4M47A

Structure of human dna polymerase complexed with 8-brg in the template base paired with incoming non-hydrolyzable gtp
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
324
structure length
314
Chain Sequence
b'NGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title Structural basis for promutagenicity of 8-halogenated Guanine.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
total genus 104
structure length 314
sequence length 324
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4m47A02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4m47A01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4m47A04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4m47A03
5KFAA 4WCWA 5KFUA 5CA7A 2ZTEA 4ECTA 2C2RA 5J29A 3RJHA 2UVUA 4KLFA 5KG5A 5BOMA 4PGQA 5KFHA 4F92B 4IQVA 4QZDA 5DQGA 1TKDA 2BDPA 4XA5A 3AQNA 4FH3A 3H8JA 3ZDEA 4QW9A 2HHWA 4JUZA 9ICTA 4AT8A 5HRBA 3ORYA 4M9JA 4KLMA 5DQIA 4R64A 2UVRA 4B9MA 3RH4A 2IHMA 4DFMA 8ICTA 5HC9A 3TAQA 5J0UA 4YP3A 3H39A 1Z00A 1NK9A 1BVSA 2ATLA 4RPXA 4DQSA 1WCLA 1RZTA 7ICUA 9ICVA 3GIMA 3V72A 2BCSA 4QZ8A 1F5AA 5J0OA 4PH5A 1U47A 3C18A 3WFSC 5DEDA 4KLSA 5HRHA 5DG8A 3GILA 4Q45A 4FHPA 5DQHA 4Q8FA 4M6WB 3MFIA 1XU4A 3Q8SB 4UD5A 1ZQVA 2I1QA 3C23A 4KN7A 4KLJA 1MIVA 3TARA 1TFWA 4B9SA 4PGXA 1SKWA 1QTMA 4IRKA 4YD1A 3N97B 4DL7A 1WCNA 3QZ8A 3RBDA 2DPIA 5IIIA 3C21A 3C1YA 4EYIB 4DL2A 4E80A 3AQLA 1BPBA 1XSNA 1TFRA 2GWSA 2Y1JA 2W9CA 1ZQNA 4ED2A 4QZBA 4B9NA 3HJ1A 4RQ2A 4TQRA 1ZQWA 3OJSA 1S9FA 2Q66A 3C2KA 3ISBA 4F8RA 4KLEA 4FHVA 3V6JA 1R8CA 5KFJA 1KRPA 5KFIA 3AQMA 3H8SA 4KLHA 3IHQB 5DGBA 3HWTA 1BPZA 5DG9A 4AT9A 9ICCA 4X4VA 1QLNA 2ZTDA 3WFOA 2XC9A 4K4GA 4M9HA 4I2AA 4F2RA 1R89A 4RNMA 3HT3A 4FS1A 3GIKA 3RAQA 1X9WA 2AQ0A 5KFMA 4AT7A 4X4TA 1JXEA 2XY5A 4ATBA 3KTQA 3WFQE 4B9TA 4F4ZA 5DGAA 1NK5A 1T8EA 3IM1A 1ZQXA 9ICFA 1RYRA 1ZQOA 4WC1A 2ZH8A 4C8MA 2RDIA 1TV9A 3RBEA 4YXMA 3NTUA 3EYZA 3AUOA 3OUYB 4RQ5A 3Q8LA 1UEUA 3RH6A 4FH5A 4YCXA 3PX0A 2VA3A 3OV7A 3OSNA 4BXOB 4Q8EA 1MIYA 5C5JA 1ZQHA 4JV2A 2HHQA 2AQ4A 2DR9A 3EW9A 2ZJ5A 2BQRA 1UA1A 2HHUA 2BHNA 1ZQQA 4UAYA 3HP6A 7ICVA 8ICYA 1H38A 2ISOA 1CEZA 4LT6A 4HYKA 5CWRA 4J9MA 4O5KA 2OWOA 3JPOA 3GV7B 2KFNA 1UETA 3GFKB 4DFKA 5J2EA 2BQUA 5HR9A 3PW2A 1DK2A 5KFZA 1JX4A 3C1ZA 5KFVA 9ICSA 7ICJA 4YMNA 3RJKA 4IQWA 1T3NA 2VA2A 5DDMA 2XGQA 2KZMA 3JPQA 4UBCA 4C8OA 4DSIA 2BGWA 9ICGA 1NK7A 1ZQLA 4F4YA 5J0YA 5D4BA 3GIIA 4QWDA 4ECSA 3RRGA 5HRFA 4XUSA 4MF2A 3MBYA 3T5LA 4DSFA 2ISPA 2R8HA 5KFRA 5KFOA 4EBEA 4AT8B 4MFFA 1SL2A 2DR7A 4WC3A 2C2EA 4UB1A 4IQTA 3LK9A 2HHXA 3EZ5A 2P66A 1NO5A 4F5OA 1L3SA 5KT5A 5KFXA 4EBDA 3OSPA 2DR8A 1MSWD 5F2VO 4ED0A 4PHAA 4GLXA 5KTQA 2DRBA 4M47A 5KFYA 1B22A 1V4AA 2P6RA 3PW4A 3PX6A 5J0SA 2NRXA 4YMOA 1ZQJA 4NM2A 1VJ7A 1KFSA 1RYSA 3L9DA 4M9NA 3M9OB 3PV8A 4I2IA 4UB5A 1TAUA 2ZH2A 3SV4A 1U9LA 5J2DA 4FS2A 4PGYA 2XCPA 2RDJA 4CCHA 5HRDA 5KG7A 2J6SA 4I2BA 3JPSA 3AU2A 4RNOA 3KHHA 2W9CB 3T5JA 4RWPA 9ICKA 4YFKA 2ZTCA 8ICMA 4ED7A 5HRGA 3RAXA 4NLZA 2F1HA 4RQ3A 4R63A 4DSEA 4F3OA 3RB4A 3T5HA 8ICGA 4JWMA 2O1PA 3ZD8A 1JMSA 3BQTA 5J0RA 5KG3A 4EEYA 3T3FA 1NK6A 3JPRA 2FLPA 5KT3A 5KT4A 4I2EA 9ICUA 8ICKA 1XWLA 4RQ7A 2UVWA 4QWAA 4DOCA 1HUOA 5L1KA 4J9QA 4QZ9A 3JPNA 4GXIA 2F1JA 1NJYA 5DDYA 1ZQCA 1R8BA 1S10A 4YXJA 4AT7B 2PI5A 5EWFA 4QWBA 2W8KA 1A77A 2ALZA 4YQWA 4MFAA 5KG2A 4ECZA 3RB3A 1NKBA 4DS5A 5D49A 2BCRA 2BCQA 4M9LA 4O5CA 4O5EA 3MR6A 2NRKA 1D8LA 5DBBA 9ICAA 3ETLA 1ZQKA 4G3IA 5TZVA 5KFQA 4Z6DA 1U49A 4J9SA 8ICVA 3ZDBA 3M8SA 4YR2A 4RQ1A 4YR3A 3TI0A 3OGUA 3LWMA 3MFHA 3RH5A 4E0DA 4Z6FA 5KFCA 2FPLA 4DF4A 4F4KA 4KLLA 4YMMA 2NRZA 4ECXA 1ZQFA 7ICGA 4O3NA 3WFPA 2PFQA 2R8GA 5KFLA 3NGDA 1DK3A 2PFPA 5J2AA 3B0YA 4Q44A 2IMWP 1TK0A 4R8UA 8ICQA 2ZH5A 1RXWA 4TUSA 5KFPA 4UD4A 4KLTA 3PNCA 4RQ0A 4ECRA 4B9VA 3GV8B 1COOA 3PW7A 1S0VA 2ID1A 4JWNA 4I2DA 3MR3A 3M9MB 2MAXA 1ZQUA 4O3PA 2AGOA 2JEIA 7ICLA 1LB2B 4I29A 5KFDA 4F2SA 4NY8A 3UXOA 3RJGA 1MIWA 2W9BA 3JZ0A 2VANA 9ICWA 3OVBA 1ZQTA 4QZHA 4O3RA 4JV1A 3M9NB 5HHHA 4IQUA 3QZ7A 2WTFA 4M2YA 3LWLA 3BQ0A 2I9GA 4XQ8A 1BPYA 9ICOA 4WBYA 4EZ6A 4IG8A 4P2HA 1BNPA 4KITB 3HW8A 4ED8A 4I2FA 5D46A 4MEYA 2BCVA 4RWNA 4F4WA 4GC6A 4F5RA 2A1JA 9ICIA 4S3NA 2XY6A 1UT5A 3M8RA 3ZDAA 4M0AA 2BPGA 4P4MA 4GC7A 3UPQA 2DVIA 2IA6A 1IM4A 1S0OA 4J9PA 3SV3A 5J2IA 5DKWA 8ICBA 1L3VA 1C7YA 4RUCA 1JQRA 4DEZA 3C5FA 3C2MA 5BOLA 3UQ0A 9ICMA 5IINA 5KFGA 1TVAA 5KFTA 3OJUA 5L1LA 1X9SA 3C2LA 4ECWA 1BPXA 2KP7A 1ZQBA 4XRHA 2ZH4A 4DOBA 4Z6CA 1QSLA 3Q8RB 1OU5A 2JEGA 5HMMA 2ZUBA 5KG4A 4ELUA 