  1VQM V;  3UPS A;  3FB5 C;  4DRX B;  3ZHR A;  4MVU A;  1SA0 A;  4X20 A;  1N36 B;  4RT3 A;  1ZQT A;  1OHH G;  1DF4 A;  1FYJ A;  1MZF A;  7ICO A;  2M2W A;  2YIB D;  5F2V O;  3ZBH A;  2UUC O;  1TA8 A;  3QG5 A;  3SJA C;  5BY1 A;  2FCL A;  4EED A;  3E89 A;  1HNZ O;  1NH2 B;  5FNV B;  2EIJ C;  2OWO A;  4JI8 B;  4IHJ B;  4X62 B;  2WPD G;  4YD1 A;  4R64 A;  3CME V;  3OR6 C;  1P7B A;  1XL6 A;  3IAY A;  1XHX A;  5CHG A;  1HDJ A;  2WAM A;  5J2F A;  1PPJ H;  3UKM A;  1VQP V;  2PGG A;  2UXC O;  4LEW A;  3A0B Z;  4FM0 A;  1K4C C;  3H1L H;  4AQY B;  4X20 B;  2Y48 A;  1Q6I A;  3EFF K;  1GN3 A;  8ICY A;  1QQC A;  5CN0 A;  4PA3 A;  2DOS A;  1FJG O;  4QZI A;  5LHH A;  2W0F C;  5EBM C;  1TFY A;  7ICL A;  4IIJ B;  3CPW U;  2GBO A;  3DC5 A;  3K04 A;  4K0K O;  3ZIA G;  3PHZ A;  1Q43 A;  4FM1 A;  4J9Y B;  4LF7 O;  3JPN A;  4NKG B;  4O2B B;  3ABM B;  4YN4 A;  3DGE A;  2VAN A;  1R6T A;  2UXB O;  1N32 O;  1VF7 A;  3D36 C;  2JEU A;  1AI6 A;  2ZIN A;  3OAA G;  4MFF A;  4LNU B;  4JI3 B;  3WFR E;  4TUR A;  1FA0 A;  4I4T B;  4EEB A;  4I2H A;  3BRC A;  4P9P A;  5EIB D;  4M04 A;  3WB0 A;  3N2K B;  2AHZ A;  1KMI Z;  3H1H H;  1M1K W;  4O4H B;  4YMM A;  1DTO A;  4ZBM A;  3CCL V;  1NO5 A;  4CH3 A;  4JZG A;  3WFO A;  5B5E Z;  1NR7 A;  3E2E A;  4UBB A;  4TV9 B;  3F5W C;  2PBE A;  4UD5 A;  2RMK B;  5LXT B;  2HJF C;  1UFI A;  2LGQ A;  4IQT A;  1ZL8 A;  3ZED A;  5CJ7 A;  5IIM A;  1K7D A;  7ICS A;  2HFE C;  2B51 A;  4P30 A;  4X65 O;  4NXU A;  5D4B A;  4DYL A;  2CTQ A;  2BCS A;  5EYP A;  4MKP A;  3FD9 A;  2A9H A;  1DGS A;  3FB8 C;  4U3J B;  2HLD G;  1E1Q G;  4E8F A;  1UEU A;  2GV9 A;  4I2F A;  4WC4 A;  2IUB A;  3UPQ A;  4QJF B;  4JYY A;  3OEH G;  1SA0 B;  7ICK A;  8ICG A;  1KEC A;  4DV0 B;  1ZQG A;  4UAZ A;  4JYC A;  2JRI A;  1ROP A;  4NXM O;  4KXR A;  1EM1 A;  4CH6 A;  1T5E A;  1H2M A;  1I5Y A;  4O4I B;  4R7C A;  3CC2 V;  5CA3 A;  2QGN A;  3UXN A;  4EV6 A;  4EP7 A;  2ODM A;  4DV0 O;  3OVA A;  2DVI A;  5CBG A;  3OMA B;  1H2K A;  1O9H A;  1QBZ A;  3MBY A;  1B06 A;  3ZRX A;  1BPE A;  3AG2 B;  2ZR3 A;  4I2J A;  1LUW A;  3CCE V;  1Q7Y W;  1A32 A;  1OCC C;  9ICK A;  3GVM A;  2YDE A;  8ICA A;  5J0T A;  1K33 A;  5K1P A;  3RJF A;  5J0Y A;  3JD0 A;  3CRQ A;  2B56 A;  3RH4 A;  1I0H A;  8ICW A;  2ZIM A;  1VQ7 V;  5HHH A;  4UUJ C;  2WLJ A;  3CRC A;  1SQG A;  5DEC A;  4JWM A;  2F43 G;  2HR3 A;  2ADQ B;  4M47 A;  3KCX A;  4LEZ A;  3L74 H;  9ICP A;  4AT9 B;  2P66 A;  3AG7 A;  4CH4 A;  1ZQJ A;  7ICE A;  1FXK B;  1ZQC A;  2A3Q A;  1J5E O;  9ICC A;  4FLV A;  1D5N A;  1IDS A;  3JCZ A;  2CAZ C;  3BAA A;  2PZS A;  1S5J A;  4UB2 A;  1YIJ V;  5L3G A;  3MD0 A;  3SPJ A;  2BCC H;  3T1Y O;  1RP3 B;  7ICT A;  4C7U A;  4LF4 O;  2E74 B;  4X0A A;  4JAV