4WC5A

Structure of trna-processing enzyme complex 3
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
381
structure length
367
Chain Sequence
MVGQIAKEMGLRAYIVGGVVRDILLGKEVWDVDFVVEGNAIELAKELARRHGVNVHPFPEFGTAHLKIGKLKLEFATARRETEPASLKEDLIRRDFTINAMAISVNLEDYGTLIDYFGGLRDLKDKVIRVLHPVSFIEDPVRILRALRFAGRLNFKLSRSTEKLLKQAVNLGLLKEAPRGRLINEIKLALREDRFLEILELYRKYRVLEEIIEGFQWNEKVLQKLYALRKVVDWHALEFSEERIDYGWLYLLILISNLDYERGKHFLEEMSAPSWVRETYKFMKFKLGSLKEELKKAKENYEVYRLLKPLHTSVLLLLMLEEELKEKIKLYLEKLRKVKLPKEKIEELKKGKELGERIEELKREIMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Poly A polymerase
publication title Measurement of Acceptor-T Psi C Helix Length of tRNA for Terminal A76-Addition by A-Adding Enzyme.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Transferase/rna
total genus 115
structure length 367
sequence length 381
ec nomenclature
pdb deposition date 2014-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01743 PolyA_pol Poly A polymerase head domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3090.10 Mainly Alpha Orthogonal Bundle cca-adding enzyme, domain 2 cca-adding enzyme, domain 2 4wc5A02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4wc5A01
1ZQCA 4RQ7A 4P4MA 4MF8A 2ZH7A 5EOZA 1ZQMA 4S3NA 7ICEA 3L9DA 4YMNA 9ICIA 1FA0A 1BPEA 7ICUA 4UB5A 4Z6EA 4QZIA 3JPPA 5DBBA 4K4GA 9ICRA 4XQ7A 5HHHA 1ZQDA 5J2AA 1ZQXA 3AQKA 8ICBA 3HWTA 4IQVA 4R66A 5HHIA 1JAJA 4MFAA 4AT9B 3LK9A 2M2TA 1ZQIA 3B0XA 4PGXA 9ICCA 4RQ6A 4RQ1A 9ICJA 1ZQKA 3HX0A 1V4AA 5IIOA 4UAWA 8ICVA 4ATBA 5DBAA 4DOBA 7ICQA 2ZHBA 5HREA 3RJFA 1ZQVA 8ICOA 4RWPA 2PFOA 5J2HA 4YMMA 4RQ3A 4UB1A 2ZH1A 8ICMA 4RWOA 4YD2A 1MIYA 4M0AA 9ICUA 1MIVA 4DOAA 4KLIA 3K75D 4KLFA 4QZFA 2DR7A 9ICNA 7ICNA 4NLNA 1JN3A 5HRLA 4QZBA 4QZ9A 8ICPA 3H37A 4X4UA 3V72A 1TFYA 4WC2A 4QZEA 1HUZA 3WFQE 4PGQA 1YLQA 4TURA 4QZ8A 2FMSA 2DR8A 3JPRA 5J0YA 4NLZA 4KLUA 4NM2A 4I2BA 3WFPA 5CHGA 2O1PA 4AT8B 5J0WA 4X0BA 4RQ5A 4JWNA 1ZQWA 2DR9A 2FMPA 7ICFA 2ID1A 9ICMA 9ICQA 5IIJA 8ICJA 4FHPA 4RWNA 5IINA 5D4BA 3PMLA 4O5KA 2Q66A 9ICAA 1NOMA 4F5RA 3UXOA 1ZJNA 1JQRA 5HC9A 4X4OA 4RT3A 7ICSA 4P2HA 3UQ0A 4ATBB 4KLSA 8ICLA 4EBKA 8ICCA 4RQ2A 4WC0A 5J0XA 4YCXA 1R8BA 3JPSA 2BE3A 1BPZA 3MDCA 5J0SA 1HUOA 9ICWA 7ICTA 5F2VO 4QZAA 5DB7A 1PX5A 4QZHA 4XUSA 9ICGA 1ZQHA 1R8AA 4UB4A 3UPQA 1ZJMA 4RQ4A 3UQ2A 1BPXA 4I27A 3RJIA 2I9GA 3H3AA 8ICYA 2BPCA 9ICHA 4X4TA 4TUSA 5J29A 2DVIA 5D49A 5J2KA 3JYYA 4RPZA 1ZQQA 4KLHA 2RFFA 4I2JA 5CWRA 4NKUA 7ICJA 8ICGA 2PFNA 4UB2A 7ICIA 3JPTA 4UB3A 4AT8A 9ICLA 1VFGA 9ICBA 3RJGA 4M9NA 5J0UA 4PHEA 3MDAA 4MF2A 5J2BA 5DB8A 1ZQYA 4KLDA 9ICTA 4PHAA 5J0OA 4EP7A 7ICVA 2BCVA 1JMSA 4KLJA 4TUPA 4WBZA 5D46A 1XSPA 5IIIA 4I2EA 4WC7A 5J0PA 1TV9A 1ZQBA 4WC1A 3MGHA 1R89A 3RJKA 5CR0A 4GXJA 4M2YA 3JZ0A 3RH5A 2DR5A 4RPXA 5HRKA 7ICHA 7ICLA 5HR9A 3HW8A 8ICTA 5DKWA 3UPSA 4MFCA 5IIMA 1ZQZA 4F5PA 2IHMA 1NO5A 3HJ4A 1MQ3A 7ICMA 1ZQGA 9ICFA 2ZHAA 4NY8A 3HIYA 4M9JA 1XSNA 2ZH3A 4LT6A 5CP2A 1KNYA 3OV7A 5DDMA 5HRIA 9ICEA 8ICSA 1ZQEA 5J2EA 7ICGA 8ICIA 5DECA 4QZGA 1MIWA 4FH5A 4X4RA 4UD4A 4UBBA 1MQ2A 4MFFA 3TFSA 3C2KA 3HJ1A 5IIKA 4WC4A 4EBJA 5J2CA 9ICOA 4IQUA 1WOTA 4NXZA 4X0AA 2W9MA 4X4PA 4IQWA 4M47A 4PGYA 1ZQAA 4O5EA 4KLQA 1UETA 4K4HA 1ZQOA 4UBCA 1ZQUA 1ZQRA 3AQMA 2ZH4A 4DOCA 8ICQA 2M2VA 4I2GA 3V7LA 2PBEA 3PMNA 4UAZA 2ZH8A 3UXPA 2BCUA 3RH6A 1UEUA 4PHPA 5J2IA 4FHVA 2P66A 4I2DA 1ZQSA 5J0TA 4F5QA 3C18A 7ICRA 5J2JA 2PFPA 3GDXA 4Z6CA 1BPBA 3ISDA 7ICPA 3AQNA 4YN4A 4KLEA 3UXNA 8ICNA 2PXIA 2O5AA 4RQ0A 3C2LA 4I2CA 5J2DA 4KLOA 3WFRE 2ZH2A 4WCWA 5J2GA 9ICKA 3WFSC 8ICFA 4UAYA 3V7JA 2BCSA 2DRAA 3OGUA 4M5DA 4WC6A 4P4PA 2BCQA 5TZVA 5J0RA 3MBYA 4KLTA 4KLGA 