5EOZA 1NJZA 5J2KA 2ZH3A 9ICRA 4X4RA 3FYHA 5HMLA 4KN4A 3UPSA 2PFOA 4I2CA 4KLQA 4P4PA 4DFPA 4X4QA 2XGPA 7ICHA 3PY8A 1ZQIA 5J2HA 4I2HA 4UBBA 2HHVA 1AROP 3HJ4A 2P6UA 1U4BA 4EYHB 4J9LA 1S77D 3SI8A 1UA0A 5BPCA 5IILA 1KLNA 5KFFA 1Z00B 5J0TA 1NK0A 2C2DA 2FMPA 2BR0A 3PO5A 2ZJAA 3TFSA 4DO9A 4ECVA 5DLFA 1ZQRA 4NLGA 1NJWA 1L3TA 5HRKA 3RJFA 4I2JA 1NKCA 2UVVA 2MUTA 2IBKA 2V4QA 3G6XA 8ICSA 3MGHA 1SL0A 4WC0A 3T5KA 4M04A 4TUPA 5IIMA 1XS9D 2HW3A 4RQ4A 4RUAA 7ICEA 5DECA 1RXVA 1KFDA 2DFLA 5J0WA 1KDHA 5CJ7A 7ICKA 1JN3A 4RQ8A 4UAZA 4UB3A 1KEJA 4KLOA 2FPMA 3Q8QB 4R8UB 4DOAA 1ZQZA 4O9MA 7ICSA 3B0XA 4Q43A 1ZJMA 9ICJA 1R8AA 2W9AA 3OVAA 3WFRE 3HPOA 1Y88A 1XO1A 4BWJA 1KNYA 2NRWA 3AQKA 2V4RA 3EPIA 4F4XA 5KT7A 9ICPA 2V9WA 2DPJA 5KT6A 1UEVA 3TAPA 2BQ3A 1NK8A 1N48A 3JPPA 4J9NA 8ICIA 3UXNA 4O0IA 2BE3A 4ED3A 1TK8A 3ISDA 4AT9B 1JXLA 5DB9A 1T4GA 2DRAA 5CHGA 4ED6A 2HHPA 1TAQA 1X2IA 3PO4A 4KLUA 3RJEA 3Q8MA 2W9BB 2C22A 1BNOA 2PBEA 1XSPA 2AGQA 3MDAA 9ICLA 4X4PA 5JUMA 4QZGA 5KFSA 4JV0A 3MR2A 5IIJA 1ZQPA 2J6TA 1ZQDA 4ATBB 4WC4A 1PZNA 2ZUDA 5J0QA 4QZIA 1L5UA 8ICFA 4BWMA 5KG6A 5KFWA 3GQCA 5L1IA 4BDPA 2PI4A 2M2UA 2ZHAA 4R66A 4YN4A 3PX4A 4NXZA 5J2GA 3H40A 5DBCA 4DQIA 4NM1A 4QW8A 4NKTA 2M2TA 5HRIA 3OVSA 2A1JB 2PXIA 3SYZA 5HREA 3MR5A 4ECQA 4LZGA 4YR0A 5J0XA 4X4UA 3EWAA 4BGDA 3K4GA 4RWOA 7ICRA 2KZZA 4M9GA 9ICXA 1WOTA 1N56A 5J2JA 2FMSA 3RR7A 3E2EA 4NKUA 2ZHBA 3Q8PB 1T7PA 3KHRA 4X4SA 5DB8A 3QE9Y 1PX5A 2BKEA 4PHPA 2NRVA 2Y1IA 7ICIA 1XC9A 4DL3A 1MQ2A 2FPKA 5DB7A 4FO6A 2B21A 1NZPA 4RZRA 4E8FA 7ICTA 1ZETA 3PMNA 1MC8A 4I27A 4X0BA 4FHXA 4QZEA 4EBJA 5F9LA 4O3OA 5J0PA 4B9UA 4I28A 5KG1A 3QEAZ 4O3SA 8ICHA 5HRLA 9ICEA 1ZQGA 4KLGA 3NYBA 2W8LA 4YG2A 5HP4A 3RB6A 1K1SA 1HUZA 8ICRA 8ICCA 3ZD9A 4X4NA 4IR9A 4MFCA 3H4BA 2ZJ8A 1DGSA 1KSPA 2JEFA 3V7LA 3ZDDA 2XO7A 1QSYA 4M5DA 3C66A 2JZBA 3PR5B 4NLNA 7ICOA 3MGIA 4F5QA 1SL1A 4R65A 5L9XA 4J9KA 4PPXA 2AJQA 4WC6A 5KFEA 4O3QA 8ICPA 5DLGA 1NK4A 2ASLA 2MUTB 2FMQA 8ICWA 4EBCA 3RR8A 3RTVA 4E7XA 4F5NA 3PW5A 4UB2A 3HX0A 2RFFA 4KMUA 3UQ2A 4DFJA 4LZDA 5DG7A 1EXNA 2ASJA 4QZCA 2BCUA 4B9LA 2F1IA 9ICHA 5EWEA 2AU0A 1A76A 3BQ2A 4ELTA 2R8JA 4F91B 3EPGA 3LDAA 3LQCB 5L1JA 4ED1A 1K1QA 4XQ7A 9ICNA 4F5PA 4X0AA 4RWQA 3OHAA 1V9PA 1ZQMA 4EZ9A 7ICPA 4DQPA 3H38A 1ZQYA 4QWEA 1HJPA 1LV5A 5J2BA 5HHIA 1NKEA 3FDSA 1TFYA 3Q8KA 2BPFA 1D9FA 3H37A 3PW0A 2W9MA 2DR5A 8ICEA 3BQ1A 2KN7A 4C8LA 1ZQEA 5CP2A 1SKSA 1SZPA 9ICQA 4EP7A 1KTQA 5IIOA 4MEXA 8ICLA 3H7IA 7ICMA 4DL4A 4RU9A 1BGXT 3V7JA 4GXJA 1Q78A 4DLGA 4FBTA 4ZH4A 2R8KA 1Z3EB 5HNKA 5DB6A 5J2CA 3RRHA 1B43A 3TQ1A 3GIJA 1ZQAA 4IRCA 8ICOA 8ICNA 3MABA 4P4OA 1KFTA 2PFNA 4RNNA 4FHYA 5EWGA 3TANA 8ICAA 4J9OA 4M6WA 3TFRA 4WC5A 4K4HA 4UQGA 3GDXA 4K4IA 3V6KA 1SKRA 4WC2A 2M9NA 5IIKA 4TUQA 4KLIA 7ICFA 4ECYA 4UB4A 9ICBA 2JEJA 4MF8A 2KZ3A 4EBKA 2HVHA 4YVZA 3ZDCA 3BJYA 4IR1A 3JPTA 4DSLA 4Z6EA 4TURA 1U45A 3OHBA 5KT2A 2FLLA 4C8KA 5CB1A 2C28A 4ECUA 1XSLA 1D8YA 4I2GA 4DSJA 2LYHA 5F9NA 5DBAA 4QZFA 3BDPA 1FA0A 4KTQA 4PHDA 1ZQSA 4F50A 1MQ3A 2HHSA 3UXPA 2ZUCA 1UT8A 5KG0A 4LVSA 2J6UA 4DWIA 2KFZA 2HVIA 1NOMA 4DSKA 8ICZA 7ICQA 2ZH9A 4ELVA 3JYYA 4F93B 4GXKA 3H3AA 3KHGA 4RPZA 4DLEA 3PMLA 2HHTA 2M2VA 4RT2A 4FHWA 3K75D 1Q79A 1S0MA 4QZAA 2NRTA 2O5AA 4JK1A 2XY7A 1BPDA 2ASDA 3HIYA 8ICUA 3V6HA 4YD2A 4PHEA 2AGPA 3MDCA 1JIHA 4RT3A 5KFKA 3SZ2A 4DS4A 4FBUA 3C5GA 4X5VA 1S76D 1D9DA 4C8NA 3H8WA 1VFGA 3AU6A 1TK5A 3OUYA 4RPYA 1BPEA 2VA8A 2IHNA 2JZBB 1CUKA 3G6VA 4TQSA 2R8IA 4DL6A 4RQ6A 3RJJA 4BXOA 4WBZA 3H4DA 2KTQA 1ZYQA 2H5XA 5J2FA 4X4OA 2XCAA 3V7KA 3PVXA 2FLNA 4UAWA 3KHLA 1U48A 2ZH1A 1ZJNA 2Q0ZX 1IXRA 1DOQA 5KFBA 1S0NA 2M2WA 3ISCA 3RJIA 1NJXA 3RB0A 1YLQA 4KLDA 5CR0A 2ZH6A 1RPLA 3THVA 3PR4A 1L3UA 1X9MA 4IRDA 2ZH7A 1S97A 4J9RA 4DL5A 3QEBZ 1QSSA 8ICXA 2BPCA 4QWCA 1JAJA 4DQRA 3N4MB 4NLKA 5KFNA 3G6YA 3GV5B 7ICNA 8ICJA 4WC7A 4DQQA 4DF8A
chains in the Genus database with same CATH superfamily