A;  3MCR A;  3IGA C;  1KYO F;  4TUY B;  3AQL A;  2HP8 A;  1OCO B;  1R8A A;  3RJG A;  3JD1 A;  1VQK V;  2F23 A;  2HHH B;  1YVW A;  3ABU A;  3K5L A;  3ZMV A;  4OAH A;  4GX0 A;  3U0Z A;  2QDO A;  4PA6 A;  4LFB B;  2W6I G;  8ICC A;  3KZI Z;  3CB2 A;  4CH5 A;  1Q86 W;  3FX7 A;  3ABK C;  5DN6 G;  3EVK A;  2R9I A;  4DV2 O;  1IXB A;  5J2D A;  1DK1 A;  4PGQ A;  2A06 H;  1GN4 A;  3JPO A;  1MA1 A;  2IU0 A;  7ICR A;  4DR6 B;  2ZH6 A;  1XNR B;  3VQW A;  1PL4 A;  3WG7 C;  4DR3 B;  3BA9 A;  2PFQ A;  3K5O A;  4RT2 A;  1R3J C;  5EBW C;  4PA4 A;  4P2Z A;  4WC7 A;  4CS4 A;  4BW5 A;  2E76 B;  4O68 A;  3N2G B;  4F4L A;  1XUQ A;  2PUS A;  5BR8 B;  4JYA O;  1GH6 A;  2NR5 A;  4ZI7 A;  5EZY A;  2XAG A;  1IBM B;  2HEP A;  1OCO C;  4WCE V;  4JAA A;  2P7T C;  1PKX A;  4FHX A;  9ICO A;  2YXH A;  1BGY H;  2CE4 A;  4DV7 B;  5LL6 Y;  1V4A A;  4FJC C;  1RFY A;  1JVM A;  1VQL V;  4JI4 O;  3Q4H A;  4LT6 A;  1V54 B;  4GUN A;  5LYJ B;  4D6T H;  4QZE A;  1IBK B;  2CTP A;  2YUA A;  4BAY A;  4JI5 B;  4ZI7 B;  3WFQ E;  4I9Q A;  2NNU A;  4NLN A;  2XND G;  3CJH B;  5KHH A;  3HJ1 A;  2EIN B;  3ETG A;  2BSK A;  4KLJ A;  1SF9 A;  3SPH A;  1MIW A;  1IX9 A;  2UXX A;  4JGS A;  3LNN A;  1IUR A;  4LFA O;  1XMO O;  4ZKI A;  3OTO O;  4O69 A;  3RYI A;  4XRH A;  1HNX B;  2W9M A;  3HW8 A;  2AW9 A;  1G8M A;  7ICM A;  1H8H G;  4X5V A;  4D7S A;  3IFX A;  4PHP A;  3SYP A;  4DR4 B;  5DKW A;  1R3L C;  5GON A;  4O5K A;  5J2K A;  2X7R B;  1KBH A;  4XA5 A;  1RSO A;  5LBQ A;  5LHG A;  2F66 C;  1FS0 G;  2ZQM A;  3CYO A;  1CXZ B;  5IE9 A;  1IBK O;  3OEE G;  1BPX A;  3GWO A;  3OUF A;  5KUK A;  3H1K H;  3UXP A;  1ZQP A;  2M7W A;  2DN9 A;  4GXJ A;  4CC6 A;  3OVB A;  1UPG A;  1ORQ C;  2WA3 A;  1NTM H;  4U3J A;  1I94 O;  3C18 A;  4RQ6 A;  2E5L B;  4X8A A;  1O9G A;  3C2K A;  7ICI A;  2CGN A;  3E8B A;  5EYP B;  4M9G A;  5KA5 A;  3ML0 A;  3L9D A;  4XQ8 A;  2WA4 A;  3JAS B;  4TQF A;  4EFE A;  4M9J A;  4TQD A;  5LMU B;  4EBK A;  3SJB C;  1EN5 A;  1FXV A;  3WFV A;  2ZE5 A;  3H1I H;  3CCM V;  4R65 A;  4G28 B;  2DRA A;  3E22 A;  3FB7 C;  4DR2 O;  1ZX3 A;  4MW8 A;  4WFB V;  5J0X A;  2XUM A;  3AG2 C;  2BOC C;  3LSU A;  4RQF A;  2L6L A;  4FZ1 A;  2UU9 B;  3RW0 A;  1NZ6 A;  2X0L A;  3TK1 A;  1M90 W;  5KMG A;  8ICX A;  1GN6 A;  3C5G A;  1EN4 A;  3QO7 A;  1QR9 A;  1TUB B;  4X1I A;  1M57 B;  4LF9 B;  3JAR B;  5BOM A;  3MGH A;  4WC3 A;  1ZLZ A;  4LNU A;  2BCQ A;  4QE9 A;  1Y66 A;  3ZHS A;  4CS2 A;  2YC0 A;  1UET A;  3RVZ A;  3F5T A;  4FFB B;  4OPA A;  1URF A;  4JI2 O;  2FMS A;  8ICZ A;  2JJ2 G;  2I9G A;  1FXK C;  5J2U A;  1BQ0 A;  4FHV A;  2C2A A;  2ZR2 A;  4DV3 O;  5BZB A;  1Q8I A;  2KG7 B;  1GM9 A;  4QZG A;  4DV7 O;  1MQ2 A;  2YS8 A;  5GTH Z;  1WAZ A;  5J0P A;  4K4H