4XA5A 2BPGA 4I2IA 4FHXA 4RT2A 3ISBA 4DO9A 3RH4A 4PPXA 4NM1A 4I28A 3JPOA 4R64A 4UD5A 4FHWA 4LZGA 5BPCA 1KDHA 3C2MA 4TUQA 2M2WA 5DDYA 2ISOA 3RJJA 4M04A 4M9LA 5BOLA 1RPLA 8ICWA 2HHPA 1Q79A 1ZQLA 4YMOA 4X4QA 4GXKA 3RJEA 9ICVA 1OU5A 5DB6A 4FHYA 4LZDA 4X4NA 2ZH5A 4X4SA 4KLMA 4WC3A 8ICRA 4F5OA 3C5GA 3MGIA 8ICAA 1R8CA 4K4IA 1XSLA 1KEJA 9ICXA 4RWQA 8ICXA 3H38A 5CJ7A 2GWSA 3WFOA 3NYBA 4RPYA 5HRFA 1VJ7A 1ZQTA 4IQTA 3AU2A 8ICHA 1BPDA 5HRBA 1TFWA 2VANA 4M9HA 3TFRA 4E80A 4PHDA 4O5CA 2FMQA 4FH3A 5HRGA 3OUYA 1ZQNA 3AQLA 4YD1A 4AT7A 5DB9A 3ISCA 5J0QA 5DBCA 4GXIA 4F5NA 4P4OA 1Q78A 4X5VA 4R63A 5DEDA 4XQ8A 3JPQA 3OVBA 4FO6A 1ZQFA 7ICOA 4WC5A 3PNCA 4X4VA 3C66A 8ICZA 3AU6A 4Z6DA 1ZQJA 5CA7A 5BOMA 4PH5A 4QZDA 1BPYA 2PFQA 9ICSA 4R65A 3OVAA 3AUOA 1ZQPA 4AT9A 4E8FA 9ICPA 3OVSA 3JPNA 7ICKA 1UEVA 2NRKA 4RQ8A 2ZH6A 4O9MA 4M9GA 5CB1A 2BCRA 3V7KA 4NKTA 1F5AA 4XRHA 5IILA 4WBYA 5J2FA 5HRHA 4KLLA 4I2AA 8ICKA 3B0YA 8ICUA 4I2HA 4JWMA 4Z6FA 2ISPA 4IG8A 4I2FA 3H39A 4NLKA 3LQCB 8ICEA 3OUYB 4LVSA 2DRBA 4QZCA 4AT7B 2ZH9A 2BPFA 3RJHA 3C5FA 4I29A 5HRDA 2M2UA 4E7XA 1TVAA 1RZTA
chains in the Genus database with same CATH superfamily
1ZQCA 4RQ7A 4P4MA 4MF8A 2ZH7A 5EOZA 1ZQMA 4S3NA 5D62A 2IUBA 7ICEA 3L9DA 4YMNA 9ICIA 5D63A 1FA0A 1BPEA 7ICUA 4UB5A 4Z6EA 4QZIA 3JPPA 5DBBA 4K4GA 9ICRA 4XQ7A 5HHHA 4K9BA 1ZQDA 5J2AA 4K8VA 1ZQXA 3AQKA 4O68A 8ICBA 3HWTA 4IQVA 4R66A 5HHIA 1JAJA 4MFAA 4AT9B 3LK9A 2M2TA 1ZQIA 3B0XA 4PGXA 9ICCA 3NKUA 4RQ6A 4RQ1A 4K96A 9ICJA 1ZQKA 3HX0A 1V4AA 5IIOA 4UAWA 8ICVA 4ATBA 5DBAA 4DOBA 7ICQA 3PHZA 2ZHBA 3NWIA 5HREA 3RJFA 1ZQVA 8ICOA 4RWPA 2PFOA 9ICQA 5J2HA 4YMMA 4RQ3A 4UB1A 3CK6A 2ZH1A 8ICMA 4RWOA 4YD2A 1MIYA 4M0AA 9ICUA 1MIVA 4DOAA 4KLIA 3K75D 4KLFA 4QZFA 2DR7A 9ICNA 7ICNA 4NLNA 1JN3A 4O69A 5HRLA 4EV6A 4QZBA 4QZ9A 8ICPA 3H37A 4X4UA 3V72A 1TFYA 4WC2A 4OAIZ 4OAGA 4QZEA 1HUZA 3WFQE 4PGQA 1YLQA 4TURA 3MCRA 4QZ8A 2FMSA 2DR8A 3JPRA 5J0YA 4KB6A 4NLZA 4KLUA 4NM2A 4I2BA 3WFPA 5CHGA 2O1PA 4AT8B 5J0WA 4X0BA 4RQ5A 3NVOA 1ZQWA 2DR9A 2FMPA 4JWNA 2ID1A 7ICFA 9ICMA 5IIJA 8ICJA 3ERCC 4FHPA 4RWNA 5IINA 5D4BA 3PMLA 4O5KA 2Q66A 9ICAA 1NOMA 4F5RA 3UXOA 1ZJNA 1JQRA 5HC9A 4X4OA 4RT3A 7ICSA 4P2HA 3UQ0A 4ATBB 4KLSA 8ICLA 4EBKA 8ICCA 4RQ2A 4WC0A 5J0XA 4YCXA 1R8BA 4OAFA 3JPSA 2BE3A 1BPZA 3MDCA 5J0SA 1HUOA 9ICWA 7ICTA 3JCFA 5F2VO 4QZAA 5DB7A 1PX5A 5JTGA 4QZHA 4XUSA 9ICGA 1ZQHA 1R8AA 4UB4A 3UPQA 1ZJMA 4RQ4A 1RZTA 3UQ2A 1BPXA 4I27A 3RJIA 2I9GA 3H3AA 8ICYA 2BPCA 4K98A 4X4TA 9ICHA 4TUSA 4NXTA 5J29A 2DVIA 5D49A 4K99A 5J2KA 3JYYA 4EEDA 4RPZA 1ZQQA 4KLHA 2RFFA 4I2JA 5CWRA 4NKUA 7ICJA 8ICGA 2PFNA 4UB2A 7ICIA 4I0UA 3JPTA 4UB3A 4AT8A 9ICLA 1VFGA 9ICBA 4NXXA 3RJGA 4M9NA 5J0UA 4PHEA 3MDAA 4MF2A 5J2BA 5DB8A 1ZQYA 4KLDA 9ICTA 4PHAA 5J0OA 4EP7A 7ICVA 2IHOA 2BCVA 1JMSA 4KLJA 4TUPA 4WBZA 5D46A 1XSPA 5IIIA 4I2EA 4WC7A 5J0PA 1TV9A 1ZQBA 4WC1A 3MGHA 1R89A 5D61A 3RJKA 5CR0A 4GXJA 4M2YA 3JZ0A 3RH5A 2DR5A 4RPXA 5HRKA 7ICHA 2BBHA 7ICLA 5HR9A 3HW8A 8ICTA 5DKWA 3UPSA 4MFCA 5IIMA 1ZQZA 4JLZA 4F5PA 2IHMA 1NO5A 3HJ4A 1MQ3A 7ICMA 1ZQGA 9ICFA 2ZHAA 4NY8A 3HIYA 4M9JA 1XSNA 2ZH3A 4LT6A 5CP2A 1KNYA 3ER8C 3OV7A 5DDMA 5HRIA 9ICEA 2GAFD 8ICSA 1ZQEA 5J2EA 7ICGA 8ICIA 5DECA 4QZGA 1MIWA 4FH5A 4X4RA 4UD4A 4UBBA 1MQ2A 5B3QA 4MFFA 3TFSA 3C2KA 3HJ1A 5IIKA 4WC4A 4EBJA 5J2CA 9ICOA 4IQUA 1WOTA 4NXZA 4X0AA 2W9MA 4X4PA 4IQWA 4M47A 4FO1A 4PGYA 1ZQAA 4O5EA 4KLQA 1UETA 4K4HA 1ZQOA 4UBCA 1ZQUA 1ZQRA 4WOYA 3AQMA 2ZH4A 4DOCA 8ICQA 2M2VA 4I2GA 3V7LA 2PBEA 3PMNA 4UAZA 2ZH8A 3UXPA 2BCUA 3RH6A 1UEUA 4PHPA 5J2IA 4LEWA 4FHVA 2P66A 4I2DA 1ZQSA 5J0TA 4F5QA 3C18A 7ICRA 5J2JA 2PFPA 3GDXA 4Z6CA 1BPBA 3ISDA 7ICPA 3AQNA 4YN4A 2B4VA 4KLEA 3UXNA 