4WC5A

Structure of trna-processing enzyme complex 3
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
381
structure length
367
Chain Sequence
MVGQIAKEMGLRAYIVGGVVRDILLGKEVWDVDFVVEGNAIELAKELARRHGVNVHPFPEFGTAHLKIGKLKLEFATARRETEPASLKEDLIRRDFTINAMAISVNLEDYGTLIDYFGGLRDLKDKVIRVLHPVSFIEDPVRILRALRFAGRLNFKLSRSTEKLLKQAVNLGLLKEAPRGRLINEIKLALREDRFLEILELYRKYRVLEEIIEGFQWNEKVLQKLYALRKVVDWHALEFSEERIDYGWLYLLILISNLDYERGKHFLEEMSAPSWVRETYKFMKFKLGSLKEELKKAKENYEVYRLLKPLHTSVLLLLMLEEELKEKIKLYLEKLRKVKLPKEKIEELKKGKELGERIEELKREIMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/rna
molecule keywords Poly A polymerase
publication title Measurement of Acceptor-T Psi C Helix Length of tRNA for Terminal A76-Addition by A-Adding Enzyme.
pubmed doi rcsb
source organism Aquifex aeolicus
total genus 115
structure length 367
sequence length 381
ec nomenclature
pdb deposition date 2014-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01743 PolyA_pol Poly A polymerase head domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3090.10 Mainly Alpha Orthogonal Bundle cca-adding enzyme, domain 2 cca-adding enzyme, domain 2 4wc5A02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4wc5A01
5CB1A 2DR8A 3HJ4A 3LK9A 4S3NA 9ICWA 4YD1A 3UPSA 4M9HA 9ICJA 3RH6A 4PHDA 4QZFA 4NLZA 4GXKA 5DDMA 4M9JA 1TFYA 4MFAA 2IHMA 4X4UA 5J2KA 7ICTA 1R8CA 4M2YA 1ZQBA 2PFPA 4XQ8A 2BCUA 5IIMA 4UB3A 4RT2A 4WBZA 2ZH2A 4XA5A 5IIJA 4FHWA 4M47A 4QZBA 4PPXA 4RPZA 8ICNA 4RQ7A 4I2FA 2M2VA 7ICLA 4EBJA 4UBBA 9ICVA 4YCXA 4WC7A 5HR9A 8ICJA 7ICRA 3K75D 4QZEA 4FH3A 3RJHA 4F5QA 5HHIA 2DVIA 7ICQA 4O5EA 8ICLA 1JQRA 9ICQA 3JPTA 2BCQA 4I28A 4O5KA 1ZQMA 9ICXA 3WFOA 3RJIA 4UB2A 1F5AA 2BE3A 4XRHA 4YMMA 2ZH4A 9ICOA 3RJEA 3AQKA 4QZ9A 4RQ0A 1TV9A 4DOBA 1ZJNA 4F5NA 5DKWA 4RPXA 4IG8A 2ZH8A 3TFRA 1UEUA 4GXIA 3C2LA 1MIYA 9ICMA 1BPZA 4O5CA 4KLOA 5J29A 8ICCA 8ICHA 9ICFA 4R64A 4P4PA 4AT8B 9ICCA 3C66A 9ICRA 8ICMA 1ZQEA 1UETA 8ICIA 4EBKA 5HRGA 1ZQKA 3UXNA 4Z6EA 4WCWA 1ZQQA 1ZQGA 5J2JA 5HRKA 4X4PA 4I2GA 3UPQA 3AQNA 4FHVA 1XSPA 1WOTA 9ICBA 2FMSA 4MFCA 1ZQNA 5BOLA 8ICSA 4RQ3A 2PFOA 4PHPA 5D46A 3L9DA 1ZQAA 3V72A 2FMQA 8ICEA 3UQ0A 3C2KA 3JYYA 3V7LA 2ZHBA 7ICNA 4QZCA 4RWOA 4R66A 2M2UA 4NM2A 1JN3A 3AUOA 2PXIA 4X5VA 3AU6A 5J0TA 4GXJA 1OU5A 4X4SA 7ICHA 4FO6A 3NYBA 5IIKA 5DECA 4X4RA 4I29A 4WC3A 4P4MA 1ZQLA 1ZQFA 4AT7A 3JZ0A 4I2DA 1BPXA 4TUSA 9ICUA 1ZQHA 9ICKA 5J0QA 3JPNA 2RFFA 4O9MA 9ICIA 5CA7A 4I2IA 3MDCA 4IQTA 2ISPA 1ZQZA 1MIWA 4FHPA 4FHYA 5BPCA 3MBYA 4E8FA 4NY8A 1ZQVA 4K4GA 3H38A 5IIIA 2PFNA 2I9GA 4KLEA 4PHAA 4FH5A 1UEVA 4WC2A 4KLGA 4I2JA 4PGXA 8ICZA 9ICLA 5D4BA 4RQ8A 2ZH5A 3MGIA 8ICYA 8ICTA 1R8BA 5J2DA 3TFSA 7ICKA 9ICPA 3AQMA 4F5RA 1BPBA 4RT3A 2DRAA 9ICAA 4LT6A 1FA0A 4TUPA 4NLKA 4AT9A 3C2MA 3JPSA 5IINA 2BCSA 1ZQXA 3WFPA 4WC1A 5HC9A 1Q78A 5J2EA 4QZGA 8ICKA 1ZQDA 4KLQA 4KLFA 5J2BA 1HUOA 9ICHA 4X4OA 2HHPA 4PGYA 4X4QA 3GDXA 7ICUA 4X4VA 4XUSA 4I2EA 5CR0A 4WC0A 5DBCA 3ISBA 3OGUA 4YMNA 4UB4A 4ATBB 1ZQJA 1RPLA 4KLTA 4NKUA 4Z6DA 3ISDA 3V7KA 8ICAA 8ICGA 9ICTA 3RJJA 4PH5A 7ICVA 4KLDA 4ATBA 4KLUA 3HJ1A 4UB1A 2BCVA 4XQ7A 4DOCA 4MF2A 5TZVA 3RH5A 4TUQA 7ICSA 8ICXA 4MF8A 3MDAA 4P2HA 1KEJA 8ICWA 2VANA 9ICNA 2M2WA 2P66A 1TFWA 4F5OA 7ICMA 5DEDA 3PMNA 3JPOA 3B0XA 4IQUA 4X0AA 7ICPA 4IQVA 3WFSC 3UXOA 4YD2A 4RPYA 4NM1A 4RQ2A 5IIOA 5DDYA 4I2HA 8ICQA 5IILA 1MQ3A 4KLLA 5J2GA 4LZGA 3OUYB 1ZQTA 1BPEA 4E80A 3OVAA 4AT7B 4UAYA 5J2AA 5J0OA 4UAZA 3RH4A 5CJ7A 4I2BA 4JWMA 4RQ4A 2DR7A 5J0XA 3OVBA 7ICFA 3OUYA 5J0YA 5CP2A 8ICVA 5DBAA 8ICUA 2ZHAA 5HRLA 3WFQE 4F5PA 1TVAA 1VFGA 2ZH9A 2Q66A 4PHEA 9ICEA 4EP7A 7ICOA 4K4IA 3HWTA 2ID1A 3OV7A 3JPQA 2PFQA 4KLIA 