A;  4TV8 B;  1FJG B;  3AG4 C;  3ZRS A;  4X88 A;  2W0X A;  5D5P A;  1GRJ A;  3RWR D;  4LBE C;  4WQK A;  1OZ0 A;  2EWR A;  5IYD O;  3K59 A;  1XOU A;  4LH7 A;  3TGU H;  1AI5 A;  2WLK A;  1FKA O;  1VQO V;  1ZAU A;  2WLI A;  4LP8 A;  1Z5W A;  1Y6X A;  1YTF B;  3LDC A;  3RBZ A;  3D8C A;  4LFC B;  3P32 A;  3B4S A;  2RN9 A;  4DV6 B;  2X6C A;  4I55 A;  1VQ5 V;  3B0Y A;  2Q0A A;  4X4V A;  2XT9 A;  3UO3 A;  4ZIB A;  4O6A A;  5H5N A;  3B2E E;  4WFA V;  3TCU A;  4X66 B;  2GA9 D;  3V7J A;  4X4U A;  1U97 A;  4RQ2 A;  3DXR A;  4F6R B;  1S3J A;  3ZX6 A;  4RQE A;  4DV2 B;  4WBN A;  3OD4 A;  2BCR A;  3K9A A;  1ZQA A;  4I2C A;  1OCR B;  2YI8 A;  3VQX A;  7ICP A;  1AR5 A;  5IIN A;  5KHI A;  1JAJ A;  4M0A A;  3AQK A;  5JJE B;  3ZHT A;  3LQC B;  1NQT A;  1YJW V;  1OV9 A;  4GKK B;  2YIC A;  1BQZ A;  3NYB A;  2JGD A;  4NYK A;  4JI0 O;  3QVN A;  4Z6E A;  5IT9 N;  2QKC A;  3W7U A;  1SZX A;  5L3D A;  3O9O A;  2M2U A;  4R63 A;  2FB5 A;  2IH1 C;  4R6Z A;  4DUZ O;  4BIU A;  2ZDI A;  3L75 H;  4NXN B;  4UVC A;  2F4V B;  2A79 B;  3HKC B;  1GM7 A;  2H94 A;  1V54 C;  1J5E B;  1YTF D;  2VWJ A;  1Q5O A;  9ICH A;  4QZA A;  4YCX A;  2FML A;  1IBL B;  2GUZ B;  2RFF A;  1WP7 A;  8ICP A;  4U3F H;  4IG8 A;  1AR4 A;  4I9W A;  3G67 A;  4HNA A;  4JTC B;  4DW1 A;  5JCO A;  2JK5 C;  4J7J A;  4UV8 A;  1AIL A;  1SET A;  5JH7 A;  5LGU A;  3SPG A;  4UBC A;  1ZJN A;  3L71 H;  8ICH A;  4H44 B;  3RJH A;  4DO9 A;  3CX5 F;  8ICN A;  4X4Q A;  2B9Z A;  3ZHU A;  4PI2 A;  4LFA B;  4FO1 A;  2BTQ B;  1VF6 A;  2IJJ A;  4CC5 A;  4FH3 A;  3STZ C;  1S77 D;  1JMK C;  3DSQ A;  7ICJ A;  1WA8 B;  1Q79 A;  3SYC A;  4HYO A;  2RQ6 A;  4UCR A;  5ITZ B;  1OCR C;  3ASN C;  4BWA A;  2QWN B;  4CZZ A;  4AT8 A;  3N2K A;  1SC5 B;  1GAX A;  3TET A;  1EZV H;  4WC6 A;  2BBH A;  3C66 A;  2Q8V A;  2BPF A;  3ZMS A;  1TUE B;  8ICQ A;  2P22 C;  4Z6F A;  3JAK B;  1ZWI C;  1N4C A;  2M2V A;  4KLG A;  3BA8 A;  2XAF A;  9ICU A;  3OTF A;  3ABM C;  5LA6 A;  1XDC A;  1M4U A;  1YXB A;  3T1Y B;  1BHB A;  1WOT A;  3OWG A;  2HN1 A;  3X2Q B;  4E4E A;  1KC8 W;  1BPY A;  4H37 A;  3A0H Z;  4FLW A;  4UB1 A;  4UD4 A;  5CBH A;  4JLX A;  1AI7 A;  1KP2 A;  3C90 A;  3H1J H;  1YDX A;  1K34 A;  5DED A;  1JMS A;  4PD4 F;  1JOY A;  4J41 A;  3TFR A;  2D2C B;  3DC6 A;  1KNY A;  4MF8 A;  3UT5 B;  3RH5 A;  5FPO A;  5B3Q A;  1SQX H;  5B3S C;  4B3S B;  2EIL C;  4WC0 A;  1R1B A;  2P6J A;  4O4J A;  2R72 A;  3ZHQ A;  1NTZ H;  5KHG A;  4LH6 A;  5IJ0 A;  1BPD A;  1E1R G;  4YIP A;  5LOV A;  1L1F A;  4IHJ A;  3ETQ A;  4O5E A;  2OCH A;  1BPZ A;  3UCS C;  3FKS G;  1KU9 A;  3CHX A;  1ZQK A;  5TIS Z;  1ZL8 B;  4QZ8 A;  2GHY A;  5BOL A;  4QZC A;  4DUY B;  2DR5 A;  2GDS A;  4I2I A;  3APO A;  3ASN B;  4DW0 A;  2OCC