3CRXA 4NL9A 3A0HU 4ECTA 5CA7A 5J29A 5KG5A 4CNQA 2BDPA 2NRKA 4F92B 1RYUA 3PSFA 2P35A 3BQ7A 4AT8A 1WWVA 4R64A 2UVRA 8ICTA 3TAQA 5J0UA 4YP3A 3H39A 1Z00A 7ICUA 5ALHA 2BCSA 1ZD3A 3WKCA 5DEDA 3PSIA 4KLSA 4MHVA 2K4IA 5DQHA 4Q8FA 1XU4A 4UD5A 4OAHA 2B0CA 1MIVA 1V97A 4IRKA 3N97B 1WCNA 2NO5A 3AQLA 2GWSA 3HJ1A 3VC8A 2W9CA 4DCCA 1S9FA 3C2KA 4FHVA 5KFJA 5KFIA 3KKAC 4KLHA 5AIAA 5DG9A 2ZTDA 5ALNA 4M9HA 4K98A 4F2RA 1R89A 1OUQA 1X9WA 3GIKA 3RAQA 2AQ0A 5KFMA 3WFQE 2XY5A 2QB0B 3K1ZA 1NK5A 9ICFA 3EYZA 3F5EA 4RQ5A 4FH5A 3PX0A 2VA3A 2XICA 3OV7A 4BXOB 5C5JA 2AQ4A 2KJ5A 2KD1A 2BQRA 2BHNA 3HP6A 4ZOHC 2ISOA 2D6FC 4HYKA 4KM5A 5J2EA 3M6ZA 5HR9A 1SV0A 3PW2A 3JCFA 5HR6A 3C1ZA 1T3NA 2XGQA 2F3NA 3JPQA 4C8OA 4DSIA 3GIIA 5E79U 4DSFA 2FE9A 2R8HA 5KFRA 2DR7A 1SL2A 2YQEA 2P66A 3IG8A 4WQKA 2DKXA 2DR8A 3M6KA 1MSWD 1YT3A 2DRBA 1Z1BA 1B22A 1UPHA 3QUQA 2NRXA 1VJ7A 4G9BA 3L9DA 4UB5A 2YMMA 3LVVA 2ZH2A 5J2DA 4US8A 2RDJA 2J6SA 1L8OA 3TADA 3JPSA 3L4PA 3AU2A 4RNOA 1RG6A 9ICKA 5ALLA 2ZTCA 3NVVA 4NLZA 4F3OA 4IC9A 4OJ5A 4JWMA 2W04A 4WH5A 3BQTA 4DFDA 5KG3A 3JPRA 4RQ7A 2K8AA 3WK8A 4J9QA 4QZ9A 3JPNA 4GXIA 2YY6A 1UQVA 2B4VA 1A77A 4MFAA 3RB3A 2K8BB 3TKAA 4O5EA 3MR6A 3B9JA 3ETLA 4G3IA 5TZVA 3TI0A 4E0DA 2PMZF 4YMMA 4ECXA 2PFQA 2JRZA 2R8GA 3NGDA 2PFPA 4EV6A 3B0YA 3SR6A 8ICQA 2F2AB 3GV8B 1COOA 1S0VA 4B6JA 1ZRMA 4O3PA 2AGOA 4I0UA 5KFDA 4F2SA 2EDUA 2W9BA 4O3RA 4IQUA 3QZ7A 3NVZA 2E1FA 1JUDA 2JXJA 4XQ8A 9ICOA 4EZ6A 4MEYA 3BZCA 4GC6A 4F5RA 4S3NA 9ICIA 2W54A 3ZDAA 2IA6A 5GTHU 4CDGA 5J2IA 2DKZA 2F77X 4DEZA 2W11A 5BOLA 5KFGA 4XRHA 5D62A 5KG4A 4ELUA 1PVPA 5J2KA 9ICRA 3FYHA 1Q3UA 2KEYA 4UBBA 3HJ4A 4C4RA 2P6UA 1U4BA 4J9LA 1UA0A 2WHEA 1KLNA 4LEVA 5J0TA 3PSPA 5ALPA 2ZJAA 3D6JA 2IBKA 2V4QA 2W03A 1SL0A 4WC0A 3T5KA 4TUPA 5IIMA 3M7DA 1XS9D 2FCLA 5DECA 1RXVA 2KSOB 1KDHA 4KB6A 4C4SA 4K97A 5EE3A 1ZQZA 3OVAA 9ICJA 2W9AA 3F53A 4BWJA 2V4RA 2V9WA 3TAPA 1NK8A 2EH9A 8ICIA 4AT9B 4O0IA 1X2IA 2NYVA 3N28A 2C22A 2YTUA 1Q8KA 9ICLA 2ZIWB 4XJEA 2KV2A 5KAFU 5CHEA 1ZQDA 4Y2QA 2ZUDA 8ICFA 5KFWA 5L1IA 2ZIXA 2ZHAA 4BDPA 4R66A 5J2GA 2HSZA 4QJFB 4NKTA 1IIPA 3OVSA 3KOOA 3SYZA 5HREA 3MR5A 4ECQA 2VJ4A 3K4GA 1MA7A 5AKHA 3H0LB 1N56A 4JLZA 7ICIA 4DL3A 1N60A 2B21A 1NZPA 4RZRA 7ICTA 3HKZF 1ZETA 1MC8A 1CRXA 1F44A 5F9LA 4B9UA 5KG1A 1KKXA 5HRLA 4KLGA 2RQ5A 4QIWF 4PZOA 3RB6A 4YG2A 1HUZA 2HI0A 3J81j 2GOLA 3F2DA 1X6IA 1LVHA 1KSPA 4OAGA 2E8MA 3V7LA 3ZDDA 2XO7A 4OCZA 4M5DA 2JHDA 1A6SA 3PR5B 4NLNA 4F5QA 5L9XA 4J9KA 2AJQA 4O3QA 8ICPA 5DLGA 2ASLA 1TAMA 3H0RB 3PW5A 3K1RB 4ACOA 5DG7A 5ALKA 4LEZA 1ZD5A 2BCUA 2F1IA 3DV9A 2AU0A 1A76A 4XQ7A 5ALQA 3IP4B 9ICNA 4EZ9A 1WWUA 4UAVA 7ICPA 3NVYA 1ZQYA 1N5XA 3ERCC 1HJPA 4Y2JA 3FM9A 2W3SA 3Q8KA 2BPFA 1J2MA 1YZ6A 2DR5A 8ICEA 3BQ1A 5AKZA 4C7ZA 4KX5A 1SZPA 3C28A 4MEXA 5IIOA 2F76X 3H7IA 4DL4A 4RU9A 1BGXT 4GXJA 1Q78A 4DLGA 2H3FA 5B3QA 8ICAA 2JV3A 4J9OA 3D2NA 2E1EA 3TFRA 4UQGA 3GDXA 1SKRA 4WC2A 5IIKA 4TUQA 7ICFA 4ECYA 4UB4A 1S8OA 2KZ3A 4MF8A 2HVHA 4Y2SA 2FI1A 3ZDCA 3BJYA 4DSLA 4Z6EA 2EANA 4EELA 4I2GA 2LYHA 5F9NA 2HHSA 3UXPA 2G5HB 1UT8A 4CF5A 2G06A 8ICZA 4DSKA 7ICQA 4F93B 2BBJA 4DLEA 2M2VA 3NRZA 4FHWA 1Q79A 4JK1A 2G5IB 4C0ZA 3KKAA 1X6JA 1JIHA 5KFKA 2PMZC 3OTQA 4C8NA 1VFGA 2IUBA 2JZBB 1HIWA 4TQSA 3H4DA 4OD0A 4X4OA 3MCRA 2FLNA 3KHLA 4C80A 2A19A 2PKEA 3RJIA 3THVA 2GLEA 3HJEA 5AKJA 2RHFA 4J9RA 4DL5A 1QSSA 8ICXA 4K8VA 8ICJA 1S5LU 2OH2A 5TISU 4WCWA 5B3PA 4KLFA 3OWGA 1TKDA 5KFHA 1L7MA 5DQGA 4XA5A 3AQNA 1ZOLA 4QW9A 4GFJA 2HHWA 4JUZA 2M0NA 4KLMA 5DQIA 1VLBA 2IHMA 4DFMA 1LKYB 1RZTA 2HBKA 3GIMA 4QZ8A 5J0OA 3C18A 3QU2A 2ODGA 4FHPA 4M6WB 3MFIA 1WG8A 5AM1A 3T79A 5JU5A 3RBDA 5GTIU 4DL2A 1BPBA 5AI4A 1TFRA 4B9NA 4TQRA 1JI7A 3OJSA 2Q66A 4KLEA 3AQMA 1KRPA 3H8SA 1BPZA 9ICCA 4BUGA 4X4VA 1QLNA 4K4GA 4I2AA 4RNMA 4AYBF 3EUB2 2ZIVA 4AT7A 5DGAA 1T8EA 2WB1F 2XI9A 2RDIA 3OUYB 2BDUA 2I5HA 2LM1A 3WK6A 4Q8EA 2Y9TA 4JV2A 2DR9A 3EW9A 4UB6U 4CRXA 4LT6A 3QU4A 4O5KA 3JPOA 3GV7B 1UETA 4DFKA 2BQUA 1DK2A 5KFVA 2HMXA 9ICSA 1DXSA 7ICJA 2K89A 4IQWA 2AHOB 5DDMA 2KZMA 9ICGA 1NK7A 3BZKA 2E8NA 4F4YA 5J0YA 4ECSA 2K4EA 5ALUA 3MBYA 3T5LA 4AT8B 4WC3A 3SAHA 2C2EA 4IQTA 4F72A 3EZ5A 3F2CA 4F5OA 1L3SA 5KT5A 3OSPA 5F2VO 4ED0A 3O0FA 5KTQA 5KFYA 1V4AA 2P6RA 1ZQJA 4NM2A 5AI8A 1KFSA 4O68A 3M9OB 3PV8A 2FJ6A 3SV4A 4EX6A 5KG7A 3HKZC 4I2BA 3KHHA 2W9CB 2CPRA 8ICMA 2KG5A 3RAXA 1A0PA 3FC4A 4RQ3A 4R63A 4QIWC 3RB4A 2O1PA 3AL0B 5KT3A 3AEVA 4FZNA 8ICKA 1HUOA 5L1KA 3I28A 3UMGA 1NJYA 1ZQCA 4OJ6A 4EX7A 4QWBA 5KG2A 1Q3VA 4M9LA 2BCQA 4O5CA 5DBBA 2DL0A 1C20A 1IG6A 3UMBA 2JH1A 4RQ1A 4KLLA 4F4KA 2HBLA 7ICGA 4O3NA 1URJA 1DK3A 5KFLA 5J2AA 2IMWP 4Q44A 4R8UA 3QX7A 1RXWA 2HN2A 5KFPA 3PNCA 4RQ0A 3FAHA 2YMQA 4FFDA 2ID1A 2AXTU 3MR3A 2JEIA 7ICLA 1LB2B 3UXOA 2WAQF 5AKGA 9ICWA 3OVBA 5ALIA 3ONNA 1ZQTA 3M9NB 5HHHA 2WTFA 4PZNA 3LWLA 2I9GA 1BPYA 1GPJA 4WBYA 4IG8A 4U7CA 4KITB 3WU2U 2W7OA 4RWNA 2A1JA 1UT5A 3DDHA 4EEDA 4M0AA 2BPGA 5AI6A 2GO7A 2LM4A 1JQRA 5IINA 3OJUA 4WQLA 4ECWA 1BPXA 4OJLA 1K5OA 4BX9C 1QSLA 1OU5A 1O08A 2ZUBA 4GIBA 3UPSA 2PFOA 4X4QA 4Y2VA 1ZQIA 5J2HA 3PY8A 2HHVA 3ICXA 4EYHB 1S77D 2YMPA 5BPCA 4NXVA 5KFFA 5G5GA 4NLBA 2FMPA 3NASA 4ECVA 4P0QA 1ZQRA 