1R8AA 1XSNA 7ICIA 4RWNA 3RJGA 5CHGA 4M9NA 1VJ7A 3LQCB 5D49A 4WC4A 2BPGA 1Q79A 4RQ1A 2ZH6A 3PNCA 4I27A 3B0YA 4X4TA 7ICJA 1ZQOA 4TURA 4E7XA 4UBCA 5J2CA 5DB9A 8ICFA 2ISOA 5J2HA 1ZQCA 2DRBA 1ZQYA 1HUZA 3MGHA 1NOMA 4R63A 3WFRE 5J0SA 3HW8A 3RJKA 3C5FA 2BPFA 3V7JA 1ZJMA 4Z6FA 4M9GA 1YLQA 4AT9B 1XSLA 4YN4A 1V4AA 3AU2A 5HREA 5J0RA 1KDHA 3UQ2A 4QZDA 4M04A 1ZQUA 2BPCA 3H37A 7ICGA 1JMSA 5CWRA 4WC6A 4NLNA 2DR5A 4WBYA 1BPYA 3C18A 4NKTA 5J0WA 4UAWA 4LVSA 4LZDA 4JWNA 7ICEA 4UD5A 4PGQA 2O1PA 4RWQA 8ICPA 1MQ2A 3C5GA 5J0PA 1R89A 4RQ6A 4KLSA 2ZH1A 1ZQPA 1ZQWA 2GWSA 8ICRA 5J2FA 3JPRA 5J0UA 4KLHA 5HRDA 2PBEA 1MIVA 2W9MA 4KLMA 1BPDA 8ICOA 5BOMA 4UD4A 4NXZA 5DB6A 4MFFA 1RZTA 5HRIA 8ICBA 4K4HA 3JPPA 5DB8A 4I2CA 5HHHA 4QZHA 4UB5A 4I2AA 2ZH3A 4AT8A 2M2TA 2FMPA 4R65A 5HRHA 4QZ8A 5EOZA 4QZIA 3ISCA 1NO5A 5F2VO 1ZQSA 2BCRA 9ICSA 2NRKA 5HRFA 3HIYA 4FHXA 3RJFA 5DBBA 3H3AA 4P4OA 4RWPA 4Z6CA 3H39A 4X0BA 5J2IA 3UXPA 3OVSA 4WC5A 2O5AA 9ICGA 2ZH7A 4RQ5A 1ZQIA 4IQWA 4M0AA 5DB7A 1KNYA 5HRBA 1ZQRA 3HX0A 4M5DA 3PMLA 2DR9A 3AQLA 4YMOA 4QZAA 1JAJA 1PX5A 4DO9A 4M9LA 4DOAA 4X4NA 4KLJA
chains in the Genus database with same CATH superfamily
5CB1A 2DR8A 3HJ4A 5CHEA 4S3NA 3LK9A 9ICWA 4YD1A 3UPSA 4M9HA 3CK6A 2FCLA 9ICJA 3RH6A 4PHDA 4QZFA 4NLZA 4GXKA 5DDMA 4M9JA 1TFYA 5B3PA 4MFAA 2IHMA 4X4UA 5J2KA 7ICTA 1R8CA 4M2YA 1ZQBA 2PFPA 4XQ8A 2BCUA 5IIMA 4UB3A 4OAFA 4RT2A 2BBHA 4WBZA 2ZH2A 4XA5A 2EWRA 5IIJA 4FHWA 4M47A 4QZBA 3ER9B 4PPXA 4RPZA 8ICNA 4RQ7A 4OAHA 4I2FA 2M2VA 7ICLA 4EBJA 4UBBA 9ICVA 4YCXA 4WC7A 5HR9A 8ICJA 7ICRA 3K75D 4QZEA 4FH3A 3RJHA 4F5QA 5HHIA 2DVIA 7ICQA 4K99A 4O5EA 8ICLA 1JQRA 9ICQA 3JPTA 2BCQA 4I28A 4O5KA 1ZQMA 9ICXA 4KM5A 3WFOA 3RJIA 3MCRA 4UB2A 1F5AA 4XJEA 2BE3A 4XRHA 4YMMA 2ZH4A 9ICOA 3RJEA 3AQKA 4QZ9A 4RQ0A 1TV9A 4DOBA 1ZJNA 4F5NA 5DKWA 4RPXA 4IG8A 2ZH8A 3TFRA 1UEUA 2IUBA 3C2LA 1MIYA 4GXIA 1BPZA 4O5CA 3ER8C 9ICMA 4KLOA 5J29A 8ICCA 4LEZA 8ICHA 5CFUA 9ICFA 4R64A 4P4PA 4AT8B 9ICCA 3C66A 9ICRA 8ICMA 1ZQEA 1UETA 8ICIA 4EBKA 3OWGA 5HRGA 1ZQKA 3UXNA 4Z6EA 4WCWA 1ZQQA 1ZQGA 5J2JA 5JTGA 5HRKA 3PHZA 4X4PA 4I2GA 4FO1A 3UPQA 3AQNA 4FHVA 1XSPA 1WOTA 4LEYA 9ICBA 2FMSA 2IHOA 4MFCA 1ZQNA 5BOLA 8ICSA 5D62A 4RQ3A 2B51A 2PFOA 4PHPA 5D46A 3L9DA 1ZQAA 3V72A 2FMQA 8ICEA 3UQ0A 3C2KA 3JYYA 3V7LA 2ZHBA 4JLXA 7ICNA 4QZCA 4RWOA 4R66A 2M2UA 4NM2A 1JN3A 2B4VA 3AUOA 2PXIA 4X5VA 3AU6A 5J0TA 4GXJA 1OU5A 4X4SA 7ICHA 4FO6A 3NYBA 5IIKA 5DECA 4X4RA 4I29A 4WC3A 4P4MA 1ZQLA 1ZQFA 4AT7A 3JZ0A 4I2DA 1BPXA 4LEWA 4TUSA 9ICUA 1ZQHA 9ICKA 5J0QA 3JPNA 2RFFA 4O9MA 4NXXA 9ICIA 5CA7A 4I2IA 3MDCA 4IQTA 2ISPA 1ZQZA 1MIWA 4FHPA 3NWIA 4FHYA 5BPCA 3MBYA 4E8FA 4NY8A 1ZQVA 4K4GA 3H38A 5IIIA 2PFNA 2I9GA 4KLEA 4PHAA 4FH5A 1UEVA 4WC2A 4KLGA 4I2JA 4PGXA 2B56A 8ICZA 9ICLA 5D4BA 4RQ8A 2ZH5A 3MGIA 2HN2A 8ICYA 8ICTA 1R8BA 5J2DA 3TFSA 4EEDA 7ICKA 9ICPA 3AQMA 4K9BA 4F5RA 1BPBA 4RT3A 2DRAA 9ICAA 4LT6A 1FA0A 4TUPA 4NLKA 2GA9D 4AT9A 3C2MA 3JPSA 5IINA 2BCSA 1ZQXA 4HX0A 3WFPA 4WC1A 5HC9A 1Q78A 5J2EA 4QZGA 8ICKA 1ZQDA 4KLQA 4WQLA 4KLFA 5J2BA 1HUOA 9ICHA 4X4OA 2HHPA 4PGYA 4X4QA 3GDXA 7ICUA 4X4VA 4XUSA 4I2EA 5CR0A 4WC0A 5DBCA 3OGUA 3ISBA 4YMNA 4UB4A 4ATBB 4WH5A 1ZQJA 1RPLA 4KLTA 4NKUA 4Z6DA 3ISDA 3V7KA 8ICAA 8ICGA 9ICTA 3RJJA 4PH5A 7ICVA 4KLDA 4ATBA 4KLUA 3HJ1A 4UB1A 2BCVA 4XQ7A 4DOCA 4MF2A 5TZVA 3RH5A 4MKPA 4TUQA 7ICSA 8ICXA 2GAFD 4OAGA 4MF8A 3MDAA 4P2HA 1KEJA 8ICWA 2VANA 4K9AA 9ICNA 2M2WA 2P66A 1TFWA 4F5OA 7ICMA 3NKUA 5DEDA 3PMNA 3JPOA 3B0XA 4IQUA 5CFSA 4X0AA 7ICPA 4IQVA 3K7DA 3WFSC 3UXOA 4YD2A 4RPYA 3EF2A 4NM1A 4O6AA 4RQ2A 5IIOA 5DDYA 4I2HA 8ICQA 5IILA 1MQ3A 4KLLA 3NVOA 4O67A 5J2GA 4LZGA 3OUYB 1ZQTA 1BPEA 4E80A 5D63A 3OVAA 4AT7B 