B;  2MK3 A;  1JFF B;  3RN4 A;  3CCV V;  4E7X A;  4FHW A;  4LF7 B;  1N33 B;  1US6 A;  4IIJ A;  5IYC O;  4I7Z B;  3RJK A;  4AHC A;  4O4H A;  4GYC B;  2FL4 A;  3R65 A;  4TWK A;  2EZO A;  4N7R A;  1UEV A;  8ICT A;  1XIL A;  2CGO A;  1Z2G A;  1Q82 W;  3E8G A;  2Q5Z A;  1J95 A;  4YJ2 B;  5EK0 A;  4DOA A;  1NJI W;  4DR2 B;  5CR0 A;  2F95 B;  3AK3 A;  4F5P A;  4GT1 A;  2EIM C;  1KP3 A;  4BW9 A;  2FMP A;  4FLU A;  1P84 F;  5CP2 A;  5B1B B;  3WFP A;  4S3N A;  4B3R B;  8ICS A;  1MSW D;  4X4P A;  2DJV A;  1AP6 A;  4NY8 A;  1ZJM A;  4UVA A;  4XDJ A;  1YEW A;  5DB6 A;  5HFL A;  2YXY A;  5JVD B;  2YEV B;  1JR9 A;  5FNV A;  4TUQ A;  1XBL A;  4P4O A;  2HN2 A;  2PI5 A;  2Q73 A;  5J2T A;  8ICE A;  4RWU A;  2DYS B;  2GWS A;  4KLI A;  3MDS A;  3HJ4 A;  1ZQV A;  1JQ0 A;  3CSX A;  3HKB B;  1ARO P;  4GKK O;  5JJJ B;  3K57 A;  1Q78 A;  4RQ8 A;  4DUY O;  3AU2 A;  1K92 A;  1N0N A;  2LFR A;  4HZ3 A;  5KUM A;  5CBF A;  2KKW A;  4FMT A;  1N36 O;  4PEL A;  4RQ3 A;  7ICN A;  3JPP A;  1B04 A;  1HNX O;  4WC2 A;  4B3M O;  1HNW B;  4DOC A;  5EIB C;  1H8E G;  2A7W A;  3CEI A;  4RWQ A;  4JI0 B;  4X4T A;  2UXD B;  4RO2 A;  3JD2 A;  2EBO A;  4WFH A;  2DRB A;  1Q81 W;  3SYQ A;  3JAM N;  4X1K B;  5B1N A;  4LF6 B;  9ICM A;  1ZQE A;  4B3S O;  2ID1 A;  4NKU A;  7ICQ A;  2O5A A;  3D3Q A;  2GTA A;  4FFB A;  9ICE A;  2P4V A;  1QHT A;  4EEQ A;  1FFX B;  1ENV A;  5III A;  2ZNI A;  4MF2 A;  7ICV A;  4LF5 B;  4K97 A;  4X66 O;  4J42 A;  1PM9 A;  1X4T A;  1K4D C;  3UT5 A;  4QPJ A;  3BEH A;  3O65 A;  3THO A;  2HG5 C;  4NXT A;  3RVY A;  4YHH B;  1QNM A;  2EIM B;  3JAW A;  2CTR A;  2B4V A;  3SYA A;  5IIJ A;  5DB9 A;  4PPX A;  2ZHB A;  2N04 A;  3OR7 C;  3HKE A;  5FLX N;  3T1H O;  3G80 A;  4EGW A;  3JAW B;  9ICB A;  9ICL A;  1F4N A;  3G6B A;  3JYC A;  3ZJZ A;  3ERC C;  4I2D A;  2BPG A;  4UV9 A;  5CHE A;  1SZT A;  3CMA V;  1YCI A;  4ZOL B;  4KLM A;  4YMO A;  1H2G A;  4KLQ A;  4JV5 B;  3C3S A;  3H39 A;  1XNR O;  3TXS A;  1RM1 C;  4X1Y A;  3OGC C;  1M56 C;  3X2Q C;  2WLL A;  2ZH3 A;  1KDH A;  8ICL A;  5D61 A;  2E75 B;  1L0L H;  1ZQI A;  1YSC A;  2Q66 A;  2Q69 A;  2XAH A;  5B66 Z;  5J2G A;  1SS3 A;  2H3O A;  1FFT B;  2ITD C;  1N32 B;  2F93 B;  2HJD A;  2IW5 A;  4MVZ A;  4FLX A;  5CA0 A;  4DXW A;  1YJ9 V;  3CE2 A;  1PV0 A;  2Q9L A;  2GTS A;  4I50 A;  2ZXW B;  1YI2 V;  2CUG A;  4XDL A;  1VF5 B;  4PA7 A;  3H37 A;  4LF4 B;  2Q7G A;  2GSM B;  2DMX A;  3G6E V;  1ZQD A;  1W59 A;  4DRX A;  4IQW A;  1JN3 A;  4PJ0 Z;  3JAT A;  3L73 H;  1XHZ A;  1S72 V;  4WBY A;  5HRG A;  1Z5V A;  5J2B A;  2K1E A;  2RCV A;  4X62 O;  1WJZ A;  2EX3 A;  9ICX A;  5B1A C;  5IYZ A;  4YXW G;  5JVD A;  4ICG A;  4JZ2 A;  4OAI Z;  4P4M A;  5D5Q A;  2VWK A;  3RJE A;  3CWB H;  