4LEYA 8ICNA 2PXIA 2O5AA 4RQ0A 3C2LA 4I2CA 5J2DA 4KLOA 3WFRE 2ZH2A 4WCWA 5B3PA 5J2GA 9ICKA 3WFSC 8ICFA 3OWGA 4UAYA 3V7JA 2BCSA 2DRAA 3OGUA 4M5DA 4WC6A 4P4PA 2BCQA 5TZVA 5J0RA 3MBYA 4KLTA 4KLGA 2BBJA 4XA5A 2BPGA 4I2IA 4FHXA 4RT2A 3ISBA 4DO9A 4WH5A 3RH4A 4PPXA 4NM1A 4I28A 3JPOA 4R64A 4UD5A 4FHWA 4LZGA 5BPCA 1KDHA 3C2MA 4TUQA 4HX0A 2M2WA 4N7RA 5DDYA 2ISOA 3RJJA 4M04A 4M9LA 4O6AA 4MKPA 5BOLA 1RPLA 8ICWA 2HHPA 1Q79A 1ZQLA 4NXUA 1GPJA 4YMOA 2B56A 4X4QA 4GXKA 3RJEA 2HN2A 9ICVA 1OU5A 4OAHA 4FHYA 4WQKA 5DB6A 4LZDA 4X4NA 2ZH5A 4KM5A 4X4SA 4KLMA 4WC3A 8ICRA 5CFSA 3ER9B 4F5OA 3C5GA 3MGIA 8ICAA 1R8CA 4K4IA 1XSLA 1KEJA 4JLXA 9ICXA 4RWQA 8ICXA 3H38A 5CJ7A 2GWSA 3WFOA 3NYBA 4RPYA 5HRFA 1VJ7A 1ZQTA 4IQTA 3AU2A 8ICHA 4LEVA 1BPDA 5HRBA 4WQLA 1TFWA 2VANA 4M9HA 3TFRA 4E80A 2GA9D 4PHDA 4O5CA 2FMQA 4FH3A 5HRGA 4EGWA 2FCLA 3OUYA 1ZQNA 3AQLA 4YD1A 4AT7A 5DB9A 3ISCA 5J0QA 5DBCA 4GXIA 4F5NA 4P4OA 1Q78A 4X5VA 4R63A 5DEDA 4XQ8A 5CFUA 3JPQA 3OVBA 4FO6A 1ZQFA 7ICOA 4WC5A 4NXVA 3PNCA 4X4VA 3C66A 4K97A 3K7DA 8ICZA 3AU6A 4Z6DA 1ZQJA 3EF2A 5CA7A 4K9AA 5BOMA 4PH5A 4QZDA 1BPYA 2PFQA 9ICSA 4R65A 3OVAA 3AUOA 1ZQPA 4AT9A 4E8FA 9ICPA 3OVSA 3JPNA 2B51A 7ICKA 1UEVA 2NRKA 4RQ8A 2ZH6A 4O9MA 4M9GA 5CB1A 2BCRA 3V7KA 4NKTA 4XJEA 1F5AA 4XRHA 5IILA 4WBYA 5J2FA 5HRHA 4KLLA 4I2AA 8ICKA 3B0YA 4EEBA 8ICUA 4O67A 4I2HA 2HN1A 4JWMA 4Z6FA 5CFTA 2ISPA 4LEZA 4IG8A 4I2FA 3H39A 4NLKA 3LQCB 8ICEA 3OUYB 4LVSA 2DRBA 5CHEA 4QZCA 4AT7B 2ZH9A 2BPFA 3RJHA 3C5FA 4I29A 2EWRA 5HRDA 2M2UA 4E7XA 1TVAA 4NXWA
chains in the Genus database with same CATH topology
1ZQCA 4RQ7A 4P4MA 4MF8A 2ZH7A 5EOZA 1ZQMA 4S3NA 7ICEA 3L9DA 4YMNA 9ICIA 1FA0A 1BPEA 7ICUA 4UB5A 4Z6EA 4QZIA 3JPPA 5DBBA 4K4GA 9ICRA 4XQ7A 5HHHA 1ZQDA 5J2AA 1ZQXA 3AQKA 8ICBA 3HWTA 4IQVA 4R66A 5HHIA 1JAJA 4MFAA 4AT9B 3LK9A 2M2TA 1ZQIA 3B0XA 4PGXA 9ICCA 4RQ6A 4RQ1A 9ICJA 1ZQKA 3HX0A 1V4AA 5IIOA 4UAWA 8ICVA 4ATBA 5DBAA 4DOBA 7ICQA 2ZHBA 5HREA 3RJFA 1ZQVA 8ICOA 4RWPA 2PFOA 5J2HA 4YMMA 4RQ3A 4UB1A 2ZH1A 8ICMA 4RWOA 4YD2A 1MIYA 4M0AA 9ICUA 1MIVA 4DOAA 4KLIA 3K75D 4KLFA 4QZFA 2DR7A 9ICNA 7ICNA 4NLNA 1JN3A 5HRLA 4QZBA 4QZ9A 8ICPA 3H37A 4X4UA 3V72A 1TFYA 4WC2A 4QZEA 1HUZA 3WFQE 4PGQA 1YLQA 4TURA 4QZ8A 2FMSA 2DR8A 3JPRA 5J0YA 4NLZA 4KLUA 4NM2A 4I2BA 3WFPA 5CHGA 2O1PA 4AT8B 5J0WA 4X0BA 4RQ5A 4JWNA 1ZQWA 2DR9A 2FMPA 7ICFA 2ID1A 9ICMA 9ICQA 5IIJA 8ICJA 4FHPA 4RWNA 5IINA 5D4BA 3PMLA 4O5KA 2Q66A 9ICAA 1NOMA 4F5RA 3UXOA 1ZJNA 1JQRA 5HC9A 4X4OA 4RT3A 7ICSA 4P2HA 3UQ0A 4ATBB 4KLSA 8ICLA 4EBKA 8ICCA 4RQ2A 4WC0A 5J0XA 4YCXA 1R8BA 3JPSA 2BE3A 1BPZA 3MDCA 5J0SA 1HUOA 9ICWA 7ICTA 5F2VO 4QZAA 5DB7A 1PX5A 4QZHA 4XUSA 9ICGA 1ZQHA 1R8AA 4UB4A 3UPQA 1ZJMA 4RQ4A 3UQ2A 1BPXA 4I27A 3RJIA 2I9GA 3H3AA 8ICYA 2BPCA 9ICHA 4X4TA 4TUSA 5J29A 2DVIA 5D49A 5J2KA 3JYYA 4RPZA 1ZQQA 4KLHA 2RFFA 4I2JA 5CWRA 4NKUA 7ICJA 8ICGA 2PFNA 4UB2A 7ICIA 3JPTA 4UB3A 4AT8A 9ICLA 1VFGA 9ICBA 3RJGA 4M9NA 5J0UA 4PHEA 3MDAA 4MF2A 5J2BA 5DB8A 1ZQYA 4KLDA 9ICTA 4PHAA 5J0OA 4EP7A 7ICVA 2BCVA 1JMSA 4KLJA 4TUPA 4WBZA 5D46A 1XSPA 5IIIA 4I2EA 4WC7A 5J0PA 1TV9A 1ZQBA 4WC1A 3MGHA 1R89A 3RJKA 5CR0A 4GXJA 4M2YA 3JZ0A 3RH5A 2DR5A 4RPXA 5HRKA 7ICHA 7ICLA 5HR9A 3HW8A 8ICTA 5DKWA 3UPSA 4MFCA 5IIMA 1ZQZA 4F5PA 2IHMA 1NO5A 3HJ4A 1MQ3A 7ICMA 1ZQGA 9ICFA 2ZHAA 4NY8A 3HIYA 4M9JA 1XSNA 2ZH3A 4LT6A 5CP2A 1KNYA 3OV7A 5DDMA 5HRIA 9ICEA 8ICSA 1ZQEA 5J2EA 7ICGA 8ICIA 5DECA 4QZGA 1MIWA 4FH5A 4X4RA 4UD4A 4UBBA 1MQ2A 4MFFA 3TFSA 3C2KA 3HJ1A 5IIKA 4WC4A 4EBJA 5J2CA 9ICOA 4IQUA 1WOTA 4NXZA 4X0AA 2W9MA 4X4PA 4IQWA 4M47A 4PGYA 1ZQAA 4O5EA 4KLQA 1UETA 4K4HA 1ZQOA 4UBCA 1ZQUA 1ZQRA 3AQMA 2ZH4A 4DOCA 8ICQA 2M2VA 4I2GA 3V7LA 2PBEA 3PMNA 