4UAYA 5J2AA 5J0OA 4UAZA 4K98A 5CJ7A 3RH4A 4I2BA 4JWMA 4RQ4A 2DR7A 5J0XA 3OVBA 7ICFA 3OUYA 5J0YA 5CP2A 8ICVA 5DBAA 8ICUA 2ZHAA 5HRLA 3WFQE 4F5PA 1TVAA 1VFGA 2ZH9A 2Q66A 4PHEA 9ICEA 4EP7A 7ICOA 4K4IA 3HWTA 2ID1A 3OV7A 3JPQA 2PFQA 4KLIA 1R8AA 1XSNA 7ICIA 4RWNA 4I0UA 3RJGA 5CHGA 4M9NA 1VJ7A 3LQCB 5D49A 4WC4A 2BPGA 1Q79A 4RQ1A 2ZH6A 3PNCA 4I27A 3B0YA 4X4TA 7ICJA 1ZQOA 4TURA 4E7XA 4UBCA 5J2CA 4N7RA 5DB9A 8ICFA 2ISOA 4LEVA 5J2HA 4NXWA 1ZQCA 2DRBA 1ZQYA 1HUZA 3MGHA 1NOMA 3ERCC 4WOYA 4R63A 3WFRE 5J0SA 3HW8A 3RJKA 3C5FA 2BPFA 3V7JA 1ZJMA 4Z6FA 4K97A 1GPJA 4M9GA 1YLQA 4AT9B 1XSLA 4YN4A 1V4AA 3AU2A 4NXTA 5HREA 5J0RA 1KDHA 4EV6A 4KB6A 3UQ2A 4QZDA 4M04A 1ZQUA 2BPCA 3H37A 7ICGA 1JMSA 5CWRA 4WC6A 5B3QA 4O68A 4NLNA 4K96A 4EGWA 4WBYA 1BPYA 2DR5A 3C18A 4NKTA 5J0WA 4UAWA 4LVSA 4LZDA 4JWNA 7ICEA 4UD5A 4PGQA 2O1PA 4RWQA 8ICPA 1MQ2A 3C5GA 4EEBA 2BBJA 5J0PA 1R89A 4RQ6A 4KLSA 2HN1A 2ZH1A 1ZQPA 1ZQWA 2GWSA 8ICRA 5J2FA 3JPRA 5J0UA 4KLHA 5HRDA 2PBEA 1MIVA 2W9MA 4KLMA 1BPDA 8ICOA 5BOMA 4UD4A 4NXZA 5DB6A 4MFFA 1RZTA 5HRIA 8ICBA 4K4HA 4K8VA 3JPPA 5DB8A 4I2CA 3JCFA 5HHHA 4OAIZ 4QZHA 5D61A 4UB5A 5CFTA 4I2AA 2ZH3A 4O69A 4WQKA 4AT8A 2M2TA 2FMPA 4R65A 5HRHA 4QZ8A 5EOZA 4QZIA 3ISCA 1NO5A 5F2VO 1ZQSA 2BCRA 9ICSA 2NRKA 5HRFA 3HIYA 4FHXA 3RJFA 5DBBA 3H3AA 4P4OA 4RWPA 4Z6CA 3H39A 4X0BA 5J2IA 3UXPA 3OVSA 4JLZA 4WC5A 2O5AA 9ICGA 2ZH7A 4RQ5A 1ZQIA 4IQWA 4M0AA 5DB7A 1KNYA 4NXUA 5HRBA 1ZQRA 3HX0A 4M5DA 3PMLA 2DR9A 4NXVA 3AQLA 4YMOA 4QZAA 1JAJA 1PX5A 4DO9A 4M9LA 4DOAA 4X4NA 4KLJA
chains in the Genus database with same CATH topology
5CB1A 2DR8A 3HJ4A 3LK9A 4S3NA 9ICWA 4YD1A 3UPSA 4M9HA 9ICJA 3RH6A 4PHDA 4QZFA 4NLZA 4GXKA 5DDMA 4M9JA 1TFYA 4MFAA 2IHMA 4X4UA 5J2KA 7ICTA 1R8CA 4M2YA 1ZQBA 2PFPA 4XQ8A 2BCUA 5IIMA 4UB3A 4RT2A 4WBZA 2ZH2A 4XA5A 5IIJA 4FHWA 4M47A 4QZBA 4PPXA 4RPZA 8ICNA 4RQ7A 4I2FA 2M2VA 7ICLA 4EBJA 4UBBA 9ICVA 4YCXA 4WC7A 5HR9A 8ICJA 7ICRA 3K75D 4QZEA 4FH3A 3RJHA 4F5QA 5HHIA 2DVIA 7ICQA 4O5EA 8ICLA 1JQRA 9ICQA 3JPTA 2BCQA 4I28A 4O5KA 1ZQMA 9ICXA 3WFOA 3RJIA 4UB2A 1F5AA 2BE3A 4XRHA 4YMMA 2ZH4A 9ICOA 3RJEA 3AQKA 4QZ9A 4RQ0A 1TV9A 4DOBA 1ZJNA 4F5NA 5DKWA 4RPXA 4IG8A 2ZH8A 3TFRA 1UEUA 4GXIA 3C2LA 1MIYA 9ICMA 1BPZA 4O5CA 4KLOA 5J29A 8ICCA 8ICHA 9ICFA 4R64A 4P4PA 4AT8B 9ICCA 3C66A 9ICRA 8ICMA 1ZQEA 1UETA 8ICIA 4EBKA 5HRGA 1ZQKA 3UXNA 4Z6EA 4WCWA 1ZQQA 1ZQGA 5J2JA 5HRKA 4X4PA 4I2GA 3UPQA 3AQNA 4FHVA 1XSPA 1WOTA 9ICBA 2FMSA 4MFCA 1ZQNA 5BOLA 8ICSA 4RQ3A 2PFOA 4PHPA 5D46A 3L9DA 1ZQAA 3V72A 2FMQA 8ICEA 3UQ0A 3C2KA 3JYYA 3V7LA 2ZHBA 7ICNA 4QZCA 4RWOA 4R66A 2M2UA 4NM2A 1JN3A 3AUOA 2PXIA 4X5VA 3AU6A 5J0TA 4GXJA 1OU5A 4X4SA 7ICHA 4FO6A 3NYBA 5IIKA 5DECA 4X4RA 4I29A 4WC3A 4P4MA 1ZQLA 1ZQFA 4AT7A 3JZ0A 4I2DA 1BPXA 4TUSA 9ICUA 1ZQHA 9ICKA 5J0QA 3JPNA 2RFFA 4O9MA 9ICIA 5CA7A 4I2IA 3MDCA 4IQTA 2ISPA 1ZQZA 1MIWA 4FHPA 4FHYA 5BPCA 3MBYA 4E8FA 4NY8A 1ZQVA 4K4GA 3H38A 5IIIA 2PFNA 2I9GA 4KLEA 4PHAA 4FH5A 1UEVA 4WC2A 4KLGA 4I2JA 4PGXA 8ICZA 9ICLA 5D4BA 4RQ8A 2ZH5A 3MGIA 8ICYA 8ICTA 1R8BA 5J2DA 3TFSA 7ICKA 9ICPA 3AQMA 4F5RA 1BPBA 4RT3A 2DRAA 9ICAA 4LT6A 1FA0A 4TUPA 4NLKA 4AT9A 3C2MA 3JPSA 5IINA 2BCSA 1ZQXA 3WFPA 4WC1A 5HC9A 1Q78A 5J2EA 4QZGA 8ICKA 1ZQDA 4KLQA 4KLFA 5J2BA 1HUOA 9ICHA 4X4OA 2HHPA 4PGYA 4X4QA 3GDXA 7ICUA 4X4VA 4XUSA 4I2EA 5CR0A 4WC0A 5DBCA 3ISBA 3OGUA 4YMNA 4UB4A 4ATBB 1ZQJA 1RPLA 4KLTA 4NKUA 4Z6DA 3ISDA 3V7KA 8ICAA 8ICGA 9ICTA 3RJJA 4PH5A 7ICVA 4KLDA 4ATBA 4KLUA 3HJ1A 4UB1A 2BCVA 4XQ7A 4DOCA 4MF2A 5TZVA 3RH5A 4TUQA 7ICSA 8ICXA 4MF8A 3MDAA 4P2HA 1KEJA 8ICWA 2VANA 9ICNA 2M2WA 2P66A 1TFWA 4F5OA 7ICMA 5DEDA 3PMNA 3JPOA 3B0XA 4IQUA 4X0AA 7ICPA 4IQVA 3WFSC 3UXOA 4YD2A 4RPYA 