4LR3 A;  3SR2 C;  1TFW A;  4J7Z A;  3A0R A;  2OTJ V;  2A0L A;  3JPQ A;  1GKF A;  1OCZ B;  4KFM A;  3OE7 G;  5CA7 A;  1N0J A;  5L3E A;  4NXN O;  4OGQ B;  4OPH A;  4XJE A;  2QWQ B;  3HKC A;  3HWT A;  3ZCC A;  4X4N A;  4RUF A;  1W2B U;  8ICR A;  2ISO A;  4WH5 A;  3ZS8 C;  5CWR A;  2NRK A;  4K96 A;  3ZN1 A;  2PFO A;  3APQ A;  3M7M X;  2IM9 A;  4XBF A;  3CCJ V;  3BFR A;  1YHQ V;  2YXL A;  4I0X A;  1YLQ A;  5DM6 V;  1XSL A;  2YI9 A;  2P90 A;  3K0G A;  4E2L A;  1P4R A;  5BXZ A;  1L0N H;  4O4L B;  3CK6 A;  5HRH A;  3K3W A;  4K4I A;  4GXK A;  1JJ2 U;  4RWN A;  4KL1 A;  1R6N A;  2ZNJ A;  1AJN A;  1OJH A;  5CA1 B;  4GZR B;  4WBN B;  5IWA O;  5LMU O;  5C8Y A;  3TJT A;  4RWP A;  1XMO B;  1Q6U A;  3RJI A;  3HX0 A;  3K08 A;  9ICV A;  1OU5 A;  2B1I A;  2WSS G;  9ICN A;  4GXI A;  2ZH8 A;  4OX9 O;  1CPY A;  5J2U B;  1F4M A;  1SQP H;  3T2M A;  4WC5 A;  4M9L A;  4NLZ A;  1MZE A;  1IBM O;  4JI6 B;  3STL C;  2LFS A;  3L72 H;  5IYZ B;  2R9R B;  4RQ0 A;  4I2B A;  4W4K A;  1VFG A;  4CBC A;  2VQF O;  5B1A B;  3OW2 U;  4TUY A;  2UUB B;  4L87 A;  2WLN A;  1KB9 F;  1F7Y A;  4AT8 B;  4X4O A;  5IIO A;  1AB3 A;  1BCC H;  1NH2 D;  4FLT A;  5IDJ A;  3RYH A;  2PXI A;  4KLS A;  2EZP A;  5LGT A;  1S5L Z;  4P9O A;  4DV3 B;  4DV5 B;  4JI7 O;  4YJ3 B;  1SQV H;  2AZ2 A;  3OTO B;  5CA0 B;  1LR1 A;  4JYA B;  3ER9 B;  4EBJ A;  1QR8 A;  3QNE A;  3HKD A;  4UAW A;  3L70 H;  4M5D A;  4J9Z B;  4FO6 A;  3OGI B;  1NKD A;  3NKU A;  5KHJ A;  4W4L A;  4B7K A;  2LW1 A;  2KB1 A;  2ZE6 A;  1H2L A;  5KX5 A;  4JI5 O;  3RYF B;  3UQ8 A;  4X1Y B;  4KLF A;  4LF9 O;  2XAQ A;  3JAL A;  4LCU C;  2AHY A;  4O67 A;  4NR1 A;  4D7T A;  3KCY A;  1PX5 A;  3OUY A;  2R9A A;  4YY3 B;  2RJZ A;  1K8A W;  1TUB A;  2VS0 A;  3JZ0 A;  4FHP A;  5KLV H;  1XEQ A;  3B8M A;  8ICB A;  4JAU A;  4JV5 O;  4LFB O;  2ILM A;  1KUQ A;  2AZ0 A;  2Y0P A;  4LFC O;  3VQY A;  5D49 A;  3WG7 B;  1D5A A;  1KEJ A;  3I55 V;  4K0K B;  5BR8 O;  3SJC C;  4I5S A;  3ZN0 A;  5J0R A;  3T1H B;  4IT5 A;  3W7W A;  2JIZ G;  5KAF Z;  3C2M A;  3W7T A;  3MDA A;  4K98 A;  2XAS A;  1THZ A;  3ZMZ A;  1M56 B;  4AQY O;  2DR9 A;  1IZ3 A;  3RFR A;  4B3T B;  1HNZ B;  3CC4 V;  1ZQO A;  1R6K A;  1ZQX A;  2UXC B;  3FB6 C;  4O2A A;  4K9A A;  1ZQY A;  2JVD A;  4M9H A;  1ZQS A;  4J11 A;  4JI2 B;  1KKC A;  2WLM A;  1SQF A;  2L35 A;  2K9P A;  3B09 A;  1WN7 A;  4O2A B;  4Z1V A;  3PN1 A;  5CB4 B;  4X64 B;  4R8C A;  3K7D A;  4LF6 O;  4TOI A;  4QZH A;  4TUS A;  4EB6 A;  4LF8 B;  3BY6 A;  8ICV A;  1W0J G;  1MSD A;  3VOU A;  5TZV A;  2QTS A;  3BHP A;  2PFN A;  4A5U B;  1TVK A;  3NWI A;  1XSN A;  1HNW O;  1VIB A;  4QGP A;  4ZHQ A;  5C8Y B;  7ICF A;  2ZH9 A;  3CRR A;  2QWP B;  9ICI A;  1K5S A;  2OTL V;  2DQ3 A;  3ETE A;  