4UAZA 2ZH8A 3UXPA 2BCUA 3RH6A 1UEUA 4PHPA 5J2IA 4FHVA 2P66A 4I2DA 1ZQSA 5J0TA 4F5QA 3C18A 7ICRA 5J2JA 2PFPA 3GDXA 4Z6CA 1BPBA 3ISDA 7ICPA 3AQNA 4YN4A 4KLEA 3UXNA 8ICNA 2PXIA 2O5AA 4RQ0A 3C2LA 4I2CA 5J2DA 4KLOA 3WFRE 2ZH2A 4WCWA 5J2GA 9ICKA 3WFSC 8ICFA 4UAYA 3V7JA 2BCSA 2DRAA 3OGUA 4M5DA 4WC6A 4P4PA 2BCQA 5TZVA 5J0RA 3MBYA 4KLTA 4KLGA 4XA5A 2BPGA 4I2IA 4FHXA 4RT2A 3ISBA 4DO9A 3RH4A 4PPXA 4NM1A 4I28A 3JPOA 4R64A 4UD5A 4FHWA 4LZGA 5BPCA 1KDHA 3C2MA 4TUQA 2M2WA 5DDYA 2ISOA 3RJJA 4M04A 4M9LA 5BOLA 1RPLA 8ICWA 2HHPA 1Q79A 1ZQLA 4YMOA 4X4QA 4GXKA 3RJEA 9ICVA 1OU5A 5DB6A 4FHYA 4LZDA 4X4NA 2ZH5A 4X4SA 4KLMA 4WC3A 8ICRA 4F5OA 3C5GA 3MGIA 8ICAA 1R8CA 4K4IA 1XSLA 1KEJA 9ICXA 4RWQA 8ICXA 3H38A 5CJ7A 2GWSA 3WFOA 3NYBA 4RPYA 5HRFA 1VJ7A 1ZQTA 4IQTA 3AU2A 8ICHA 1BPDA 5HRBA 1TFWA 2VANA 4M9HA 3TFRA 4E80A 4PHDA 4O5CA 2FMQA 4FH3A 5HRGA 3OUYA 1ZQNA 3AQLA 4YD1A 4AT7A 5DB9A 3ISCA 5J0QA 5DBCA 4GXIA 4F5NA 4P4OA 1Q78A 4X5VA 4R63A 5DEDA 4XQ8A 3JPQA 3OVBA 4FO6A 1ZQFA 7ICOA 4WC5A 3PNCA 4X4VA 3C66A 8ICZA 3AU6A 4Z6DA 1ZQJA 5CA7A 5BOMA 4PH5A 4QZDA 1BPYA 2PFQA 9ICSA 4R65A 3OVAA 3AUOA 1ZQPA 4AT9A 4E8FA 9ICPA 3OVSA 3JPNA 7ICKA 1UEVA 2NRKA 4RQ8A 2ZH6A 4O9MA 4M9GA 5CB1A 2BCRA 3V7KA 4NKTA 1F5AA 4XRHA 5IILA 4WBYA 5J2FA 5HRHA 4KLLA 4I2AA 8ICKA 3B0YA 8ICUA 4I2HA 4JWMA 4Z6FA 2ISPA 4IG8A 4I2FA 3H39A 4NLKA 3LQCB 8ICEA 3OUYB 4LVSA 2DRBA 4QZCA 4AT7B 2ZH9A 2BPFA 3RJHA 3C5FA 4I29A 5HRDA 2M2UA 4E7XA 1TVAA 1RZTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZQC A;  4RQ7 A;  4P4M A;  4MF8 A;  2ZH7 A;  5EOZ A;  1ZQM A;  4S3N A;  7ICE A;  3L9D A;  4YMN A;  9ICI A;  1FA0 A;  1BPE A;  7ICU A;  4UB5 A;  4Z6E A;  4QZI A;  3JPP A;  5DBB A;  4K4G A;  9ICR A;  4XQ7 A;  5HHH A;  1ZQD A;  5J2A A;  1ZQX A;  3AQK A;  8ICB A;  3HWT A;  4IQV A;  4R66 A;  5HHI A;  1JAJ A;  4MFA A;  4AT9 B;  3LK9 A;  2M2T A;  1ZQI A;  3B0X A;  4PGX A;  9ICC A;  4RQ6 A;  4RQ1 A;  9ICJ A;  1ZQK A;  3HX0 A;  1V4A A;  5IIO A;  4UAW A;  8ICV A;  4ATB A;  5DBA A;  4DOB A;  7ICQ A;  2ZHB A;  5HRE A;  3RJF A;  1ZQV A;  8ICO A;  4RWP A;  2PFO A;  5J2H A;  4YMM A;  4RQ3 A;  4UB1 A;  2ZH1 A;  8ICM A;  4RWO A;  4YD2 A;  1MIY A;  4M0A A;  9ICU A;  1MIV A;  4DOA A;  4KLI A;  3K75 D;  4KLF A;  4QZF A;  2DR7 A;  9ICN A;  7ICN A;  4NLN A;  1JN3 A;  5HRL A;  4QZB A;  4QZ9 A;  8ICP A;  3H37 A;  4X4U A;  3V72 A;  1TFY A;  4WC2 A;  4QZE A;  1HUZ A;  3WFQ E;  4PGQ A;  1YLQ A;  4TUR A;  4QZ8 A;  2FMS A;  2DR8 A;  3JPR A;  5J0Y A;  4NLZ A;  4KLU A;  4NM2 A;  4I2B A;  3WFP A;  5CHG A;  2O1P A;  4AT8 B;  5J0W A;  4X0B A;  4RQ5 A;  4JWN A;  1ZQW A;  2DR9 A;  2FMP A;  7ICF A;  2ID1 A;  9ICM A;  9ICQ A;  5IIJ A;  8ICJ A;  4FHP A;  4RWN A;  5IIN A;  5D4B A;  3PML A;  4O5K A;  2Q66 A;  9ICA A;  1NOM A;  4F5R A;  3UXO A;  1ZJN A;  1JQR A;  5HC9 A;  4X4O A;  4RT3 A;  7ICS A;  4P2H A;  3UQ0 A;  4ATB B;  4KLS A;  8ICL A;  4EBK A;  8ICC A;  4RQ2 A;  4WC0 A;  5J0X A;  4YCX A;  1R8B A;  3JPS A;  2BE3 A;  1BPZ A;  3MDC A;  5J0S A;  1HUO A;  9ICW A;  7ICT A;  5F2V O;  4QZA A;  5DB7 A;  1PX5 A;  4QZH A;  4XUS A;  9ICG A;  1ZQH A;  1R8A A;  4UB4 A;  3UPQ A;  1ZJM A;  4RQ4 A;  3UQ2 A;  1BPX A;  4I27 A;  3RJI A;  2I9G A;  3H3A A;  8ICY A;  2BPC A;  9ICH A;  4X4T A;  4TUS A;  5J29 A;  2DVI A;  5D49 A;  5J2K A;  3JYY A;  4RPZ A;  1ZQQ A;  4KLH A;  2RFF A;  4I2J A;  5CWR A;  4NKU A;  7ICJ A;  8ICG A;  2PFN A;  4UB2 A;  7ICI A;  3JPT A;  4UB3 A;  4AT8 A;  9ICL A;  1VFG A;  9ICB A;  3RJG A;  4M9N A;  5J0U A;  4PHE A;  3MDA A;  4MF2 A;  5J2B A;  5DB8 A;  1ZQY A;  4KLD A;  9ICT A;  4PHA A;  5J0O A;  4EP7 A;  7ICV A;  2BCV A;  1JMS A;  4KLJ A;  4TUP A;  