4NM1A 4RQ2A 5IIOA 5DDYA 4I2HA 8ICQA 5IILA 1MQ3A 4KLLA 5J2GA 4LZGA 3OUYB 1ZQTA 1BPEA 4E80A 3OVAA 4AT7B 4UAYA 5J2AA 5J0OA 4UAZA 3RH4A 5CJ7A 4I2BA 4JWMA 4RQ4A 2DR7A 5J0XA 3OVBA 7ICFA 3OUYA 5J0YA 5CP2A 8ICVA 5DBAA 8ICUA 2ZHAA 5HRLA 3WFQE 4F5PA 1TVAA 1VFGA 2ZH9A 2Q66A 4PHEA 9ICEA 4EP7A 7ICOA 4K4IA 3HWTA 2ID1A 3OV7A 3JPQA 2PFQA 4KLIA 1R8AA 1XSNA 7ICIA 4RWNA 3RJGA 5CHGA 4M9NA 1VJ7A 3LQCB 5D49A 4WC4A 2BPGA 1Q79A 4RQ1A 2ZH6A 3PNCA 4I27A 3B0YA 4X4TA 7ICJA 1ZQOA 4TURA 4E7XA 4UBCA 5J2CA 5DB9A 8ICFA 2ISOA 5J2HA 1ZQCA 2DRBA 1ZQYA 1HUZA 3MGHA 1NOMA 4R63A 3WFRE 5J0SA 3HW8A 3RJKA 3C5FA 2BPFA 3V7JA 1ZJMA 4Z6FA 4M9GA 1YLQA 4AT9B 1XSLA 4YN4A 1V4AA 3AU2A 5HREA 5J0RA 1KDHA 3UQ2A 4QZDA 4M04A 1ZQUA 2BPCA 3H37A 7ICGA 1JMSA 5CWRA 4WC6A 4NLNA 2DR5A 4WBYA 1BPYA 3C18A 4NKTA 5J0WA 4UAWA 4LVSA 4LZDA 4JWNA 7ICEA 4UD5A 4PGQA 2O1PA 4RWQA 8ICPA 1MQ2A 3C5GA 5J0PA 1R89A 4RQ6A 4KLSA 2ZH1A 1ZQPA 1ZQWA 2GWSA 8ICRA 5J2FA 3JPRA 5J0UA 4KLHA 5HRDA 2PBEA 1MIVA 2W9MA 4KLMA 1BPDA 8ICOA 5BOMA 4UD4A 4NXZA 5DB6A 4MFFA 1RZTA 5HRIA 8ICBA 4K4HA 3JPPA 5DB8A 4I2CA 5HHHA 4QZHA 4UB5A 4I2AA 2ZH3A 4AT8A 2M2TA 2FMPA 4R65A 5HRHA 4QZ8A 5EOZA 4QZIA 3ISCA 1NO5A 5F2VO 1ZQSA 2BCRA 9ICSA 2NRKA 5HRFA 3HIYA 4FHXA 3RJFA 5DBBA 3H3AA 4P4OA 4RWPA 4Z6CA 3H39A 4X0BA 5J2IA 3UXPA 3OVSA 4WC5A 2O5AA 9ICGA 2ZH7A 4RQ5A 1ZQIA 4IQWA 4M0AA 5DB7A 1KNYA 5HRBA 1ZQRA 3HX0A 4M5DA 3PMLA 2DR9A 3AQLA 4YMOA 4QZAA 1JAJA 1PX5A 4DO9A 4M9LA 4DOAA 4X4NA 4KLJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CB1 A;  2DR8 A;  3HJ4 A;  3LK9 A;  4S3N A;  9ICW A;  4YD1 A;  3UPS A;  4M9H A;  9ICJ A;  3RH6 A;  4PHD A;  4QZF A;  4NLZ A;  4GXK A;  5DDM A;  4M9J A;  1TFY A;  4MFA A;  2IHM A;  4X4U A;  5J2K A;  7ICT A;  1R8C A;  4M2Y A;  1ZQB A;  2PFP A;  4XQ8 A;  2BCU A;  5IIM A;  4UB3 A;  4RT2 A;  4WBZ A;  2ZH2 A;  4XA5 A;  5IIJ A;  4FHW A;  4M47 A;  4QZB A;  4PPX A;  4RPZ A;  8ICN A;  4RQ7 A;  4I2F A;  2M2V A;  7ICL A;  4EBJ A;  4UBB A;  9ICV A;  4YCX A;  4WC7 A;  5HR9 A;  8ICJ A;  7ICR A;  3K75 D;  4QZE A;  4FH3 A;  3RJH A;  4F5Q A;  5HHI A;  2DVI A;  7ICQ A;  4O5E A;  8ICL A;  1JQR A;  9ICQ A;  3JPT A;  2BCQ A;  4I28 A;  4O5K A;  1ZQM A;  9ICX A;  3WFO A;  3RJI A;  4UB2 A;  1F5A A;  2BE3 A;  4XRH A;  4YMM A;  2ZH4 A;  9ICO A;  3RJE A;  3AQK A;  4QZ9 A;  4RQ0 A;  1TV9 A;  4DOB A;  1ZJN A;  4F5N A;  5DKW A;  4RPX A;  4IG8 A;  2ZH8 A;  3TFR A;  1UEU A;  4GXI A;  3C2L A;  1MIY A;  9ICM A;  1BPZ A;  4O5C A;  4KLO A;  5J29 A;  8ICC A;  8ICH A;  9ICF A;  4R64 A;  4P4P A;  4AT8 B;  9ICC A;  3C66 A;  9ICR A;  8ICM A;  1ZQE A;  1UET A;  8ICI A;  4EBK A;  5HRG A;  1ZQK A;  3UXN A;  4Z6E A;  4WCW A;  1ZQQ A;  1ZQG A;  5J2J A;  5HRK A;  4X4P A;  4I2G A;  3UPQ A;  3AQN A;  4FHV A;  1XSP A;  1WOT A;  9ICB A;  2FMS A;  4MFC A;  1ZQN A;  5BOL A;  8ICS A;  4RQ3 A;  2PFO A;  4PHP A;  5D46 A;  3L9D A;  1ZQA A;  3V72 A;  2FMQ A;  8ICE A;  3UQ0 A;  3C2K A;  3JYY A;  3V7L A;  2ZHB A;  7ICN A;  4QZC A;  4RWO A;  4R66 A;  2M2U A;  4NM2 A;  1JN3 A;  3AUO A;  2PXI A;  4X5V A;  3AU6 A;  5J0T A;  4GXJ A;  1OU5 A;  4X4S A;  7ICH A;  4FO6 A;  3NYB A;  5IIK A;  5DEC A;  4X4R A;  4I29 A;  4WC3 A;  4P4M A;  1ZQL A;  1ZQF A;  4AT7 A;  3JZ0 A;  4I2D A;  1BPX A;  4TUS A;  9ICU A;  1ZQH A;  9ICK A;  5J0Q A;  3JPN A;  2RFF A;  4O9M A;  9ICI A;  5CA7 A;  4I2I A;  3MDC A;  4IQT A;  2ISP A;  1ZQZ A;  1MIW A;  4FHP A;  4FHY A;  5BPC A;  3MBY A;  4E8F A;  4NY8 A;  1ZQV A;  4K4G A;  3H38 A;  5III A;  2PFN A;  2I9G A;  4KLE A;  4PHA A;  4FH5 A;  1UEV A;  4WC2 A;  4KLG A;  4I2J A;  4PGX A;  8ICZ A;  9ICL A;  5D4B A;  4RQ8 A;  2ZH5 A;  3MGI A;  8ICY A;  8ICT A;  1R8B