4I2JA 1NKCA 4LEYA 5KL1B 2MUTA 3G6XA 5AK6A 2E5SA 2QARA 1QQ5A 3PZPA 2DFLA 3OPXA 2E8OA 7ICKA 1JN3A 4RQ8A 3PSTA 1JROA 2JMGA 4O9MA 3B0XA 4Q43A 4LJXA 2GH1A 4AP9A 1N48A 3JPPA 3AN1A 4UARA 3TACB 3ISDA 2DRAA 4ED6A 1TAQA 5ALWA 2I6XA 2W9BB 2PBEA 1F5SA 2AGQA 5ALOA 5CFTA 2HDOA 5KFSA 3WKBA 4ATBB 1D8BA 3WKDA 5J0QA 5KG6A 2M2UA 3ER9B 2PI4A 4NXZA 5AKKA 4QW8A 3QNMA 3H8MA 5J0XA 2Y0SF 4J03A 1N2XA 5J2JA 2ZHBA 3KHRA 2YN4A 4AYBC 3L3FX 5DB7A 1WUDA 4FO6A 1Z19A 4JMUA 3AQFA 1L7OA 4EBJA 4O3OA 5ALZA 9ICEA 1RQLA 5HP4A 1K1SA 8ICCA 3ZD9A 2W55A 2LPEA 3NWIA 2WFAA 3ETRA 3RF9A 4R65A 4PPXA 2KIWA 4WC6A 5KFEA 3RFAA 8ICWA 2EWRA 3RR8A 2EQYA 2RFFA 4KMUA 2G0AA 3UQ2A 2ASJA 4Y2RA 4ELTA 5L1JA 3QUBA 4ED1A 4F5PA 4HX0A 4X0AA 2B51A 5ALSA 1ZQMA 3H38A 4QWEA 1B4FA 4UATA 1AQ6A 1D9FA 3PW0A 2W9MA 5CP2A 4EP7A 9ICQA 3QU9A 3R9KA 5AHXA 4ZH4A 4RQNA 2R8KA 5J2CA 8ICNA 3TQ1A 1ZQAA 1L7NA 1JALA 4EENA 5ALJA 2ZIXB 2R18A 1OXJA 4WC5A 4K4IA 2W7PA 1DRGA 2JEJA 4YVZA 4IR1A 2ESEA 3NVWA 2OEHA 3OHBA 5KT2A 4X4NA 4ECUA 4DSJA 5J8YC 4KTQA 1ZQSA 3GU3A 4F50A 2VKQA 2KFZA 4U6PA 2HVIA 4UAUA 2ZH9A 4ELVA 4GXKA 2MA1A 3KHGA 3PMLA 2HHTA 4RT2A 4BJQA 1S0MA 2NRTA 5HR7A 4WJ3B 1X66A 1BPDA 1QQ7A 3V6HA 1PK1A 3KBBA 2BBHA 4X5VA 3A0BU 1S76D 1D9DA 1TK5A 3I76A 1BPEA 2IHNA 2KOBA 4FZMA 2R8IA 4DL6A 4RQ6A 2XIDA 4WBZA 2KTQA 4ICAA 2H5XA 2OHFA 2XCAA 2G09A 3BS7A 2AH5A 2Z7JA 3ISCA 4OJOA 1YLQA 4KLDA 5CR0A 1RPLA 1L3UA 2EAPA 5AKEA 2K60A 4QWCA 4NLKA 5KFNA 3GV5B 3V72A 5KFAA 5JTGA 5KFUA 2C2RA 2ZTEA 2EZZA 3RJHA 4KX3A 5BOMA 4QZDA 3LYSA 2H3ZA 5HRBA 2KK0A 4B9MA 3RH4A 5HC9A 3CW2C 2ATLA 4DQSA 1WCLA 2F8LA 4K96A 9ICVA 5CFSA 5FP0A 4PH5A 3CNHA 3WK7A 5DG8A 4Q45A 1KN5A 3Q8SB 5D61A 4F71A 1ZQVA 4KN7A 3TARA 1SKWA 3U26A 4DL7A 2DPIA 3QZ8A 4E80A 5IIIA 3C21A 3C1YA 4EYIB 4UASA 1KNYA 1XSNA 1ZQNA 4ED2A 1SB3C 3QYPA 3ISBA 4F8RA 3V6JA 1R8CA 3IHQB 4AT9A 1MN8A 3WFOA 3HT3A 2MSNA 4X4TA 1JXEA 3KTQA 2QKQA 3KD3A 3SENA 2E3TA 4B9TA 1L7PA 4WC1A 2ZH8A 1RYRA 3L5KA 4C8MA 3QU5A 1TV9A 3RBEA 4YXMA 3NTUA 3Q8LA 4US9A 1ZQHA 3WK9A 1N62A 2HN1A 2GA9D 2HHUA 7ICVA 5K4LA 3BS5A 8ICYA 2KVSA 1H38A 5CWRA 4J9MA 2KFNA 2NV3A 3GFKB 1JX4A 1ZQLA 1QH9A 4C4TA 5D4BA 5HRFA 4QWDA 3RRGA 4XUSA 4MF2A 5KFOA 4EBEA 4MFFA 2HOFA 2K4HA 2BZFA 4EBDA 5F3XB 5ALTA 4PHAA 4GLXA 5J0SA 2RRDA 2JH7A 4YMOA 5JTIA 2Y9UA 3IV6A 4I2IA 1TAUA 4PGYA 2KICA 3T5JA 4ED7A 2F1HA 2E8PA 8ICGA 3UM9A 1JMSA 1NK6A 4I2EA 3IG5A 3NRWA 2FLPA 9ICUA 3CP8A 1XWLA 2UVWA 4DOCA 3HIYA 2ZIVB 5DDYA 4AT7B 1S10A 2PI5A 5EWFA 2W8KA 4OJPA 4YQWA 1NKBA 4DS5A 5D49A 3SD7A 1D8LA 5CFUA 1ZQKA 5EE9A 4PL1A 5AIBA 5KFQA 4P0PB 4Z6DA 1Z4OA 1U49A 3ZDBA 3M8SA 2KHVA 4YR2A 3OGUA 3LWMA 3MFHA 3RH5A 2IOHA 3N7RC 1KW4A 2NRZA 1ZQFA 4NJ8A 1IV8A 1TK0A 2IHOA 2ZH5A 5AK4A 3ZI4A 1VDVA 3PW7A 3AMZA 4I2DA 5AI0A 3IDWA 2MAXA 1ZQUA 3KZIU 3M9MB 4I29A 4NY8A 3RJGA 4UB8U 3JZ0A 1UCVA 4JV1A 4M2YA 2VJ5A 3HW8A 2BCVA 1X9XA 2KKPA 2XY6A 1NI3A 2DVIA 4GC7A 1J97A 4J9PA 2H3QA 3SEIA 1L3VA 1DGJA 2ZXHA 2L5YA 2VIXA 3C5FA 3C2MA 1TVAA 1X9SA 5KFTA 5L1LA 5AKIA 2F44A 3C2LA 2ZH4A 4DOBA 4Z6CA 2ZIUA 2JEGA 5HMMA 2A3VA 2ZH3A 4X4RA 5AKYA 5CEHA 4KN4A 2HBMA 4P4PA 5CRXA 2K8CB 4DFPA 1AROP 1SWWA 1Z00B 2KNJA 2BR0A 3PO5A 4DO9A 5DLFA 5HRKA 1NJWA 2UVVA 3C29A 2LI6A 3MGHA 1V38A 2HOQA 5H2FU 4M04A 3NUQA 2D3DA 2HW3A 4RQ4A 1X40A 1KFDA 2OYYA 5J0WA 1FEZA 4O6AA 2FPMA 4R8UB 5C0YA 3N7PD 1R8AA 3WFRE 1Y88A 1XO1A 1RQNA 2NRWA 4F4XA 5KT7A 1CI4A 2N1RA 5KT6A 4MKPA 5EE0A 4J9NA 3UXNA 4ED3A 4Y2YA 1T4GA 5CHGA 2B6GA 3NVOA 3RJEA 3Q8MA 1N63A 1XSPA 5JUMA 1ZQPA 4WC4A 1L5UA 4BWMA 3GQCA 1NZBA 4YN4A 4NM1A 5ALMA 2M2TA 5HRIA 2A1JB 2PXIA 4X4UA 4LZGA 2RP5A 4YR0A 3EWAA 2KJ8A 2KZZA 1WOTA 5JRTA 5DB8A 1PX5A 2BKEA 2K4PA 4PHPA 2Y1IA 1XC9A 2G07A 2A1AA 1MQ2A 1XO0A 4E8FA 4Y2XA 4I27A 5AI9A 4X0BA 1ZD2P 4FHXA 3QUTA 1ZD4A 3GZFA 4QZEA 1YZ7A 5J0PA 4Y2UA 4O3SA 1PK3A 2W3RA 4FE3A 5KAIU 3NYBA 5J8YA 2W8LA 8ICRA 2ZJ8A 1DGSA 3HRDD 3N7SC 3C66A 5ALFA 7ICOA 3MGIA 1SL1A 4QNLA 3WKAA 4P0QB 1NK4A 2MUTB 2KKVA 3RTVA 2QARB 4DFJA 4LZDA 1EXNA 5AM4A 4B9LA 5EWEA 2HBJA 3DEEA 3BQ2A 3LQCB 2R8JA 2DQNB 4DQPA 2WF6A 5J2BA 5HHIA 3H37A 2HCFA 2KE7A 2QB1A 4C8LA 1SKSA 2FDRA 8ICLA 1B0XA 3LVWA 5ALDA 2KJ9A 4LEWA 1SZHA 3GIJA 4IRCA 5A0LA 4P4OA 1KFTA 4RNNA 4FHYA 5EWGA 2LMRA 2CRXA 4K9AA 3K7DA 3V6KA 2M9NA 4KLIA 1T3QA 4EBKA 3JPTA 4TURA 2WF5A 5CB1A 2C28A 1XSLA 1D8YA 2KIVA 5DBAA 1KBUA 2QLTA 1MQ3A 3E0FA 4LVSA 2DBYA 1NOMA 3JYYA 3H3AA 2MU2A 4RPZA 1FIQA 2W43A 8ICUA 4YD2A 4PHEA 2O6KA 3MDCA 2QB0A 5ALEA 3SZ2A 4DS4A 3QXGA 1SIJA 3H8WA 3AU6A 4RPYA 5D63A 3AQEA 5AM3A 4BXOA 4O69A 4CE6A 2KVCA 3QUCA 3PVXA 3EF2A 2ZH1A 1ZJNA 