3RGB A;  1PNM A;  1BMF G;  2Q0O C;  5J0W A;  4Q20 A;  3ZMU A;  4I50 B;  2JS5 A;  1TVA A;  5DBB A;  5KHK A;  2XOK G;  3AG3 C;  4YJ3 A;  3ISB A;  1PNK A;  3CJH A;  1PL0 A;  2ARH A;  2EUL A;  4NXW A;  1TGO A;  2PF4 E;  4UCU A;  4F5Q A;  2PYL A;  1VAR A;  2ZH1 A;  1BSM A;  5J2I A;  3BCC H;  3H9V A;  1HUO A;  2EIK C;  4JI1 B;  2QJ1 A;  4RAI A;  4IQV A;  3OUS A;  3P3P A;  1FXH A;  1GO3 F;  1WP8 A;  2CH7 A;  5BMV A;  1RPR A;  4P2H A;  4EB6 B;  3KKY A;  5DB8 A;  5HC9 A;  4WOY A;  1GTO A;  1AR1 B;  5FL7 G;  2LP7 A;  1PNL A;  1N34 O;  3UQ2 A;  5GON B;  4YMN A;  5GW7 A;  3LNM B;  2CH7 B;  1XMQ O;  2WLI B;  3HKD B;  4NXZ A;  1IBL O;  9ICA A;  3LSQ A;  1B3Q A;  4DR1 O;  4BR6 A;  4DR4 O;  1YZB A;  2V7Q G;  2Z5U A;  3K0D A;  4X65 B;  2F4V O;  4L8J A;  4ABM A;  3ETD A;  5J2C A;  5KMG B;  4KLE A;  4PDL A;  4O4L A;  3GB7 C;  4G2K A;  4Z1M G;  2Q68 A;  4MT8 A;  2ZKO A;  4EFB A;  4QPK A;  2DW4 A;  2BSK B;  5DBC A;  4E80 A;  4I27 A;  4ATB A;  1FXK A;  3WB1 A;  4PDM A;  4DV4 O;  4PHD A;  3K03 A;  3T4D A;  3RYC A;  4YD2 A;  4UAY A;  5LMN B;  1VQ9 V;  2HHH O;  1V55 C;  3Q4H B;  3RH6 A;  5JCO C;  1FD9 A;  4K8X A;  5J2H A;  3CC7 V;  3U10 A;  2ZM6 O;  2QSA A;  5KA6 A;  3IC7 A;  5EC2 C;  3CRA A;  3F7Y C;  2OIG A;  2HVK C;  4LVS A;  2PY5 A;  1D2D A;  2BTO A;  3ZRW A;  5HRK A;  4HNA B;  3UQ0 A;  4LC1 A;  2FYU H;  5L3F A;  2P4K A;  3RT3 C;  1HWY A;  3CRM A;  4TV9 A;  3N2G A;  1M57 C;  3QO8 A;  1LUV A;  3CCR V;  4NTX A;  5HRL A;  3QTC A;  4DR7 O;  3A8T A;  4Z6C A;  3ISD A;  2QKA A;  8ICF A;  4OAG A;  3D36 A;  4LWS B;  4MVQ A;  2DWD C;  1TVK B;  4UB8 Z;  4X4R A;  2EJR A;  2WLH A;  9ICQ A;  4DR3 O;  2OT5 A;  2B5U A;  3H01 A;  3EXA A;  2FKX A;  3RJJ A;  1GPJ A;  2JS3 A;  4WC1 A;  3SYO A;  2DWE C;  4JI3 O;  2QM4 A;  5H6R A;  4F5R A;  4FZ0 A;  3ASO B;  1NS1 A;  2OYQ A;  3A2F A;  5HRF A;  1HW7 A;  2UXB B;  3NVO A;  4GX2 A;  5J2A A;  4X1I B;  2PI4 A;  2ZT9 B;  5E1A C;  3GDX A;  3JAL B;  1K5Q A;  3DTU B;  1W0K G;  1ZQW A;  5IWA B;  3CD6 V;  4NKT A;  1JX9 A;  4XDK A;  4TSF G;  4FLZ A;  2ATK C;  1F51 A;  4N21 A;  4ZOL A;  4FM2 A;  1R3K C;  1OCC B;  3AQN A;  1P49 A;  1YF2 A;  5HHI A;  2UU9 O;  2YIA A;  4RQ4 A;  3E22 B;  4I2A A;  4H33 A;  1EZJ A;  4R50 A;  3T1C A;  4M2Y A;  1RPO A;  1WA8 A;  4PA9 A;  1R73 A;  4K99 A;  2QWO B;  2LJ2 A;  3V7K A;  2YSU B;  3LDE A;  4WCW A;  4JYB A;  7ICU A;  1XRE A;  3OUY B;  1M93 A;  2KG7 A;  2LO1 A;  4OXS A;  1ZQZ A;  1NI8 A;  4TUP A;  4MS2 A;  5IJ9 B;  1VP7 A;  1QVG U;  3F7V C;  5HRD A;  5KX5 B;  4NVP A;  5IY5 B;  3JD4 A;  4DR5 O;  4J80 A;  2OCC C;  4WFE A;  4MVS A;  3BVO A;  1I5X A;  2G38 A;  4KLT A;  5K1X A;  3I5D A;  1NVP B;  3K58 A;  4WF9 V;  3N27 A;  5IJ9 A;  2LQT A;  2UUC B;  5J0U A;  1VQ6 V;  4X1K A;  1QLN A;  2VRZ A;  5IYB O;  9ICF A;  2D3O W;  1G1X B;  3AG3 B;  3R66 A;  2JJ1 G;  1RPL A; 