A;  5J2D A;  3TFS A;  7ICK A;  9ICP A;  3AQM A;  4F5R A;  1BPB A;  4RT3 A;  2DRA A;  9ICA A;  4LT6 A;  1FA0 A;  4TUP A;  4NLK A;  4AT9 A;  3C2M A;  3JPS A;  5IIN A;  2BCS A;  1ZQX A;  3WFP A;  4WC1 A;  5HC9 A;  1Q78 A;  5J2E A;  4QZG A;  8ICK A;  1ZQD A;  4KLQ A;  4KLF A;  5J2B A;  1HUO A;  9ICH A;  4X4O A;  2HHP A;  4PGY A;  4X4Q A;  3GDX A;  7ICU A;  4X4V A;  4XUS A;  4I2E A;  5CR0 A;  4WC0 A;  5DBC A;  3ISB A;  3OGU A;  4YMN A;  4UB4 A;  4ATB B;  1ZQJ A;  1RPL A;  4KLT A;  4NKU A;  4Z6D A;  3ISD A;  3V7K A;  8ICA A;  8ICG A;  9ICT A;  3RJJ A;  4PH5 A;  7ICV A;  4KLD A;  4ATB A;  4KLU A;  3HJ1 A;  4UB1 A;  2BCV A;  4XQ7 A;  4DOC A;  4MF2 A;  5TZV A;  3RH5 A;  4TUQ A;  7ICS A;  8ICX A;  4MF8 A;  3MDA A;  4P2H A;  1KEJ A;  8ICW A;  2VAN A;  9ICN A;  2M2W A;  2P66 A;  1TFW A;  4F5O A;  7ICM A;  5DED A;  3PMN A;  3JPO A;  3B0X A;  4IQU A;  4X0A A;  7ICP A;  4IQV A;  3WFS C;  3UXO A;  4YD2 A;  4RPY A;  4NM1 A;  4RQ2 A;  5IIO A;  5DDY A;  4I2H A;  8ICQ A;  5IIL A;  1MQ3 A;  4KLL A;  5J2G A;  4LZG A;  3OUY B;  1ZQT A;  1BPE A;  4E80 A;  3OVA A;  4AT7 B;  4UAY A;  5J2A A;  5J0O A;  4UAZ A;  3RH4 A;  5CJ7 A;  4I2B A;  4JWM A;  4RQ4 A;  2DR7 A;  5J0X A;  3OVB A;  7ICF A;  3OUY A;  5J0Y A;  5CP2 A;  8ICV A;  5DBA A;  8ICU A;  2ZHA A;  5HRL A;  3WFQ E;  4F5P A;  1TVA A;  1VFG A;  2ZH9 A;  2Q66 A;  4PHE A;  9ICE A;  4EP7 A;  7ICO A;  4K4I A;  3HWT A;  2ID1 A;  3OV7 A;  3JPQ A;  2PFQ A;  4KLI A;  1R8A A;  1XSN A;  7ICI A;  4RWN A;  3RJG A;  5CHG A;  4M9N A;  1VJ7 A;  3LQC B;  5D49 A;  4WC4 A;  2BPG A;  1Q79 A;  4RQ1 A;  2ZH6 A;  3PNC A;  4I27 A;  3B0Y A;  4X4T A;  7ICJ A;  1ZQO A;  4TUR A;  4E7X A;  4UBC A;  5J2C A;  5DB9 A;  8ICF A;  2ISO A;  5J2H A;  1ZQC A;  2DRB A;  1ZQY A;  1HUZ A;  3MGH A;  1NOM A;  4R63 A;  3WFR E;  5J0S A;  3HW8 A;  3RJK A;  3C5F A;  2BPF A;  3V7J A;  1ZJM A;  4Z6F A;  4M9G A;  1YLQ A;  4AT9 B;  1XSL A;  4YN4 A;  1V4A A;  3AU2 A;  5HRE A;  5J0R A;  1KDH A;  3UQ2 A;  4QZD A;  4M04 A;  1ZQU A;  2BPC A;  3H37 A;  7ICG A;  1JMS A;  5CWR A;  4WC6 A;  4NLN A;  2DR5 A;  4WBY A;  1BPY A;  3C18 A;  4NKT A;  5J0W A;  4UAW A;  4LVS A;  4LZD A;  4JWN A;  7ICE A;  4UD5 A;  4PGQ A;  2O1P A;  4RWQ A;  8ICP A;  1MQ2 A;  3C5G A;  5J0P A;  1R89 A;  4RQ6 A;  4KLS A;  2ZH1 A;  1ZQP A;  1ZQW A;  2GWS A;  8ICR A;  5J2F A;  3JPR A;  5J0U A;  4KLH A;  5HRD A;  2PBE A;  1MIV A;  2W9M A;  4KLM A;  1BPD A;  8ICO A;  5BOM A;  4UD4 A;  4NXZ A;  5DB6 A;  4MFF A;  1RZT A;  5HRI A;  8ICB A;  4K4H A;  3JPP A;  5DB8 A;  4I2C A;  5HHH A;  4QZH A;  4UB5 A;  4I2A A;  2ZH3 A;  4AT8 A;  2M2T A;  2FMP A;  4R65 A;  5HRH A;  4QZ8 A;  5EOZ A;  4QZI A;  3ISC A;  1NO5 A;  5F2V O;  1ZQS A;  2BCR A;  9ICS A;  2NRK A;  5HRF A;  3HIY A;  4FHX A;  3RJF A;  5DBB A;  3H3A A;  4P4O A;  4RWP A;  4Z6C A;  3H39 A;  4X0B A;  5J2I A;  3UXP A;  3OVS A;  4WC5 A;  2O5A A;  9ICG A;  2ZH7 A;  4RQ5 A;  1ZQI A;  4IQW A;  4M0A A;  5DB7 A;  1KNY A;  5HRB A;  1ZQR A;  3HX0 A;  4M5D A;  3PML A;  2DR9 A;  3AQL A;  4YMO A;  4QZA A;  1JAJ A;  1PX5 A;  4DO9 A;  4M9L A;  4DOA A;  4X4N A;  4KLJ A; 
#chains in the Genus database with same CATH topology