2Q0ZX 1IXRA 5KFBA 1S0NA 2ZH6A 1X9MA 2ZH7A 1S97A 1JAJA 4DQRA 4WC7A 1U48A 1ZXIA 2UVUA 4PGQA 4IQVA 1TE2A 3VCBA 4FH3A 3H8JA 3ZDEA 9ICTA 3ORYA 4M9JA 4IL6U 2WB1C 4N7RA 2YB4A 1NK9A 1BVSA 4RPXA 1F5AA 5AM5A 1U47A 3WFSC 1SXEA 5HRHA 3GILA 3SAFA 3KFUF 2I1QA 3C23A 4KLJA 1TFWA 3F5AA 4B9SA 4PGXA 1QTMA 4YD1A 2KMDA 2Y1JA 4QZBA 4RQ2A 1FO4A 1ZQWA 5AICA 1ZRNA 4OAIZ 5DGBA 3HWTA 2XC9A 1L8LA 3ER8C 3NS1A 4FS1A 4ATBA 5KNIA 1PK1B 4F4ZA 4WOYA 4NXXA 1KL9A 1ZQXA 3IM1A 1ZQOA 2ZG6A 2Q4TA 3AUOA 1UEUA 3RH6A 5ALXA 4YCXA 3OSNA 1MIYA 2HHQA 5AK3A 1OW5A 5KL8B 2ZJ5A 4NWIA 1UA1A 2JR5A 4UAYA 1ZQQA 1CEZA 5AK5A 4NL9C 2OWOA 1P7DA 4EGWA 1UHUA 5KFZA 2EZYA 4K9BA 4YMNA 3RJKA 2VA2A 4RQMA 4USAA 4UBCA 2BGWA 4NXUA 2ISPA 2LYAA 3M1YA 4UB1A 2HHXA 3LK9A 1NO5A 5KFXA 3UMCA 4NXTA 1O03A 4M47A 3PW4A 3PX6A 2YX8A 5ALYA 1RYSA 4M9NA 4A8EA 1U9LA 2ES6A 4FS2A 2XCPA 5HRDA 4CCHA 1FFVA 3I1YA 3E58A 4RWPA 4YFKA 4EEKA 5HRGA 3QU7A 1V85A 4DSEA 3T5HA 3ZD8A 5J0RA 4EEYA 3T3FA 5KT4A 3D2SA 3F2BA 4QWAA 5G5HA 2WAQC 1R8BA 2F1JA 4YXJA 1M6YA 2ALZA 4ECZA 1FFUA 2CXYA 1N5WA 2BCRA 1X42A 2G08A 5B66U 9ICAA 1SV0C 2IOFA 2LBOA 1PVQA 2OXOA 4J9SA 2WF7A 8ICVA 3AM9A 4YR3A 1JRPA 2KHQA 3BS5B 4Z6FA 5KFCA 2FPLA 4DF4A 4OO1J 3PHZA 3WFPA 2KSOA 2DWQA 1ECWA 2B56A 1SGGA 5ALVA 4TUSA 4UD4A 4KLTA 4ECRA 4B9VA 2WF9A 1PVRA 4JWNA 3SQIA 1N61A 3CK6A 2DGZA 1MIWA 2VANA 5AI5A 4QZHA 2ZIWA 3BQ0A 3TADC 4P2HA 1BNPA 1QCKA 4ED8A 4I2FA 5D46A 4F4WA 2OM6A 1L6NA 3M8RA 4P4MA 3UPQA 1IM4A 1S0OA 4PL2A 1SV4A 8ICBA 5DKWA 3MGVA 5AM0A 5T14A 1C7YA 4RUCA 1GO3F 9ICMA 4NV0A 3UQ0A 2KP7A 1ZQBA 3S6JA 4EEBA 3Q8RB 2EZXA 5EOZA 1NJZA 5HMLA 4I2CA 2EAMA 4KLQA 4JLXA 3WK5A 2XGPA 7ICHA 4I2HA 1Q46A 3SI8A 1XNSA 3D2QA 5IILA 1RDFA 1NK0A 2C2DA 3PO4A 3TFSA 4NLGA 1L3TA 2H3IA 2ZXIA 3RJFA 2Y0SC 2D8CA 8ICSA 3NKUA 5AKLA 4CF4A 1VJ5A 7ICEA 4RUAA 5CJ7A 4IS7A 4UAZA 4UB3A 1KEJA 4KLOA 3Q8QB 4DOAA 1ED1A 7ICSA 1ZJMA 5B5EU 3HPOA 3AQKA 3EPIA 9ICPA 2DPJA 1UEVA 2BQ3A 2BE3A 1TK8A 2HOIA 3ED5A 1JXLA 5DB9A 2HHPA 4C7YA 4KLUA 4FO1A 3WK4A 4CGZA 1BNOA 4X4PA 3MDAA 4QZGA 4JV0A 3MR2A 5IIJA 2J6TA 1PZNA 4QZIA 4KMOB 1T94A 4NLCA 3PX4A 3H40A 5DBCA 4DQIA 4BGDA 3IRUA 4RWOA 7ICRA 4M9GA 9ICXA 2FMSA 3RR7A 4NKUA 3E2EA 3SAGA 3Q8PB 1T7PA 4X4SA 3QE9Y 2NRVA 1KQQA 2FPKA 3PMNA 3MC1A 2ZIUB 5ALRA 2F8KA 4I28A 3QEAZ 2GAFD 8ICHA 1ZQGA 1SWVA 4IR9A 4MFCA 3H4BA 2JEFA 1QSYA 3IN5A 2JZBA 1ZQ1C 4JB3A 1NNLA 2YMLA 2FMQA 1PUZA 4EBCA 1F0MA 4NXWA 4E7XA 4F5NA 4FZLA 4UB2A 3HX0A 4QZCA 9ICHA 1Z1VA 4F91B 3LDAA 3EPGA 1K1QA 1WYGA 4RWQA 3OHAA 1V9PA 2H3VA 4CF3A 2YB1A 1LV5A 2MRLA 1NKEA 2LHTA 3FDSA 1TFYA 2LKYA 2KN7A 1ZQEA 2IOFK 1KTQA 1LKYA 7ICMA 1SXDA 3V7JA 4P0PA 5EE1A 4FBTA 1Z3EB 5HNKA 5DB6A 3RRHA 8ICOA 1B43A 5AM2A 3MABA 3KZXA 4HAIA 3SMVA 2PFNA 3TANA 4PJ0U 3ALRA 4M6WA 4K4HA 9ICBA 4UW9A 4K99A 1U45A 2FLLA 1COKA 4C8KA 1FA0A 4QZFA 3BDPA 4O3MA 1HEKA 4PHDA 2OCEA 2ZUCA 2CN1A 5KG0A 2J6UA 4DWIA 2JGAA 3H0MB 4Y2TA 3HILA 2LYBA 3K75D 4QZAA 1J2NA 5ALGA 2O5AA 2XY7A 2ASDA 1Z4NA 2AGPA 2DUYA 4RT3A 4FBUA 2WF8A 3C5GA 2EAOA 4OAFA 2RLTA 3OUYA 4Y2PA 2VA8A 1QQ6A 5AKXA 1CUKA 3G6VA 3RJJA 1ZYQA 5J2FA 2NO4A 3V7KA 2DF4B 4UAWA 1RM6C 1DOQA 2M2WA 1NJXA 3RB0A 3WKEA 3PR4A 3CYMA 5L1MA 4IRDA 2XVTA 3QEBZ 2BPCA 3N4MB 7ICNA 4O67A 3G6YA 3SV3A 4DQQA 4DF8A
chains in the Genus database with same CATH topology
5KFAA 4WCWA 5KFUA 5CA7A 2ZTEA 4ECTA 2C2RA 5J29A 3RJHA 2UVUA 4KLFA 5KG5A 5BOMA 4PGQA 5KFHA 4F92B 4IQVA 4QZDA 5DQGA 1TKDA 2BDPA 4XA5A 3AQNA 4FH3A 3H8JA 3ZDEA 4QW9A 2HHWA 4JUZA 9ICTA 4AT8A 5HRBA 3ORYA 4M9JA 4KLMA 5DQIA 4R64A 2UVRA 4B9MA 3RH4A 2IHMA 4DFMA 8ICTA 5HC9A 3TAQA 5J0UA 4YP3A 3H39A 1Z00A 1NK9A 1BVSA 2ATLA 4RPXA 4DQSA 1WCLA 1RZTA 7ICUA 9ICVA 3GIMA 3V72A 2BCSA 4QZ8A 1F5AA 5J0OA 4PH5A 1U47A 3C18A 3WFSC 5DEDA 4KLSA 5HRHA 5DG8A 3GILA 4Q45A 4FHPA 5DQHA 4Q8FA 4M6WB 3MFIA 1XU4A 3Q8SB 4UD5A 1ZQVA 2I1QA 3C23A 4KN7A 4KLJA 1MIVA 3TARA 1TFWA 4B9SA 4PGXA 1SKWA 1QTMA 4IRKA 4YD1A 3N97B 4DL7A 1WCNA 3QZ8A 3RBDA 2DPIA 5IIIA 3C21A 3C1YA 4EYIB 4DL2A 4E80A 3AQLA 1BPBA 1XSNA 1TFRA 2GWSA 2Y1JA 2W9CA 1ZQNA 4ED2A 4QZBA 4B9NA 3HJ1A 4RQ2A 4TQRA 1ZQWA 3OJSA 1S9FA 2Q66A 3C2KA 3ISBA 4F8RA 4KLEA 4FHVA 3V6JA 1R8CA 5KFJA 1KRPA 5KFIA 3AQMA 3H8SA 4KLHA 3IHQB 5DGBA 3HWTA 1BPZA 5DG9A 4AT9A 9ICCA 4X4VA 1QLNA 2ZTDA 3WFOA 2XC9A 4K4GA 4M9HA 4I2AA 4F2RA 1R89A 4RNMA 3HT3A 4FS1A 3GIKA 3RAQA 1X9WA 2AQ0A 5KFMA 4AT7A 4X4TA 1JXEA 2XY5A 4ATBA 3KTQA 3WFQE 4B9TA 4F4ZA 5DGAA 1NK5A 1T8EA 3IM1A 1ZQXA 9ICFA 1RYRA 1ZQOA 4WC1A 2ZH8A 4C8MA 2RDIA 1TV9A 3RBEA 4YXMA 3NTUA 3EYZA 3AUOA 3OUYB 4RQ5A 3Q8LA 1UEUA 3RH6A 4FH5A 4YCXA 