#chains in the Genus database with same CATH homology
 1MIV A;  1RZT A;  1R8C A;  4F5O A;  5DDM A;  4R65 A;  2IHM A;  3WFS C;  8ICI A;  3V72 A;  2DRA A;  3MDC A;  3H37 A;  3JPT A;  4RWO A;  2HHP A;  2ZH7 A;  4X4S A;  4RQ1 A;  5J0X A;  1ZQD A;  4IQW A;  1JN3 A;  4R66 A;  4WBY A;  5J2B A;  5HRG A;  4NM2 A;  5CB1 A;  5D46 A;  4RQ5 A;  1ZQF A;  4IQU A;  4K4G A;  9ICX A;  4QZ9 A;  8ICX A;  3C5G A;  3OGU A;  9ICS A;  4P4M A;  4KLL A;  5BOM A;  3MGH A;  3RJE A;  4WC3 A;  4MFA A;  2BCQ A;  1ZQN A;  1TFW A;  1ZQM A;  8ICJ A;  2ZH4 A;  5IIK A;  3JPQ A;  5J0S A;  1UET A;  5CA7 A;  2FMS A;  8ICZ A;  4KLD A;  2I9G A;  4FHV A;  3HWT A;  4QZF A;  4X4N A;  3AQM A;  8ICR A;  3MGI A;  1RPL A;  4QZG A;  3C5F A;  2ZH5 A;  2ISO A;  1MQ2 A;  5CWR A;  2NRK A;  5J0P A;  4K4H A;  2PFO A;  4PGY A;  2BCU A;  3JPS A;  2DR7 A;  9ICG A;  4O9M A;  3HIY A;  4ATB B;  3PML A;  1YLQ A;  3UPS A;  1XSL A;  5HRH A;  4K4I A;  4RPX A;  4GXK A;  4RWN A;  4RT3 A;  1ZQT A;  4RQ7 A;  7ICO A;  2M2W A;  5F2V O;  4RWP A;  4FHY A;  3RJI A;  4PH5 A;  5HRE A;  3HX0 A;  9ICV A;  1OU5 A;  9ICN A;  4GXI A;  3B0Y A;  2ZH8 A;  4X4V A;  4WC5 A;  4M9L A;  4NLZ A;  3V7J A;  4X4U A;  4RQ2 A;  4AT7 B;  2BCR A;  4YD1 A;  4RQ0 A;  4R64 A;  1ZQA A;  4I2C A;  4I2B A;  5IIN A;  7ICP A;  1VFG A;  2BCV A;  1JAJ A;  4M0A A;  3AQK A;  5CHG A;  5J2F A;  3LQC B;  3NYB A;  4QZD A;  4X4O A;  4AT8 B;  4M9N A;  1XSP A;  5IIO A;  4PGX A;  2BPC A;  4Z6E A;  2PXI A;  4KLS A;  4AT9 A;  5J29 A;  2M2U A;  8ICY A;  4R63 A;  4QZI A;  4XUS A;  4EBJ A;  4UAW A;  4M5D A;  1TFY A;  3PNC A;  4FO6 A;  7ICL A;  3JYY A;  9ICH A;  4QZA A;  4YCX A;  2RFF A;  5HRB A;  1R8B A;  3JPN A;  8ICP A;  1JQR A;  4IG8 A;  4KLF A;  4YN4 A;  2VAN A;  3AU6 A;  4I29 A;  1PX5 A;  3OUY A;  4KLO A;  3JZ0 A;  4MFF A;  4FHP A;  1R89 A;  8ICB A;  4UBC A;  1ZJN A;  3WFR E;  8ICH A;  4TUR A;  3RJH A;  4DO9 A;  1FA0 A;  4I2H A;  1ZQR A;  5D49 A;  8ICN A;  4M04 A;  4X4Q A;  2ZH2 A;  8ICK A;  1KEJ A;  4YMM A;  4Z6D A;  1ZQH A;  4I28 A;  1F5A A;  4FH3 A;  1NO5 A;  1MIY A;  5J0R A;  4JWN A;  3WFO A;  4UBB A;  7ICJ A;  1Q79 A;  3C2M A;  2PBE A;  3MDA A;  4UD5 A;  4IQT A;  4RPZ A;  5CJ7 A;  5IIM A;  4AT8 A;  2DR9 A;  4MFC A;  7ICS A;  1HUZ A;  4WC6 A;  1ZQO A;  1ZQX A;  3C66 A;  3UXO A;  2BPF A;  1ZQY A;  5HR9 A;  4M9H A;  1ZQS A;  8ICQ A;  5D4B A;  4I2G A;  2BCS A;  4Z6F A;  5HRI A;  4KLG A;  2M2V A;  4E8F A;  4DOB A;  9ICU A;  1UEU A;  4I2F A;  4QZH A;  4TUS A;  4WC4 A;  3UPQ A;  8ICV A;  5TZV A;  7ICK A;  1WOT A;  2PFN A;  8ICG A;  1XSN A;  1ZQG A;  1BPY A;  4UAZ A;  4QZB A;  4UB1 A;  4UD4 A;  