 5CB1 A;  2DR8 A;  3HJ4 A;  5CHE A;  4S3N A;  3LK9 A;  9ICW A;  4YD1 A;  3UPS A;  4M9H A;  3CK6 A;  2FCL A;  9ICJ A;  3RH6 A;  4PHD A;  4QZF A;  4NLZ A;  4GXK A;  5DDM A;  4M9J A;  1TFY A;  5B3P A;  4MFA A;  2IHM A;  4X4U A;  5J2K A;  7ICT A;  1R8C A;  4M2Y A;  1ZQB A;  2PFP A;  4XQ8 A;  2BCU A;  5IIM A;  4UB3 A;  4OAF A;  4RT2 A;  2BBH A;  4WBZ A;  2ZH2 A;  4XA5 A;  2EWR A;  5IIJ A;  4FHW A;  4M47 A;  4QZB A;  3ER9 B;  4PPX A;  4RPZ A;  8ICN A;  4RQ7 A;  4OAH A;  4I2F A;  2M2V A;  7ICL A;  4EBJ A;  4UBB A;  9ICV A;  4YCX A;  4WC7 A;  5HR9 A;  8ICJ A;  7ICR A;  3K75 D;  4QZE A;  4FH3 A;  3RJH A;  4F5Q A;  5HHI A;  2DVI A;  7ICQ A;  4K99 A;  4O5E A;  8ICL A;  1JQR A;  9ICQ A;  3JPT A;  2BCQ A;  4I28 A;  4O5K A;  1ZQM A;  9ICX A;  4KM5 A;  3WFO A;  3RJI A;  3MCR A;  4UB2 A;  1F5A A;  4XJE A;  2BE3 A;  4XRH A;  4YMM A;  2ZH4 A;  9ICO A;  3RJE A;  3AQK A;  4QZ9 A;  4RQ0 A;  1TV9 A;  4DOB A;  1ZJN A;  4F5N A;  5DKW A;  4RPX A;  4IG8 A;  2ZH8 A;  3TFR A;  1UEU A;  2IUB A;  3C2L A;  1MIY A;  4GXI A;  1BPZ A;  4O5C A;  3ER8 C;  9ICM A;  4KLO A;  5J29 A;  8ICC A;  4LEZ A;  8ICH A;  5CFU A;  9ICF A;  4R64 A;  4P4P A;  4AT8 B;  9ICC A;  3C66 A;  9ICR A;  8ICM A;  1ZQE A;  1UET A;  8ICI A;  4EBK A;  3OWG A;  5HRG A;  1ZQK A;  3UXN A;  4Z6E A;  4WCW A;  1ZQQ A;  1ZQG A;  5J2J A;  5JTG A;  5HRK A;  3PHZ A;  4X4P A;  4I2G A;  4FO1 A;  3UPQ A;  3AQN A;  4FHV A;  1XSP A;  1WOT A;  4LEY A;  9ICB A;  2FMS A;  2IHO A;  4MFC A;  1ZQN A;  5BOL A;  8ICS A;  5D62 A;  4RQ3 A;  2B51 A;  2PFO A;  4PHP A;  5D46 A;  3L9D A;  1ZQA A;  3V72 A;  2FMQ A;  8ICE A;  3UQ0 A;  3C2K A;  3JYY A;  3V7L A;  2ZHB A;  4JLX A;  7ICN A;  4QZC A;  4RWO A;  4R66 A;  2M2U A;  4NM2 A;  1JN3 A;  2B4V A;  3AUO A;  2PXI A;  4X5V A;  3AU6 A;  5J0T A;  4GXJ A;  1OU5 A;  4X4S A;  7ICH A;  4FO6 A;  3NYB A;  5IIK A;  5DEC A;  4X4R A;  4I29 A;  4WC3 A;  4P4M A;  1ZQL A;  1ZQF A;  4AT7 A;  3JZ0 A;  4I2D A;  1BPX A;  4LEW A;  4TUS A;  9ICU A;  1ZQH A;  9ICK A;  5J0Q A;  3JPN A;  2RFF A;  4O9M A;  4NXX A;  9ICI A;  5CA7 A;  4I2I A;  3MDC A;  4IQT A;  2ISP A;  1ZQZ A;  1MIW A;  4FHP A;  3NWI A;  4FHY A;  5BPC A;  3MBY A;  4E8F A;  4NY8 A;  1ZQV A;  4K4G A;  3H38 A;  5III A;  2PFN A;  2I9G A;  4KLE A;  4PHA A;  4FH5 A;  1UEV A;  4WC2 A;  4KLG A;  4I2J A;  4PGX A;  2B56 A;  8ICZ A;  9ICL A;  5D4B A;  4RQ8 A;  2ZH5 A;  3MGI A;  2HN2 A;  8ICY A;  8ICT A;  1R8B A;  5J2D A;  3TFS A;  4EED A;  7ICK A;  9ICP A;  3AQM A;  4K9B A;  4F5R A;  1BPB A;  4RT3 A;  2DRA A;  9ICA A;  4LT6 A;  1FA0 A;  4TUP A;  4NLK A;  2GA9 D;  4AT9 A;  3C2M A;  3JPS A;  5IIN A;  2BCS A;  1ZQX A;  4HX0 A;  3WFP A;  4WC1 A;  5HC9 A;  1Q78 A;  5J2E A;  4QZG A;  8ICK A;  1ZQD A;  4KLQ A;  4WQL A;  4KLF A;  5J2B A;  1HUO A;  9ICH A;  4X4O A;  2HHP A;  4PGY A;  4X4Q A;  3GDX A;  7ICU A;  4X4V A;  4XUS A;  4I2E A;  5CR0 A;  4WC0 A;  5DBC A;  3OGU A;  3ISB A;  4YMN A;  4UB4 A;  4ATB B;  4WH5 A;  1ZQJ A;  1RPL A;  4KLT A;  4NKU A;  4Z6D A;  3ISD A;  3V7K A;  8ICA A;  8ICG A;  9ICT A;  3RJJ A;  4PH5 A;  7ICV A;  4KLD A;  4ATB A;  4KLU A;  3HJ1 A;  4UB1 A;  2BCV A;  4XQ7 A;  4DOC A;  4MF2 A;  5TZV A;  3RH5 A;  4MKP A;  4TUQ A;  7ICS A;  8ICX A;  2GAF D;  4OAG A;  4MF8 A;  3MDA A;  4P2H A;  1KEJ A;  8ICW A;  2VAN A;  4K9A A;  9ICN A;  2M2W A;  2P66 A;  1TFW A;  4F5O A;  7ICM A;  3NKU A;  5DED A;  3PMN A;  3JPO A;  3B0X A;  4IQU A;  5CFS A;  4X0A A;  7ICP A;  4IQV A;  3K7D A;  3WFS C;  3UXO A;  4YD2 A;  4RPY A;  3EF2 A;  4NM1 A;  4O6A A;  4RQ2 A;  5IIO A;  5DDY A;  4I2H A;  8ICQ A;  5IIL A;  1MQ3 A;  4KLL A;  3NVO A;  4O67 A;  5J2G A;  4LZG A;  3OUY B;  1ZQT A;  1BPE A;  4E80 A;  5D63 A;  3OVA A;  4AT7 B;  4UAY A;  5J2A A;  5J0O A;  4UAZ A;  4K98 A;  5CJ7 A;  3RH4 A;  4I2B A;  4JWM A;  4RQ4 A;  2DR7 A;  5J0X A;  3OVB A;  7ICF A;  3OUY A;  5J0Y A;  5CP2 A;  8ICV A;  5DBA A;  8ICU A;  2ZHA A;  5HRL A;  3WFQ E;  4F5P A;  1TVA A;  1VFG A;  2ZH9 A;  2Q66 A;  4PHE A;  9ICE A;  4EP7 A;  7ICO A;  4K4I A;  3HWT A;  2ID1 A;  3OV7 A;  3JPQ A;  2PFQ A;  4KLI A;  1R8A A;  