4WBZ A;  5D46 A;  1XSP A;  5III A;  4I2E A;  4WC7 A;  5J0P A;  1TV9 A;  1ZQB A;  4WC1 A;  3MGH A;  1R89 A;  3RJK A;  5CR0 A;  4GXJ A;  4M2Y A;  3JZ0 A;  3RH5 A;  2DR5 A;  4RPX A;  5HRK A;  7ICH A;  7ICL A;  5HR9 A;  3HW8 A;  8ICT A;  5DKW A;  3UPS A;  4MFC A;  5IIM A;  1ZQZ A;  4F5P A;  2IHM A;  1NO5 A;  3HJ4 A;  1MQ3 A;  7ICM A;  1ZQG A;  9ICF A;  2ZHA A;  4NY8 A;  3HIY A;  4M9J A;  1XSN A;  2ZH3 A;  4LT6 A;  5CP2 A;  1KNY A;  3OV7 A;  5DDM A;  5HRI A;  9ICE A;  8ICS A;  1ZQE A;  5J2E A;  7ICG A;  8ICI A;  5DEC A;  4QZG A;  1MIW A;  4FH5 A;  4X4R A;  4UD4 A;  4UBB A;  1MQ2 A;  4MFF A;  3TFS A;  3C2K A;  3HJ1 A;  5IIK A;  4WC4 A;  4EBJ A;  5J2C A;  9ICO A;  4IQU A;  1WOT A;  4NXZ A;  4X0A A;  2W9M A;  4X4P A;  4IQW A;  4M47 A;  4PGY A;  1ZQA A;  4O5E A;  4KLQ A;  1UET A;  4K4H A;  1ZQO A;  4UBC A;  1ZQU A;  1ZQR A;  3AQM A;  2ZH4 A;  4DOC A;  8ICQ A;  2M2V A;  4I2G A;  3V7L A;  2PBE A;  3PMN A;  4UAZ A;  2ZH8 A;  3UXP A;  2BCU A;  3RH6 A;  1UEU A;  4PHP A;  5J2I A;  4FHV A;  2P66 A;  4I2D A;  1ZQS A;  5J0T A;  4F5Q A;  3C18 A;  7ICR A;  5J2J A;  2PFP A;  3GDX A;  4Z6C A;  1BPB A;  3ISD A;  7ICP A;  3AQN A;  4YN4 A;  4KLE A;  3UXN A;  8ICN A;  2PXI A;  2O5A A;  4RQ0 A;  3C2L A;  4I2C A;  5J2D A;  4KLO A;  3WFR E;  2ZH2 A;  4WCW A;  5J2G A;  9ICK A;  3WFS C;  8ICF A;  4UAY A;  3V7J A;  2BCS A;  2DRA A;  3OGU A;  4M5D A;  4WC6 A;  4P4P A;  2BCQ A;  5TZV A;  5J0R A;  3MBY A;  4KLT A;  4KLG A;  4XA5 A;  2BPG A;  4I2I A;  4FHX A;  4RT2 A;  3ISB A;  4DO9 A;  3RH4 A;  4PPX A;  4NM1 A;  4I28 A;  3JPO A;  4R64 A;  4UD5 A;  4FHW A;  4LZG A;  5BPC A;  1KDH A;  3C2M A;  4TUQ A;  2M2W A;  5DDY A;  2ISO A;  3RJJ A;  4M04 A;  4M9L A;  5BOL A;  1RPL A;  8ICW A;  2HHP A;  1Q79 A;  1ZQL A;  4YMO A;  4X4Q A;  4GXK A;  3RJE A;  9ICV A;  1OU5 A;  5DB6 A;  4FHY A;  4LZD A;  4X4N A;  2ZH5 A;  4X4S A;  4KLM A;  4WC3 A;  8ICR A;  4F5O A;  3C5G A;  3MGI A;  8ICA A;  1R8C A;  4K4I A;  1XSL A;  1KEJ A;  9ICX A;  4RWQ A;  8ICX A;  3H38 A;  5CJ7 A;  2GWS A;  3WFO A;  3NYB A;  4RPY A;  5HRF A;  1VJ7 A;  1ZQT A;  4IQT A;  3AU2 A;  8ICH A;  1BPD A;  5HRB A;  1TFW A;  2VAN A;  4M9H A;  3TFR A;  4E80 A;  4PHD A;  4O5C A;  2FMQ A;  4FH3 A;  5HRG A;  3OUY A;  1ZQN A;  3AQL A;  4YD1 A;  4AT7 A;  5DB9 A;  3ISC A;  5J0Q A;  5DBC A;  4GXI A;  4F5N A;  4P4O A;  1Q78 A;  4X5V A;  4R63 A;  5DED A;  4XQ8 A;  3JPQ A;  3OVB A;  4FO6 A;  1ZQF A;  7ICO A;  4WC5 A;  3PNC A;  4X4V A;  3C66 A;  8ICZ A;  3AU6 A;  4Z6D A;  1ZQJ A;  5CA7 A;  5BOM A;  4PH5 A;  4QZD A;  1BPY A;  2PFQ A;  9ICS A;  4R65 A;  3OVA A;  3AUO A;  1ZQP A;  4AT9 A;  4E8F A;  9ICP A;  3OVS A;  3JPN A;  7ICK A;  1UEV A;  2NRK A;  4RQ8 A;  2ZH6 A;  4O9M A;  4M9G A;  5CB1 A;  2BCR A;  3V7K A;  4NKT A;  1F5A A;  4XRH A;  5IIL A;  4WBY A;  5J2F A;  5HRH A;  4KLL A;  4I2A A;  8ICK A;  3B0Y A;  8ICU A;  4I2H A;  4JWM A;  4Z6F A;  2ISP A;  4IG8 A;  4I2F A;  3H39 A;  4NLK A;  3LQC B;  8ICE A;  3OUY B;  4LVS A;  2DRB A;  4QZC A;  4AT7 B;  2ZH9 A;  2BPF A;  3RJH A;  3C5F A;  4I29 A;  5HRD A;  2M2U A;  4E7X A;  1TVA A;  1RZT A; 
#chains in the Genus database with same CATH topology