3PX0A 2VA3A 3OV7A 3OSNA 4BXOB 4Q8EA 1MIYA 5C5JA 1ZQHA 4JV2A 2HHQA 2AQ4A 2DR9A 3EW9A 2ZJ5A 2BQRA 1UA1A 2HHUA 2BHNA 1ZQQA 4UAYA 3HP6A 7ICVA 8ICYA 1H38A 2ISOA 1CEZA 4LT6A 4HYKA 5CWRA 4J9MA 4O5KA 2OWOA 3JPOA 3GV7B 2KFNA 1UETA 3GFKB 4DFKA 5J2EA 2BQUA 5HR9A 3PW2A 1DK2A 5KFZA 1JX4A 3C1ZA 5KFVA 9ICSA 7ICJA 4YMNA 3RJKA 4IQWA 1T3NA 2VA2A 5DDMA 2XGQA 2KZMA 3JPQA 4UBCA 4C8OA 4DSIA 2BGWA 9ICGA 1NK7A 1ZQLA 4F4YA 5J0YA 5D4BA 3GIIA 4QWDA 4ECSA 3RRGA 5HRFA 4XUSA 4MF2A 3MBYA 3T5LA 4DSFA 2ISPA 2R8HA 5KFRA 5KFOA 4EBEA 4AT8B 4MFFA 1SL2A 2DR7A 4WC3A 2C2EA 4UB1A 4IQTA 3LK9A 2HHXA 3EZ5A 2P66A 1NO5A 4F5OA 1L3SA 5KT5A 5KFXA 4EBDA 3OSPA 2DR8A 1MSWD 5F2VO 4ED0A 4PHAA 4GLXA 5KTQA 2DRBA 4M47A 5KFYA 1B22A 1V4AA 2P6RA 3PW4A 3PX6A 5J0SA 2NRXA 4YMOA 1ZQJA 4NM2A 1VJ7A 1KFSA 1RYSA 3L9DA 4M9NA 3M9OB 3PV8A 4I2IA 4UB5A 1TAUA 2ZH2A 3SV4A 1U9LA 5J2DA 4FS2A 4PGYA 2XCPA 2RDJA 4CCHA 5HRDA 5KG7A 2J6SA 4I2BA 3JPSA 3AU2A 4RNOA 3KHHA 2W9CB 3T5JA 4RWPA 9ICKA 4YFKA 2ZTCA 8ICMA 4ED7A 5HRGA 3RAXA 4NLZA 2F1HA 4RQ3A 4R63A 4DSEA 4F3OA 3RB4A 3T5HA 8ICGA 4JWMA 2O1PA 3ZD8A 1JMSA 3BQTA 5J0RA 5KG3A 4EEYA 3T3FA 1NK6A 3JPRA 2FLPA 5KT3A 5KT4A 4I2EA 9ICUA 8ICKA 1XWLA 4RQ7A 2UVWA 4QWAA 4DOCA 1HUOA 5L1KA 4J9QA 4QZ9A 3JPNA 4GXIA 2F1JA 1NJYA 5DDYA 1ZQCA 1R8BA 1S10A 4YXJA 4AT7B 2PI5A 5EWFA 4QWBA 2W8KA 1A77A 2ALZA 4YQWA 4MFAA 5KG2A 4ECZA 3RB3A 1NKBA 4DS5A 5D49A 2BCRA 2BCQA 4M9LA 4O5CA 4O5EA 3MR6A 2NRKA 1D8LA 5DBBA 9ICAA 3ETLA 1ZQKA 4G3IA 5TZVA 5KFQA 4Z6DA 1U49A 4J9SA 8ICVA 3ZDBA 3M8SA 4YR2A 4RQ1A 4YR3A 3TI0A 3OGUA 3LWMA 3MFHA 3RH5A 4E0DA 4Z6FA 5KFCA 2FPLA 4DF4A 4F4KA 4KLLA 4YMMA 2NRZA 4ECXA 1ZQFA 7ICGA 4O3NA 3WFPA 2PFQA 2R8GA 5KFLA 3NGDA 1DK3A 2PFPA 5J2AA 3B0YA 4Q44A 2IMWP 1TK0A 4R8UA 8ICQA 2ZH5A 1RXWA 4TUSA 5KFPA 4UD4A 4KLTA 3PNCA 4RQ0A 4ECRA 4B9VA 3GV8B 1COOA 3PW7A 1S0VA 2ID1A 4JWNA 4I2DA 3MR3A 3M9MB 2MAXA 1ZQUA 4O3PA 2AGOA 2JEIA 7ICLA 1LB2B 4I29A 5KFDA 4F2SA 4NY8A 3UXOA 3RJGA 1MIWA 2W9BA 3JZ0A 2VANA 9ICWA 3OVBA 1ZQTA 4QZHA 4O3RA 4JV1A 3M9NB 5HHHA 4IQUA 3QZ7A 2WTFA 4M2YA 3LWLA 3BQ0A 2I9GA 4XQ8A 1BPYA 9ICOA 4WBYA 4EZ6A 4IG8A 4P2HA 1BNPA 4KITB 3HW8A 4ED8A 4I2FA 5D46A 4MEYA 2BCVA 4RWNA 4F4WA 4GC6A 4F5RA 2A1JA 9ICIA 4S3NA 2XY6A 1UT5A 3M8RA 3ZDAA 4M0AA 2BPGA 4P4MA 4GC7A 3UPQA 2DVIA 2IA6A 1IM4A 1S0OA 4J9PA 3SV3A 5J2IA 5DKWA 8ICBA 1L3VA 1C7YA 4RUCA 1JQRA 4DEZA 3C5FA 3C2MA 5BOLA 3UQ0A 9ICMA 5IINA 5KFGA 1TVAA 5KFTA 3OJUA 5L1LA 1X9SA 3C2LA 4ECWA 1BPXA 2KP7A 1ZQBA 4XRHA 2ZH4A 4DOBA 4Z6CA 1QSLA 3Q8RB 1OU5A 2JEGA 5HMMA 2ZUBA 5KG4A 4ELUA 5EOZA 1NJZA 5J2KA 2ZH3A 9ICRA 4X4RA 3FYHA 5HMLA 4KN4A 3UPSA 2PFOA 4I2CA 4KLQA 4P4PA 4DFPA 4X4QA 2XGPA 7ICHA 3PY8A 1ZQIA 5J2HA 4I2HA 4UBBA 2HHVA 1AROP 3HJ4A 2P6UA 1U4BA 4EYHB 4J9LA 1S77D 3SI8A 1UA0A 5BPCA 5IILA 1KLNA 5KFFA 1Z00B 5J0TA 1NK0A 2C2DA 2FMPA 2BR0A 3PO5A 2ZJAA 3TFSA 4DO9A 4ECVA 5DLFA 1ZQRA 4NLGA 1NJWA 1L3TA 5HRKA 3RJFA 4I2JA 1NKCA 2UVVA 2MUTA 2IBKA 2V4QA 3G6XA 8ICSA 3MGHA 1SL0A 4WC0A 3T5KA 4M04A 4TUPA 5IIMA 1XS9D 2HW3A 4RQ4A 4RUAA 7ICEA 5DECA 1RXVA 1KFDA 2DFLA 5J0WA 1KDHA 5CJ7A 7ICKA 1JN3A 4RQ8A 4UAZA 4UB3A 1KEJA 4KLOA 2FPMA 3Q8QB 4R8UB 4DOAA 1ZQZA 4O9MA 7ICSA 3B0XA 4Q43A 1ZJMA 9ICJA 1R8AA 2W9AA 3OVAA 3WFRE 3HPOA 1Y88A 1XO1A 4BWJA 1KNYA 2NRWA 3AQKA 2V4RA 3EPIA 4F4XA 5KT7A 9ICPA 2V9WA 2DPJA 5KT6A 1UEVA 3TAPA 2BQ3A 1NK8A 1N48A 3JPPA 4J9NA 8ICIA 3UXNA 4O0IA 2BE3A 4ED3A 1TK8A 3ISDA 4AT9B 1JXLA 5DB9A 1T4GA 2DRAA 5CHGA 4ED6A 2HHPA 1TAQA 1X2IA 3PO4A 4KLUA 3RJEA 3Q8MA 2W9BB 2C22A 1BNOA 2PBEA 1XSPA 2AGQA 3MDAA 9ICLA 4X4PA 5JUMA 4QZGA 5KFSA 4JV0A 3MR2A 5IIJA 1ZQPA 2J6TA 1ZQDA 4ATBB 4WC4A 1PZNA 2ZUDA 5J0QA 4QZIA 1L5UA 8ICFA 4BWMA 5KG6A 5KFWA 3GQCA 5L1IA 4BDPA 2PI4A 2M2UA 2ZHAA 4R66A 4YN4A 3PX4A 4NXZA 5J2GA 3H40A 5DBCA 4DQIA 4NM1A 4QW8A 4NKTA 2M2TA 5HRIA 3OVSA 2A1JB 2PXIA 3SYZA 5HREA 3MR5A 4ECQA 4LZGA 4YR0A 5J0XA 4X4UA 3EWAA 4BGDA 3K4GA 4RWOA 7ICRA 2KZZA 4M9GA 9ICXA 1WOTA 1N56A 5J2JA 2FMSA 3RR7A 3E2EA 4NKUA 2ZHBA 3Q8PB 1T7PA 3KHRA 4X4SA 5DB8A 3QE9Y 1PX5A 2BKEA 4PHPA 2NRVA 2Y1IA 7ICIA 1XC9A 4DL3A 1MQ2A 2FPKA 5DB7A 4FO6A 2B21A 1NZPA 4RZRA 4E8FA 7ICTA 1ZETA 3PMNA 1MC8A 4I27A 4X0BA 4FHXA 4QZEA 4EBJA 5F9LA 4O3OA 5J0PA 4B9UA 4I28A 5KG1A 3QEAZ 4O3SA 8ICHA 5HRLA 9ICEA 1ZQGA 4KLGA 3NYBA 2W8LA 4YG2A 5HP4A 3RB6A 1K1SA 1HUZA 8ICRA 8ICCA 3ZD9A 4X4NA 4IR9A 4MFCA 3H4BA 2ZJ8A 1DGSA 1KSPA 2JEFA 3V7LA 3ZDDA 2XO7A 1QSYA 4M5DA 3C66A 2JZBA 3PR5B 4NLNA 7ICOA 3MGIA 4F5QA 1SL1A 4R65A 5L9XA 4J9KA 4PPXA 2AJQA 4WC6A 5KFEA 4O3QA 8ICPA 5DLGA 1NK4A 2ASLA 2MUTB 2FMQA 8ICWA 4EBCA 3RR8A 