1XSN A;  7ICI A;  4RWN A;  4I0U A;  3RJG A;  5CHG A;  4M9N A;  1VJ7 A;  3LQC B;  5D49 A;  4WC4 A;  2BPG A;  1Q79 A;  4RQ1 A;  2ZH6 A;  3PNC A;  4I27 A;  3B0Y A;  4X4T A;  7ICJ A;  1ZQO A;  4TUR A;  4E7X A;  4UBC A;  5J2C A;  4N7R A;  5DB9 A;  8ICF A;  2ISO A;  4LEV A;  5J2H A;  4NXW A;  1ZQC A;  2DRB A;  1ZQY A;  1HUZ A;  3MGH A;  1NOM A;  3ERC C;  4WOY A;  4R63 A;  3WFR E;  5J0S A;  3HW8 A;  3RJK A;  3C5F A;  2BPF A;  3V7J A;  1ZJM A;  4Z6F A;  4K97 A;  1GPJ A;  4M9G A;  1YLQ A;  4AT9 B;  1XSL A;  4YN4 A;  1V4A A;  3AU2 A;  4NXT A;  5HRE A;  5J0R A;  1KDH A;  4EV6 A;  4KB6 A;  3UQ2 A;  4QZD A;  4M04 A;  1ZQU A;  2BPC A;  3H37 A;  7ICG A;  1JMS A;  5CWR A;  4WC6 A;  5B3Q A;  4O68 A;  4NLN A;  4K96 A;  4EGW A;  4WBY A;  1BPY A;  2DR5 A;  3C18 A;  4NKT A;  5J0W A;  4UAW A;  4LVS A;  4LZD A;  4JWN A;  7ICE A;  4UD5 A;  4PGQ A;  2O1P A;  4RWQ A;  8ICP A;  1MQ2 A;  3C5G A;  4EEB A;  2BBJ A;  5J0P A;  1R89 A;  4RQ6 A;  4KLS A;  2HN1 A;  2ZH1 A;  1ZQP A;  1ZQW A;  2GWS A;  8ICR A;  5J2F A;  3JPR A;  5J0U A;  4KLH A;  5HRD A;  2PBE A;  1MIV A;  2W9M A;  4KLM A;  1BPD A;  8ICO A;  5BOM A;  4UD4 A;  4NXZ A;  5DB6 A;  4MFF A;  1RZT A;  5HRI A;  8ICB A;  4K4H A;  4K8V A;  3JPP A;  5DB8 A;  4I2C A;  3JCF A;  5HHH A;  4OAI Z;  4QZH A;  5D61 A;  4UB5 A;  5CFT A;  4I2A A;  2ZH3 A;  4O69 A;  4WQK A;  4AT8 A;  2M2T A;  2FMP A;  4R65 A;  5HRH A;  4QZ8 A;  5EOZ A;  4QZI A;  3ISC A;  1NO5 A;  5F2V O;  1ZQS A;  2BCR A;  9ICS A;  2NRK A;  5HRF A;  3HIY A;  4FHX A;  3RJF A;  5DBB A;  3H3A A;  4P4O A;  4RWP A;  4Z6C A;  3H39 A;  4X0B A;  5J2I A;  3UXP A;  3OVS A;  4JLZ A;  4WC5 A;  2O5A A;  9ICG A;  2ZH7 A;  4RQ5 A;  1ZQI A;  4IQW A;  4M0A A;  5DB7 A;  1KNY A;  4NXU A;  5HRB A;  1ZQR A;  3HX0 A;  4M5D A;  3PML A;  2DR9 A;  4NXV A;  3AQL A;  4YMO A;  4QZA A;  1JAJ A;  1PX5 A;  4DO9 A;  4M9L A;  4DOA A;  4X4N A;  4KLJ A; 
#chains in the Genus database with same CATH homology
 5CB1 A;  2DR8 A;  3HJ4 A;  3LK9 A;  4S3N A;  9ICW A;  4YD1 A;  3UPS A;  4M9H A;  9ICJ A;  3RH6 A;  4PHD A;  4QZF A;  4NLZ A;  4GXK A;  5DDM A;  4M9J A;  1TFY A;  4MFA A;  2IHM A;  4X4U A;  5J2K A;  7ICT A;  1R8C A;  4M2Y A;  1ZQB A;  2PFP A;  4XQ8 A;  2BCU A;  5IIM A;  4UB3 A;  4RT2 A;  4WBZ A;  2ZH2 A;  4XA5 A;  5IIJ A;  4FHW A;  4M47 A;  4QZB A;  4PPX A;  4RPZ A;  8ICN A;  4RQ7 A;  4I2F A;  2M2V A;  7ICL A;  4EBJ A;  4UBB A;  9ICV A;  4YCX A;  4WC7 A;  5HR9 A;  8ICJ A;  7ICR A;  3K75 D;  4QZE A;  4FH3 A;  3RJH A;  4F5Q A;  5HHI A;  2DVI A;  7ICQ A;  4O5E A;  8ICL A;  1JQR A;  9ICQ A;  3JPT A;  2BCQ A;  4I28 A;  4O5K A;  1ZQM A;  9ICX A;  3WFO A;  3RJI A;  4UB2 A;  1F5A A;  2BE3 A;  4XRH A;  4YMM A;  2ZH4 A;  9ICO A;  3RJE A;  3AQK A;  4QZ9 A;  4RQ0 A;  1TV9 A;  4DOB A;  1ZJN A;  4F5N A;  5DKW A;  4RPX A;  4IG8 A;  2ZH8 A;  3TFR A;  1UEU A;  4GXI A;  3C2L A;  1MIY A;  9ICM A;  1BPZ A;  4O5C A;  4KLO A;  5J29 A;  8ICC A;  8ICH A;  9ICF A;  4R64 A;  4P4P A;  4AT8 B;  9ICC A;  3C66 A;  9ICR A;  8ICM A;  1ZQE A;  1UET A;  8ICI A;  4EBK A;  5HRG A;  1ZQK A;  3UXN A;  4Z6E A;  4WCW A;  1ZQQ A;  1ZQG A;  5J2J A;  5HRK A;  4X4P A;  4I2G A;  3UPQ A;  3AQN A;  4FHV A;  1XSP A;  1WOT A;  9ICB A;  2FMS A;  4MFC A;  1ZQN A;  5BOL A;  8ICS A;  4RQ3 A;  2PFO A;  4PHP A;  5D46 A;  3L9D A;  1ZQA A;  3V72 A;  2FMQ A;  8ICE A;  3UQ0 A;  3C2K A;  3JYY A;  3V7L A;  2ZHB A;  7ICN A;  4QZC A;  4RWO A;  4R66 A;  2M2U A;  4NM2 A;  1JN3 A;  3AUO A;  2PXI A;  4X5V A;  3AU6 A;  5J0T A;  4GXJ A;  1OU5 A;  4X4S A;  7ICH A;  4FO6 A;  3NYB A;  5IIK A;  5DEC A;  4X4R A;  4I29 A;  4WC3 A;  4P4M A;  1ZQL A;  1ZQF