 1ZQC A;  4RQ7 A;  4P4M A;  4MF8 A;  2ZH7 A;  5EOZ A;  1ZQM A;  4S3N A;  5D62 A;  2IUB A;  7ICE A;  3L9D A;  4YMN A;  9ICI A;  5D63 A;  1FA0 A;  1BPE A;  7ICU A;  4UB5 A;  4Z6E A;  4QZI A;  3JPP A;  5DBB A;  4K4G A;  9ICR A;  4XQ7 A;  5HHH A;  4K9B A;  1ZQD A;  5J2A A;  4K8V A;  1ZQX A;  3AQK A;  4O68 A;  8ICB A;  3HWT A;  4IQV A;  4R66 A;  5HHI A;  1JAJ A;  4MFA A;  4AT9 B;  3LK9 A;  2M2T A;  1ZQI A;  3B0X A;  4PGX A;  9ICC A;  3NKU A;  4RQ6 A;  4RQ1 A;  4K96 A;  9ICJ A;  1ZQK A;  3HX0 A;  1V4A A;  5IIO A;  4UAW A;  8ICV A;  4ATB A;  5DBA A;  4DOB A;  7ICQ A;  3PHZ A;  2ZHB A;  3NWI A;  5HRE A;  3RJF A;  1ZQV A;  8ICO A;  4RWP A;  2PFO A;  9ICQ A;  5J2H A;  4YMM A;  4RQ3 A;  4UB1 A;  3CK6 A;  2ZH1 A;  8ICM A;  4RWO A;  4YD2 A;  1MIY A;  4M0A A;  9ICU A;  1MIV A;  4DOA A;  4KLI A;  3K75 D;  4KLF A;  4QZF A;  2DR7 A;  9ICN A;  7ICN A;  4NLN A;  1JN3 A;  4O69 A;  5HRL A;  4EV6 A;  4QZB A;  4QZ9 A;  8ICP A;  3H37 A;  4X4U A;  3V72 A;  1TFY A;  4WC2 A;  4OAI Z;  4OAG A;  4QZE A;  1HUZ A;  3WFQ E;  4PGQ A;  1YLQ A;  4TUR A;  3MCR A;  4QZ8 A;  2FMS A;  2DR8 A;  3JPR A;  5J0Y A;  4KB6 A;  4NLZ A;  4KLU A;  4NM2 A;  4I2B A;  3WFP A;  5CHG A;  2O1P A;  4AT8 B;  5J0W A;  4X0B A;  4RQ5 A;  3NVO A;  1ZQW A;  2DR9 A;  2FMP A;  4JWN A;  2ID1 A;  7ICF A;  9ICM A;  5IIJ A;  8ICJ A;  3ERC C;  4FHP A;  4RWN A;  5IIN A;  5D4B A;  3PML A;  4O5K A;  2Q66 A;  9ICA A;  1NOM A;  4F5R A;  3UXO A;  1ZJN A;  1JQR A;  5HC9 A;  4X4O A;  4RT3 A;  7ICS A;  4P2H A;  3UQ0 A;  4ATB B;  4KLS A;  8ICL A;  4EBK A;  8ICC A;  4RQ2 A;  4WC0 A;  5J0X A;  4YCX A;  1R8B A;  4OAF A;  3JPS A;  2BE3 A;  1BPZ A;  3MDC A;  5J0S A;  1HUO A;  9ICW A;  7ICT A;  3JCF A;  5F2V O;  4QZA A;  5DB7 A;  1PX5 A;  5JTG A;  4QZH A;  4XUS A;  9ICG A;  1ZQH A;  1R8A A;  4UB4 A;  3UPQ A;  1ZJM A;  4RQ4 A;  1RZT A;  3UQ2 A;  1BPX A;  4I27 A;  3RJI A;  2I9G A;  3H3A A;  8ICY A;  2BPC A;  4K98 A;  4X4T A;  9ICH A;  4TUS A;  4NXT A;  5J29 A;  2DVI A;  5D49 A;  4K99 A;  5J2K A;  3JYY A;  4EED A;  4RPZ A;  1ZQQ A;  4KLH A;  2RFF A;  4I2J A;  5CWR A;  4NKU A;  7ICJ A;  8ICG A;  2PFN A;  4UB2 A;  7ICI A;  4I0U A;  3JPT A;  4UB3 A;  4AT8 A;  9ICL A;  1VFG A;  9ICB A;  4NXX A;  3RJG A;  4M9N A;  5J0U A;  4PHE A;  3MDA A;  4MF2 A;  5J2B A;  5DB8 A;  1ZQY A;  4KLD A;  9ICT A;  4PHA A;  5J0O A;  4EP7 A;  7ICV A;  2IHO A;  2BCV A;  1JMS A;  4KLJ A;  4TUP A;  4WBZ A;  5D46 A;  1XSP A;  5III A;  4I2E A;  4WC7 A;  5J0P A;  1TV9 A;  1ZQB A;  4WC1 A;  3MGH A;  1R89 A;  5D61 A;  3RJK A;  5CR0 A;  4GXJ A;  4M2Y A;  3JZ0 A;  3RH5 A;  2DR5 A;  4RPX A;  5HRK A;  7ICH A;  2BBH A;  7ICL A;  5HR9 A;  3HW8 A;  8ICT A;  5DKW A;  3UPS A;  4MFC A;  5IIM A;  1ZQZ A;  4JLZ A;  4F5P A;  2IHM A;  1NO5 A;  3HJ4 A;  1MQ3 A;  7ICM A;  1ZQG A;  9ICF A;  2ZHA A;  4NY8 A;  3HIY A;  4M9J A;  1XSN A;  2ZH3 A;  4LT6 A;  5CP2 A;  1KNY A;  3ER8 C;  3OV7 A;  5DDM A;  5HRI A;  9ICE A;  2GAF D;  8ICS A;  1ZQE A;  5J2E A;  7ICG A;  8ICI A;  5DEC A;  4QZG A;  1MIW A;  4FH5 A;  4X4R A;  4UD4 A;  4UBB A;  1MQ2 A;  5B3Q A;  4MFF A;  3TFS A;  3C2K A;  3HJ1 A;  5IIK A;  4WC4 A;  4EBJ A;  5J2C A;  9ICO A;  4IQU A;  1WOT A;  4NXZ A;  4X0A A;  2W9M A;  4X4P A;  4IQW A;  4M47 A;  4FO1 A;  4PGY A;  1ZQA A;  4O5E A;  4KLQ A;  1UET A;  4K4H A;  1ZQO A;  4UBC A;  1ZQU A;  1ZQR A;  4WOY A;  3AQM A;  2ZH4 A;  4DOC A;  8ICQ A;  2M2V A;  4I2G A;  3V7L A;  2PBE A;  3PMN A;  4UAZ A;  2ZH8 A;  3UXP A;  2BCU A;  3RH6 A;  1UEU A;  4PHP A;  5J2I A;  4LEW A;  4FHV A;  2P66 A;  4I2D A;  1ZQS A;  5J0T A;  4F5Q A;  3C18 A;  7ICR A;  5J2J A;  2PFP A;  3GDX A;  4Z6C A;  1BPB A;  3ISD A;  7ICP A;  3AQN A;  4YN4 A;  2B4V A;  4KLE A;  3UXN A;  4LEY A;  8ICN A;  2PXI A;  2O5A A;  4RQ0 A;  3C2L A;  4I2C A;  5J2D A;  4KLO A;  3WFR E;  2ZH2 A;  4WCW A;  5B3P A;  5J2G A;  9ICK A;  3WFS C;  8ICF A;  3OWG A;  4UAY A;  3V7J A;  2BCS A;  2DRA A;  3OGU A;  4M5D A;  4WC6 A;  4P4P A;  2BCQ A;  5TZV A;  5J0R A;  3MBY A;  4KLT A;  4KLG A;  2BBJ A;  4XA5 A;  2BPG A;  4I2I A;  4FHX A;  4RT2 A;  3ISB A;  4DO9 A;  