7ICF A;  2ZH9 A;  2PFP A;  9ICI A;  5EOZ A;  5DED A;  9ICW A;  1JMS A;  5J0W A;  2M2T A;  5IIL A;  1TV9 A;  1TVA A;  5DBB A;  3ISB A;  3TFR A;  3H38 A;  3UXN A;  1KNY A;  4MF8 A;  4EP7 A;  3RH5 A;  1ZQU A;  3OVA A;  2DVI A;  4NLK A;  4F5Q A;  2ZH1 A;  5J2I A;  3MBY A;  1HUO A;  1BPE A;  4WC0 A;  4I2J A;  5J0O A;  4KLU A;  4IQV A;  1BPD A;  9ICK A;  4P2H A;  8ICA A;  5J0T A;  4O5E A;  5DB8 A;  5HC9 A;  3RJF A;  5J0Y A;  1BPZ A;  3RH4 A;  8ICW A;  5HHH A;  3UQ2 A;  1ZQK A;  4YMN A;  5DEC A;  4JWM A;  4QZ8 A;  4NXZ A;  5BOL A;  9ICA A;  4QZC A;  2DR5 A;  4M47 A;  4I2I A;  7ICH A;  9ICP A;  3OVS A;  4E7X A;  4FHW A;  4AT9 B;  2P66 A;  1ZQJ A;  4WBZ A;  4XQ7 A;  7ICE A;  4O5C A;  5J2C A;  3RJK A;  4KLE A;  4LZG A;  1ZQC A;  9ICC A;  5DBC A;  1UEV A;  4E80 A;  4I27 A;  8ICT A;  4ATB A;  4UB2 A;  4UB4 A;  4DOA A;  5CR0 A;  7ICT A;  4UB3 A;  3V7L A;  4F5P A;  4X0A A;  4PHD A;  3AQL A;  1R8A A;  3RJG A;  1MQ3 A;  2FMP A;  4YD2 A;  4UAY A;  5DBA A;  5CP2 A;  3WFP A;  4S3N A;  3RH6 A;  3LK9 A;  8ICS A;  5J2H A;  4X4P A;  4NY8 A;  8ICC A;  1ZJM A;  1NOM A;  5DB6 A;  9ICJ A;  5DB7 A;  4LVS A;  1BPB A;  5HRK A;  7ICG A;  5J2D A;  4TUQ A;  4P4O A;  3UQ0 A;  4PGQ A;  8ICE A;  3JPO A;  1ZQQ A;  2GWS A;  7ICR A;  4KLI A;  2O1P A;  2ZH6 A;  3AUO A;  3HJ4 A;  1ZQV A;  2PFQ A;  5HRL A;  4RT2 A;  3ISD A;  4Z6C A;  4WC7 A;  4P4P A;  3PMN A;  8ICF A;  1Q78 A;  4RQ8 A;  3AU2 A;  4F5N A;  8ICU A;  4UB5 A;  5BPC A;  4RQ3 A;  4X4R A;  7ICN A;  3JPP A;  9ICQ A;  2DR8 A;  4WC2 A;  3RJJ A;  4DOC A;  4RWQ A;  4WC1 A;  4X4T A;  3C2L A;  2FMQ A;  4FHX A;  2DRB A;  4F5R A;  9ICO A;  2ZHA A;  1V4A A;  4KLH A;  9ICR A;  9ICM A;  4RPY A;  1ZQE A;  2ID1 A;  4LT6 A;  4NKU A;  7ICQ A;  2O5A A;  1VJ7 A;  5HRF A;  9ICE A;  4QZE A;  5J2A A;  1ZQL A;  3JPR A;  3GDX A;  5III A;  4MF2 A;  3WFQ E;  7ICV A;  5J0Q A;  2ISP A;  1ZQW A;  4NKT A;  4NLN A;  4LZD A;  3HJ1 A;  3B0X A;  4KLJ A;  1MIW A;  3AQN A;  5HHI A;  1ZQB A;  4RQ4 A;  4I2A A;  5IIJ A;  5DB9 A;  4PPX A;  2ZHB A;  9ICT A;  4NM1 A;  4XRH A;  9ICB A;  4M2Y A;  8ICO A;  9ICL A;  2W9M A;  3HW8 A;  3V7K A;  7ICM A;  4FH5 A;  4I2D A;  4X5V A;  8ICM A;  4PHE A;  4PHP A;  2BPG A;  3TFS A;  5DKW A;  4WCW A;  4O5K A;  5J2K A;  4KLM A;  4YMO A;  7ICU A;  4KLQ A;  4XA5 A;  4AT7 A;  3OUY B;  3H39 A;  1ZQZ A;  4TUP A;  1BPX A;  3ISC A;  4PHA A;  2BE3 A;  3K75 D;  3OV7 A;  5HRD A;  3UXP A;  1ZQP A;  4GXJ A;  1KDH A;  2ZH3 A;  3OVB A;  8ICL A;  1ZQI A;  5DDY A;  3C18 A;  5J2E A;  4RQ6 A;  2Q66 A;  5J2J A;  4KLT A;  3C2K A;  7ICI A;  5J2G A;  4M9G A;  3H3A A;  4I2E A;  3L9D A;  4XQ8 A;  5J0U A;  4X0B A;  4M9J A;  9ICF A;  4EBK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...