A;  4AT7 A;  3JZ0 A;  4I2D A;  1BPX A;  4TUS A;  9ICU A;  1ZQH A;  9ICK A;  5J0Q A;  3JPN A;  2RFF A;  4O9M A;  9ICI A;  5CA7 A;  4I2I A;  3MDC A;  4IQT A;  2ISP A;  1ZQZ A;  1MIW A;  4FHP A;  4FHY A;  5BPC A;  3MBY A;  4E8F A;  4NY8 A;  1ZQV A;  4K4G A;  3H38 A;  5III A;  2PFN A;  2I9G A;  4KLE A;  4PHA A;  4FH5 A;  1UEV A;  4WC2 A;  4KLG A;  4I2J A;  4PGX A;  8ICZ A;  9ICL A;  5D4B A;  4RQ8 A;  2ZH5 A;  3MGI A;  8ICY A;  8ICT A;  1R8B A;  5J2D A;  3TFS A;  7ICK A;  9ICP A;  3AQM A;  4F5R A;  1BPB A;  4RT3 A;  2DRA A;  9ICA A;  4LT6 A;  1FA0 A;  4TUP A;  4NLK A;  4AT9 A;  3C2M A;  3JPS A;  5IIN A;  2BCS A;  1ZQX A;  3WFP A;  4WC1 A;  5HC9 A;  1Q78 A;  5J2E A;  4QZG A;  8ICK A;  1ZQD A;  4KLQ A;  4KLF A;  5J2B A;  1HUO A;  9ICH A;  4X4O A;  2HHP A;  4PGY A;  4X4Q A;  3GDX A;  7ICU A;  4X4V A;  4XUS A;  4I2E A;  5CR0 A;  4WC0 A;  5DBC A;  3ISB A;  3OGU A;  4YMN A;  4UB4 A;  4ATB B;  1ZQJ A;  1RPL A;  4KLT A;  4NKU A;  4Z6D A;  3ISD A;  3V7K A;  8ICA A;  8ICG A;  9ICT A;  3RJJ A;  4PH5 A;  7ICV A;  4KLD A;  4ATB A;  4KLU A;  3HJ1 A;  4UB1 A;  2BCV A;  4XQ7 A;  4DOC A;  4MF2 A;  5TZV A;  3RH5 A;  4TUQ A;  7ICS A;  8ICX A;  4MF8 A;  3MDA A;  4P2H A;  1KEJ A;  8ICW A;  2VAN A;  9ICN A;  2M2W A;  2P66 A;  1TFW A;  4F5O A;  7ICM A;  5DED A;  3PMN A;  3JPO A;  3B0X A;  4IQU A;  4X0A A;  7ICP A;  4IQV A;  3WFS C;  3UXO A;  4YD2 A;  4RPY A;  4NM1 A;  4RQ2 A;  5IIO A;  5DDY A;  4I2H A;  8ICQ A;  5IIL A;  1MQ3 A;  4KLL A;  5J2G A;  4LZG A;  3OUY B;  1ZQT A;  1BPE A;  4E80 A;  3OVA A;  4AT7 B;  4UAY A;  5J2A A;  5J0O A;  4UAZ A;  3RH4 A;  5CJ7 A;  4I2B A;  4JWM A;  4RQ4 A;  2DR7 A;  5J0X A;  3OVB A;  7ICF A;  3OUY A;  5J0Y A;  5CP2 A;  8ICV A;  5DBA A;  8ICU A;  2ZHA A;  5HRL A;  3WFQ E;  4F5P A;  1TVA A;  1VFG A;  2ZH9 A;  2Q66 A;  4PHE A;  9ICE A;  4EP7 A;  7ICO A;  4K4I A;  3HWT A;  2ID1 A;  3OV7 A;  3JPQ A;  2PFQ A;  4KLI A;  1R8A A;  1XSN A;  7ICI A;  4RWN A;  3RJG A;  5CHG A;  4M9N A;  1VJ7 A;  3LQC B;  5D49 A;  4WC4 A;  2BPG A;  1Q79 A;  4RQ1 A;  2ZH6 A;  3PNC A;  4I27 A;  3B0Y A;  4X4T A;  7ICJ A;  1ZQO A;  4TUR A;  4E7X A;  4UBC A;  5J2C A;  5DB9 A;  8ICF A;  2ISO A;  5J2H A;  1ZQC A;  2DRB A;  1ZQY A;  1HUZ A;  3MGH A;  1NOM A;  4R63 A;  3WFR E;  5J0S A;  3HW8 A;  3RJK A;  3C5F A;  2BPF A;  3V7J A;  1ZJM A;  4Z6F A;  4M9G A;  1YLQ A;  4AT9 B;  1XSL A;  4YN4 A;  1V4A A;  3AU2 A;  5HRE A;  5J0R A;  1KDH A;  3UQ2 A;  4QZD A;  4M04 A;  1ZQU A;  2BPC A;  3H37 A;  7ICG A;  1JMS A;  5CWR A;  4WC6 A;  4NLN A;  2DR5 A;  4WBY A;  1BPY A;  3C18 A;  4NKT A;  5J0W A;  4UAW A;  4LVS A;  4LZD A;  4JWN A;  7ICE A;  4UD5 A;  4PGQ A;  2O1P A;  4RWQ A;  8ICP A;  1MQ2 A;  3C5G A;  5J0P A;  1R89 A;  4RQ6 A;  4KLS A;  2ZH1 A;  1ZQP A;  1ZQW A;  2GWS A;  8ICR A;  5J2F A;  3JPR A;  5J0U A;  4KLH A;  5HRD A;  2PBE A;  1MIV A;  2W9M A;  4KLM A;  1BPD A;  8ICO A;  5BOM A;  4UD4 A;  4NXZ A;  5DB6 A;  4MFF A;  1RZT A;  5HRI A;  8ICB A;  4K4H A;  3JPP A;  5DB8 A;  4I2C A;  5HHH A;  4QZH A;  4UB5 A;  4I2A A;  2ZH3 A;  4AT8 A;  2M2T A;  2FMP A;  4R65 A;  5HRH A;  4QZ8 A;  5EOZ A;  4QZI A;  3ISC A;  1NO5 A;  5F2V O;  1ZQS A;  2BCR A;  9ICS A;  2NRK A;  5HRF A;  3HIY A;  4FHX A;  3RJF A;  5DBB A;  3H3A A;  4P4O A;  4RWP A;  4Z6C A;  3H39 A;  4X0B A;  5J2I A;  3UXP A;  3OVS A;  4WC5 A;  2O5A A;  9ICG A;  2ZH7 A;  4RQ5 A;  1ZQI A;  4IQW A;  4M0A A;  5DB7 A;  1KNY A;  5HRB A;  1ZQR A;  3HX0 A;  4M5D A;  3PML A;  2DR9 A;  3AQL A;  4YMO A;  4QZA A;  1JAJ A;  1PX5 A;  4DO9 A;  4M9L A;  4DOA A;  4X4N A;  4KLJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...