4WH5 A;  3RH4 A;  4PPX A;  4NM1 A;  4I28 A;  3JPO A;  4R64 A;  4UD5 A;  4FHW A;  4LZG A;  5BPC A;  1KDH A;  3C2M A;  4TUQ A;  4HX0 A;  2M2W A;  4N7R A;  5DDY A;  2ISO A;  3RJJ A;  4M04 A;  4M9L A;  4O6A A;  4MKP A;  5BOL A;  1RPL A;  8ICW A;  2HHP A;  1Q79 A;  1ZQL A;  4NXU A;  1GPJ A;  4YMO A;  2B56 A;  4X4Q A;  4GXK A;  3RJE A;  2HN2 A;  9ICV A;  1OU5 A;  4OAH A;  4FHY A;  4WQK A;  5DB6 A;  4LZD A;  4X4N A;  2ZH5 A;  4KM5 A;  4X4S A;  4KLM A;  4WC3 A;  8ICR A;  5CFS A;  3ER9 B;  4F5O A;  3C5G A;  3MGI A;  8ICA A;  1R8C A;  4K4I A;  1XSL A;  1KEJ A;  4JLX A;  9ICX A;  4RWQ A;  8ICX A;  3H38 A;  5CJ7 A;  2GWS A;  3WFO A;  3NYB A;  4RPY A;  5HRF A;  1VJ7 A;  1ZQT A;  4IQT A;  3AU2 A;  8ICH A;  4LEV A;  1BPD A;  5HRB A;  4WQL A;  1TFW A;  2VAN A;  4M9H A;  3TFR A;  4E80 A;  2GA9 D;  4PHD A;  4O5C A;  2FMQ A;  4FH3 A;  5HRG A;  4EGW A;  2FCL A;  3OUY A;  1ZQN A;  3AQL A;  4YD1 A;  4AT7 A;  5DB9 A;  3ISC A;  5J0Q A;  5DBC A;  4GXI A;  4F5N A;  4P4O A;  1Q78 A;  4X5V A;  4R63 A;  5DED A;  4XQ8 A;  5CFU A;  3JPQ A;  3OVB A;  4FO6 A;  1ZQF A;  7ICO A;  4WC5 A;  4NXV A;  3PNC A;  4X4V A;  3C66 A;  4K97 A;  3K7D A;  8ICZ A;  3AU6 A;  4Z6D A;  1ZQJ A;  3EF2 A;  5CA7 A;  4K9A A;  5BOM A;  4PH5 A;  4QZD A;  1BPY A;  2PFQ A;  9ICS A;  4R65 A;  3OVA A;  3AUO A;  1ZQP A;  4AT9 A;  4E8F A;  9ICP A;  3OVS A;  3JPN A;  2B51 A;  7ICK A;  1UEV A;  2NRK A;  4RQ8 A;  2ZH6 A;  4O9M A;  4M9G A;  5CB1 A;  2BCR A;  3V7K A;  4NKT A;  4XJE A;  1F5A A;  4XRH A;  5IIL A;  4WBY A;  5J2F A;  5HRH A;  4KLL A;  4I2A A;  8ICK A;  3B0Y A;  4EEB A;  8ICU A;  4O67 A;  4I2H A;  2HN1 A;  4JWM A;  4Z6F A;  5CFT A;  2ISP A;  4LEZ A;  4IG8 A;  4I2F A;  3H39 A;  4NLK A;  3LQC B;  8ICE A;  3OUY B;  4LVS A;  2DRB A;  5CHE A;  4QZC A;  4AT7 B;  2ZH9 A;  2BPF A;  3RJH A;  3C5F A;  4I29 A;  2EWR A;  5HRD A;  2M2U A;  4E7X A;  1TVA A;  4NXW A; 
#chains in the Genus database with same CATH homology
 1ZQC A;  4RQ7 A;  4P4M A;  4MF8 A;  2ZH7 A;  5EOZ A;  1ZQM A;  4S3N A;  7ICE A;  3L9D A;  4YMN A;  9ICI A;  1FA0 A;  1BPE A;  7ICU A;  4UB5 A;  4Z6E A;  4QZI A;  3JPP A;  5DBB A;  4K4G A;  9ICR A;  4XQ7 A;  5HHH A;  1ZQD A;  5J2A A;  1ZQX A;  3AQK A;  8ICB A;  3HWT A;  4IQV A;  4R66 A;  5HHI A;  1JAJ A;  4MFA A;  4AT9 B;  3LK9 A;  2M2T A;  1ZQI A;  3B0X A;  4PGX A;  9ICC A;  4RQ6 A;  4RQ1 A;  9ICJ A;  1ZQK A;  3HX0 A;  1V4A A;  5IIO A;  4UAW A;  8ICV A;  4ATB A;  5DBA A;  4DOB A;  7ICQ A;  2ZHB A;  5HRE A;  3RJF A;  1ZQV A;  8ICO A;  4RWP A;  2PFO A;  5J2H A;  4YMM A;  4RQ3 A;  4UB1 A;  2ZH1 A;  8ICM A;  4RWO A;  4YD2 A;  1MIY A;  4M0A A;  9ICU A;  1MIV A;  4DOA A;  4KLI A;  3K75 D;  4KLF A;  4QZF A;  2DR7 A;  9ICN A;  7ICN A;  4NLN A;  1JN3 A;  5HRL A;  4QZB A;  4QZ9 A;  8ICP A;  3H37 A;  4X4U A;  3V72 A;  1TFY A;  4WC2 A;  4QZE A;  1HUZ A;  3WFQ E;  4PGQ A;  1YLQ A;  4TUR A;  4QZ8 A;  2FMS A;  2DR8 A;  3JPR A;  5J0Y A;  4NLZ A;  4KLU A;  4NM2 A;  4I2B A;  3WFP A;  5CHG A;  2O1P A;  4AT8 B;  5J0W A;  4X0B A;  4RQ5 A;  4JWN A;  1ZQW A;  2DR9 A;  2FMP A;  7ICF A;  2ID1 A;  9ICM A;  9ICQ A;  5IIJ A;  8ICJ A;  4FHP A;  4RWN A;  5IIN A;  5D4B A;  3PML A;  4O5K A;  2Q66 A;  9ICA A;  1NOM A;  4F5R A;  3UXO A;  1ZJN A;  1JQR A;  5HC9 A;  4X4O A;  4RT3 A;  7ICS A;  4P2H A;  3UQ0 A;  4ATB B;  4KLS A;  8ICL A;  4EBK A;  8ICC A;  4RQ2 A;  4WC0 A;  5J0X A;  4YCX A;  1R8B A;  3JPS A;  2BE3 A;  1BPZ A;  3MDC A;  5J0S A;  1HUO A;  9ICW A;  7ICT A;  5F2V O;  4QZA A;  5DB7 A;  1PX5 A;  4QZH A;  4XUS A;  9ICG A;  1ZQH A;  1R8A A;  4UB4 A;  3UPQ A;  1ZJM A;  4RQ4 A;  3UQ2 A;  1BPX A;  4I27 A;  3RJI