3RTVA 4E7XA 4F5NA 3PW5A 4UB2A 3HX0A 2RFFA 4KMUA 3UQ2A 4DFJA 4LZDA 5DG7A 1EXNA 2ASJA 4QZCA 2BCUA 4B9LA 2F1IA 9ICHA 5EWEA 2AU0A 1A76A 3BQ2A 4ELTA 2R8JA 4F91B 3EPGA 3LDAA 3LQCB 5L1JA 4ED1A 1K1QA 4XQ7A 9ICNA 4F5PA 4X0AA 4RWQA 3OHAA 1V9PA 1ZQMA 4EZ9A 7ICPA 4DQPA 3H38A 1ZQYA 4QWEA 1HJPA 1LV5A 5J2BA 5HHIA 1NKEA 3FDSA 1TFYA 3Q8KA 2BPFA 1D9FA 3H37A 3PW0A 2W9MA 2DR5A 8ICEA 3BQ1A 2KN7A 4C8LA 1ZQEA 5CP2A 1SKSA 1SZPA 9ICQA 4EP7A 1KTQA 5IIOA 4MEXA 8ICLA 3H7IA 7ICMA 4DL4A 4RU9A 1BGXT 3V7JA 4GXJA 1Q78A 4DLGA 4FBTA 4ZH4A 2R8KA 1Z3EB 5HNKA 5DB6A 5J2CA 3RRHA 1B43A 3TQ1A 3GIJA 1ZQAA 4IRCA 8ICOA 8ICNA 3MABA 4P4OA 1KFTA 2PFNA 4RNNA 4FHYA 5EWGA 3TANA 8ICAA 4J9OA 4M6WA 3TFRA 4WC5A 4K4HA 4UQGA 3GDXA 4K4IA 3V6KA 1SKRA 4WC2A 2M9NA 5IIKA 4TUQA 4KLIA 7ICFA 4ECYA 4UB4A 9ICBA 2JEJA 4MF8A 2KZ3A 4EBKA 2HVHA 4YVZA 3ZDCA 3BJYA 4IR1A 3JPTA 4DSLA 4Z6EA 4TURA 1U45A 3OHBA 5KT2A 2FLLA 4C8KA 5CB1A 2C28A 4ECUA 1XSLA 1D8YA 4I2GA 4DSJA 2LYHA 5F9NA 5DBAA 4QZFA 3BDPA 1FA0A 4KTQA 4PHDA 1ZQSA 4F50A 1MQ3A 2HHSA 3UXPA 2ZUCA 1UT8A 5KG0A 4LVSA 2J6UA 4DWIA 2KFZA 2HVIA 1NOMA 4DSKA 8ICZA 7ICQA 2ZH9A 4ELVA 3JYYA 4F93B 4GXKA 3H3AA 3KHGA 4RPZA 4DLEA 3PMLA 2HHTA 2M2VA 4RT2A 4FHWA 3K75D 1Q79A 1S0MA 4QZAA 2NRTA 2O5AA 4JK1A 2XY7A 1BPDA 2ASDA 3HIYA 8ICUA 3V6HA 4YD2A 4PHEA 2AGPA 3MDCA 1JIHA 4RT3A 5KFKA 3SZ2A 4DS4A 4FBUA 3C5GA 4X5VA 1S76D 1D9DA 4C8NA 3H8WA 1VFGA 3AU6A 1TK5A 3OUYA 4RPYA 1BPEA 2VA8A 2IHNA 2JZBB 1CUKA 3G6VA 4TQSA 2R8IA 4DL6A 4RQ6A 3RJJA 4BXOA 4WBZA 3H4DA 2KTQA 1ZYQA 2H5XA 5J2FA 4X4OA 2XCAA 3V7KA 3PVXA 2FLNA 4UAWA 3KHLA 1U48A 2ZH1A 1ZJNA 2Q0ZX 1IXRA 1DOQA 5KFBA 1S0NA 2M2WA 3ISCA 3RJIA 1NJXA 3RB0A 1YLQA 4KLDA 5CR0A 2ZH6A 1RPLA 3THVA 3PR4A 1L3UA 1X9MA 4IRDA 2ZH7A 1S97A 4J9RA 4DL5A 3QEBZ 1QSSA 8ICXA 2BPCA 4QWCA 1JAJA 4DQRA 3N4MB 4NLKA 5KFNA 3G6YA 3GV5B 7ICNA 8ICJA 4WC7A 4DQQA 4DF8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KFA A;  4WCW A;  5KFU A;  5CA7 A;  2ZTE A;  4ECT A;  2C2R A;  5J29 A;  3RJH A;  2UVU A;  4KLF A;  5KG5 A;  5BOM A;  4PGQ A;  5KFH A;  4F92 B;  4IQV A;  4QZD A;  5DQG A;  1TKD A;  2BDP A;  4XA5 A;  3AQN A;  4FH3 A;  3H8J A;  3ZDE A;  4QW9 A;  2HHW A;  4JUZ A;  9ICT A;  4AT8 A;  5HRB A;  3ORY A;  4M9J A;  4KLM A;  5DQI A;  4R64 A;  2UVR A;  4B9M A;  3RH4 A;  2IHM A;  4DFM A;  8ICT A;  5HC9 A;  3TAQ A;  5J0U A;  4YP3 A;  3H39 A;  1Z00 A;  1NK9 A;  1BVS A;  2ATL A;  4RPX A;  4DQS A;  1WCL A;  1RZT A;  7ICU A;  9ICV A;  3GIM A;  3V72 A;  2BCS A;  4QZ8 A;  1F5A A;  5J0O A;  4PH5 A;  1U47 A;  3C18 A;  3WFS C;  5DED A;  4KLS A;  5HRH A;  5DG8 A;  3GIL A;  4Q45 A;  4FHP A;  5DQH A;  4Q8F A;  4M6W B;  3MFI A;  1XU4 A;  3Q8S B;  4UD5 A;  1ZQV A;  2I1Q A;  3C23 A;  4KN7 A;  4KLJ A;  1MIV A;  3TAR A;  1TFW A;  4B9S A;  4PGX A;  1SKW A;  1QTM A;  4IRK A;  4YD1 A;  3N97 B;  4DL7 A;  1WCN A;  3QZ8 A;  3RBD A;  2DPI A;  5III A;  3C21 A;  3C1Y A;  4EYI B;  4DL2 A;  4E80 A;  3AQL A;  1BPB A;  1XSN A;  1TFR A;  2GWS A;  2Y1J A;  2W9C A;  1ZQN A;  4ED2 A;  4QZB A;  4B9N A;  3HJ1 A;  4RQ2 A;  4TQR A;  1ZQW A;  3OJS A;  1S9F A;  2Q66 A;  3C2K A;  3ISB A;  4F8R A;  4KLE A;  4FHV A;  3V6J A;  1R8C A;  5KFJ A;  1KRP A;  5KFI A;  3AQM A;  3H8S A;  4KLH A;  3IHQ B;  5DGB A;  3HWT A;  1BPZ A;  5DG9 A;  4AT9 A;  9ICC A;  4X4V A;  1QLN A;  2ZTD A;  3WFO A;  2XC9 A;  4K4G A;  4M9H A;  4I2A A;  4F2R A;  1R89 A;  4RNM A;  3HT3 A;  4FS1 A;  3GIK A;  3RAQ A;  1X9W A;  2AQ0 A;  5KFM A;  4AT7 A;  4X4T A;  1JXE A;  2XY5 A;  4ATB A;  3KTQ A;  3WFQ E;  4B9T A;  4F4Z A;  5DGA A;  1NK5 A;  1T8E A;  3IM1 A;  1ZQX A;  9ICF A;  1RYR A;  1ZQO A;  4WC1 A;  2ZH8 A;  4C8M A;  2RDI A;  1TV9 A;  3RBE A;  4YXM A;  3NTU A;  3EYZ A;  3AUO A;  3OUY B;  4RQ5 A;  3Q8L A;  1UEU A;  3RH6 A;  4FH5 A;  4YCX A;  3PX0 A;  2VA3 A;  3OV7 A;  3OSN A;  4BXO B;  4Q8E A;  1MIY A;  5C5J A;  1ZQH A;  4JV2 A;  2HHQ A;  2AQ4 A;  2DR9 A;  3EW9 A;  2ZJ5 A;  2BQR A;  1UA1 A;  2HHU A;  2BHN A;  1ZQQ A;  4UAY A;  3HP6 A;  7ICV A;  8ICY A;  1H38 A;  2ISO A;  1CEZ A;  4LT6 A;  4HYK A;  5CWR A;  4J9M A;  4O5K A;  2OWO A;  3JPO A;  3GV7 B;  2KFN A;  1UET A;  3GFK B;  4DFK A;  5J2E A;  2BQU A;  5HR9 A;  3PW2 A;  1DK2 A;  5KFZ A;  1JX4 A;  3C1Z A;  5KFV A;  9ICS A;  7ICJ A;  4YMN A;  3RJK A;  4IQW A;  1T3N A;  2VA2 A;  5DDM A;  2XGQ A;  2KZM A;  3JPQ A;  4UBC A;  4C8O A;  4DSI A;  2BGW A;  9ICG A;  1NK7 A;  1ZQL A;  4F4Y A;  5J0Y A;  5D4B A;  3GII A;  4QWD A;  4ECS A;  3RRG A;  5HRF A;  4XUS A;  4MF2 A;  3MBY A;  