A;  2I9G A;  3H3A A;  8ICY A;  2BPC A;  9ICH A;  4X4T A;  4TUS A;  5J29 A;  2DVI A;  5D49 A;  5J2K A;  3JYY A;  4RPZ A;  1ZQQ A;  4KLH A;  2RFF A;  4I2J A;  5CWR A;  4NKU A;  7ICJ A;  8ICG A;  2PFN A;  4UB2 A;  7ICI A;  3JPT A;  4UB3 A;  4AT8 A;  9ICL A;  1VFG A;  9ICB A;  3RJG A;  4M9N A;  5J0U A;  4PHE A;  3MDA A;  4MF2 A;  5J2B A;  5DB8 A;  1ZQY A;  4KLD A;  9ICT A;  4PHA A;  5J0O A;  4EP7 A;  7ICV A;  2BCV A;  1JMS A;  4KLJ A;  4TUP A;  4WBZ A;  5D46 A;  1XSP A;  5III A;  4I2E A;  4WC7 A;  5J0P A;  1TV9 A;  1ZQB A;  4WC1 A;  3MGH A;  1R89 A;  3RJK A;  5CR0 A;  4GXJ A;  4M2Y A;  3JZ0 A;  3RH5 A;  2DR5 A;  4RPX A;  5HRK A;  7ICH A;  7ICL A;  5HR9 A;  3HW8 A;  8ICT A;  5DKW A;  3UPS A;  4MFC A;  5IIM A;  1ZQZ A;  4F5P A;  2IHM A;  1NO5 A;  3HJ4 A;  1MQ3 A;  7ICM A;  1ZQG A;  9ICF A;  2ZHA A;  4NY8 A;  3HIY A;  4M9J A;  1XSN A;  2ZH3 A;  4LT6 A;  5CP2 A;  1KNY A;  3OV7 A;  5DDM A;  5HRI A;  9ICE A;  8ICS A;  1ZQE A;  5J2E A;  7ICG A;  8ICI A;  5DEC A;  4QZG A;  1MIW A;  4FH5 A;  4X4R A;  4UD4 A;  4UBB A;  1MQ2 A;  4MFF A;  3TFS A;  3C2K A;  3HJ1 A;  5IIK A;  4WC4 A;  4EBJ A;  5J2C A;  9ICO A;  4IQU A;  1WOT A;  4NXZ A;  4X0A A;  2W9M A;  4X4P A;  4IQW A;  4M47 A;  4PGY A;  1ZQA A;  4O5E A;  4KLQ A;  1UET A;  4K4H A;  1ZQO A;  4UBC A;  1ZQU A;  1ZQR A;  3AQM A;  2ZH4 A;  4DOC A;  8ICQ A;  2M2V A;  4I2G A;  3V7L A;  2PBE A;  3PMN A;  4UAZ A;  2ZH8 A;  3UXP A;  2BCU A;  3RH6 A;  1UEU A;  4PHP A;  5J2I A;  4FHV A;  2P66 A;  4I2D A;  1ZQS A;  5J0T A;  4F5Q A;  3C18 A;  7ICR A;  5J2J A;  2PFP A;  3GDX A;  4Z6C A;  1BPB A;  3ISD A;  7ICP A;  3AQN A;  4YN4 A;  4KLE A;  3UXN A;  8ICN A;  2PXI A;  2O5A A;  4RQ0 A;  3C2L A;  4I2C A;  5J2D A;  4KLO A;  3WFR E;  2ZH2 A;  4WCW A;  5J2G A;  9ICK A;  3WFS C;  8ICF A;  4UAY A;  3V7J A;  2BCS A;  2DRA A;  3OGU A;  4M5D A;  4WC6 A;  4P4P A;  2BCQ A;  5TZV A;  5J0R A;  3MBY A;  4KLT A;  4KLG A;  4XA5 A;  2BPG A;  4I2I A;  4FHX A;  4RT2 A;  3ISB A;  4DO9 A;  3RH4 A;  4PPX A;  4NM1 A;  4I28 A;  3JPO A;  4R64 A;  4UD5 A;  4FHW A;  4LZG A;  5BPC A;  1KDH A;  3C2M A;  4TUQ A;  2M2W A;  5DDY A;  2ISO A;  3RJJ A;  4M04 A;  4M9L A;  5BOL A;  1RPL A;  8ICW A;  2HHP A;  1Q79 A;  1ZQL A;  4YMO A;  4X4Q A;  4GXK A;  3RJE A;  9ICV A;  1OU5 A;  5DB6 A;  4FHY A;  4LZD A;  4X4N A;  2ZH5 A;  4X4S A;  4KLM A;  4WC3 A;  8ICR A;  4F5O A;  3C5G A;  3MGI A;  8ICA A;  1R8C A;  4K4I A;  1XSL A;  1KEJ A;  9ICX A;  4RWQ A;  8ICX A;  3H38 A;  5CJ7 A;  2GWS A;  3WFO A;  3NYB A;  4RPY A;  5HRF A;  1VJ7 A;  1ZQT A;  4IQT A;  3AU2 A;  8ICH A;  1BPD A;  5HRB A;  1TFW A;  2VAN A;  4M9H A;  3TFR A;  4E80 A;  4PHD A;  4O5C A;  2FMQ A;  4FH3 A;  5HRG A;  3OUY A;  1ZQN A;  3AQL A;  4YD1 A;  4AT7 A;  5DB9 A;  3ISC A;  5J0Q A;  5DBC A;  4GXI A;  4F5N A;  4P4O A;  1Q78 A;  4X5V A;  4R63 A;  5DED A;  4XQ8 A;  3JPQ A;  3OVB A;  4FO6 A;  1ZQF A;  7ICO A;  4WC5 A;  3PNC A;  4X4V A;  3C66 A;  8ICZ A;  3AU6 A;  4Z6D A;  1ZQJ A;  5CA7 A;  5BOM A;  4PH5 A;  4QZD A;  1BPY A;  2PFQ A;  9ICS A;  4R65 A;  3OVA A;  3AUO A;  1ZQP A;  4AT9 A;  4E8F A;  9ICP A;  3OVS A;  3JPN A;  7ICK A;  1UEV A;  2NRK A;  4RQ8 A;  2ZH6 A;  4O9M A;  4M9G A;  5CB1 A;  2BCR A;  3V7K A;  4NKT A;  1F5A A;  4XRH A;  5IIL A;  4WBY A;  5J2F A;  5HRH A;  4KLL A;  4I2A A;  8ICK A;  3B0Y A;  8ICU A;  4I2H A;  4JWM A;  4Z6F A;  2ISP A;  4IG8 A;  4I2F A;  3H39 A;  4NLK A;  3LQC B;  8ICE A;  3OUY B;  4LVS A;  2DRB A;  4QZC A;  4AT7 B;  2ZH9 A;  2BPF A;  3RJH A;  3C5F A;  4I29 A;  5HRD A;  2M2U A;  4E7X A;  1TVA A;  1RZT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...