3T5L A;  4DSF A;  2ISP A;  2R8H A;  5KFR A;  5KFO A;  4EBE A;  4AT8 B;  4MFF A;  1SL2 A;  2DR7 A;  4WC3 A;  2C2E A;  4UB1 A;  4IQT A;  3LK9 A;  2HHX A;  3EZ5 A;  2P66 A;  1NO5 A;  4F5O A;  1L3S A;  5KT5 A;  5KFX A;  4EBD A;  3OSP A;  2DR8 A;  1MSW D;  5F2V O;  4ED0 A;  4PHA A;  4GLX A;  5KTQ A;  2DRB A;  4M47 A;  5KFY A;  1B22 A;  1V4A A;  2P6R A;  3PW4 A;  3PX6 A;  5J0S A;  2NRX A;  4YMO A;  1ZQJ A;  4NM2 A;  1VJ7 A;  1KFS A;  1RYS A;  3L9D A;  4M9N A;  3M9O B;  3PV8 A;  4I2I A;  4UB5 A;  1TAU A;  2ZH2 A;  3SV4 A;  1U9L A;  5J2D A;  4FS2 A;  4PGY A;  2XCP A;  2RDJ A;  4CCH A;  5HRD A;  5KG7 A;  2J6S A;  4I2B A;  3JPS A;  3AU2 A;  4RNO A;  3KHH A;  2W9C B;  3T5J A;  4RWP A;  9ICK A;  4YFK A;  2ZTC A;  8ICM A;  4ED7 A;  5HRG A;  3RAX A;  4NLZ A;  2F1H A;  4RQ3 A;  4R63 A;  4DSE A;  4F3O A;  3RB4 A;  3T5H A;  8ICG A;  4JWM A;  2O1P A;  3ZD8 A;  1JMS A;  3BQT A;  5J0R A;  5KG3 A;  4EEY A;  3T3F A;  1NK6 A;  3JPR A;  2FLP A;  5KT3 A;  5KT4 A;  4I2E A;  9ICU A;  8ICK A;  1XWL A;  4RQ7 A;  2UVW A;  4QWA A;  4DOC A;  1HUO A;  5L1K A;  4J9Q A;  4QZ9 A;  3JPN A;  4GXI A;  2F1J A;  1NJY A;  5DDY A;  1ZQC A;  1R8B A;  1S10 A;  4YXJ A;  4AT7 B;  2PI5 A;  5EWF A;  4QWB A;  2W8K A;  1A77 A;  2ALZ A;  4YQW A;  4MFA A;  5KG2 A;  4ECZ A;  3RB3 A;  1NKB A;  4DS5 A;  5D49 A;  2BCR A;  2BCQ A;  4M9L A;  4O5C A;  4O5E A;  3MR6 A;  2NRK A;  1D8L A;  5DBB A;  9ICA A;  3ETL A;  1ZQK A;  4G3I A;  5TZV A;  5KFQ A;  4Z6D A;  1U49 A;  4J9S A;  8ICV A;  3ZDB A;  3M8S A;  4YR2 A;  4RQ1 A;  4YR3 A;  3TI0 A;  3OGU A;  3LWM A;  3MFH A;  3RH5 A;  4E0D A;  4Z6F A;  5KFC A;  2FPL A;  4DF4 A;  4F4K A;  4KLL A;  4YMM A;  2NRZ A;  4ECX A;  1ZQF A;  7ICG A;  4O3N A;  3WFP A;  2PFQ A;  2R8G A;  5KFL A;  3NGD A;  1DK3 A;  2PFP A;  5J2A A;  3B0Y A;  4Q44 A;  2IMW P;  1TK0 A;  4R8U A;  8ICQ A;  2ZH5 A;  1RXW A;  4TUS A;  5KFP A;  4UD4 A;  4KLT A;  3PNC A;  4RQ0 A;  4ECR A;  4B9V A;  3GV8 B;  1COO A;  3PW7 A;  1S0V A;  2ID1 A;  4JWN A;  4I2D A;  3MR3 A;  3M9M B;  2MAX A;  1ZQU A;  4O3P A;  2AGO A;  2JEI A;  7ICL A;  1LB2 B;  4I29 A;  5KFD A;  4F2S A;  4NY8 A;  3UXO A;  3RJG A;  1MIW A;  2W9B A;  3JZ0 A;  2VAN A;  9ICW A;  3OVB A;  1ZQT A;  4QZH A;  4O3R A;  4JV1 A;  3M9N B;  5HHH A;  4IQU A;  3QZ7 A;  2WTF A;  4M2Y A;  3LWL A;  3BQ0 A;  2I9G A;  4XQ8 A;  1BPY A;  9ICO A;  4WBY A;  4EZ6 A;  4IG8 A;  4P2H A;  1BNP A;  4KIT B;  3HW8 A;  4ED8 A;  4I2F A;  5D46 A;  4MEY A;  2BCV A;  4RWN A;  4F4W A;  4GC6 A;  4F5R A;  2A1J A;  9ICI A;  4S3N A;  2XY6 A;  1UT5 A;  3M8R A;  3ZDA A;  4M0A A;  2BPG A;  4P4M A;  4GC7 A;  3UPQ A;  2DVI A;  2IA6 A;  1IM4 A;  1S0O A;  4J9P A;  3SV3 A;  5J2I A;  5DKW A;  8ICB A;  1L3V A;  1C7Y A;  4RUC A;  1JQR A;  4DEZ A;  3C5F A;  3C2M A;  5BOL A;  3UQ0 A;  9ICM A;  5IIN A;  5KFG A;  1TVA A;  5KFT A;  3OJU A;  5L1L A;  1X9S A;  3C2L A;  4ECW A;  1BPX A;  2KP7 A;  1ZQB A;  4XRH A;  2ZH4 A;  4DOB A;  4Z6C A;  1QSL A;  3Q8R B;  1OU5 A;  2JEG A;  5HMM A;  2ZUB A;  5KG4 A;  4ELU A;  5EOZ A;  1NJZ A;  5J2K A;  2ZH3 A;  9ICR A;  4X4R A;  3FYH A;  5HML A;  4KN4 A;  3UPS A;  2PFO A;  4I2C A;  4KLQ A;  4P4P A;  4DFP A;  4X4Q A;  2XGP A;  7ICH A;  3PY8 A;  1ZQI A;  5J2H A;  4I2H A;  4UBB A;  2HHV A;  1ARO P;  3HJ4 A;  2P6U A;  1U4B A;  4EYH B;  4J9L A;  1S77 D;  3SI8 A;  1UA0 A;  5BPC A;  5IIL A;  1KLN A;  5KFF A;  1Z00 B;  5J0T A;  1NK0 A;  2C2D A;  2FMP A;  2BR0 A;  3PO5 A;  2ZJA A;  3TFS A;  4DO9 A;  4ECV A;  5DLF A;  1ZQR A;  4NLG A;  1NJW A;  1L3T A;  5HRK A;  3RJF A;  4I2J A;  1NKC A;  2UVV A;  2MUT A;  2IBK A;  2V4Q A;  3G6X A;  8ICS A;  3MGH A;  1SL0 A;  4WC0 A;  3T5K A;  4M04 A;  4TUP A;  5IIM A;  1XS9 D;  2HW3 A;  4RQ4 A;  4RUA A;  7ICE A;  5DEC A;  1RXV A;  1KFD A;  2DFL A;  5J0W A;  1KDH A;  5CJ7 A;  7ICK A;  1JN3 A;  4RQ8 A;  4UAZ A;  4UB3 A;  1KEJ A;  4KLO A;  2FPM A;  3Q8Q B;  4R8U B;  4DOA A;  1ZQZ A;  4O9M A;  7ICS A;  3B0X A;  4Q43 A;  1ZJM A;  9ICJ A;  1R8A A;  2W9A A;  3OVA A;  3WFR E;  3HPO A;  1Y88 A;  1XO1 A;  4BWJ A;  1KNY A;  2NRW A;  3AQK A;  2V4R A;  3EPI A;  4F4X A;  5KT7 A;  9ICP A;  2V9W A;  2DPJ A;  5KT6 A;  1UEV A;  3TAP A;  2BQ3 A;  1NK8 A;  1N48 A;  3JPP A;  4J9N A;  8ICI A;  3UXN A;  4O0I A;  2BE3 A;  4ED3 A;  1TK8 A;  3ISD A;  4AT9 B;  1JXL A;  5DB9 A;  1T4G A;  2DRA A;  5CHG A;  4ED6 A;  2HHP A;  1TAQ A;  1X2I A;  3PO4 A;  4KLU A;  3RJE A;  3Q8M A;  2W9B B;  2C22 A;  1BNO A;  2PBE A;  1XSP A;  2AGQ A;  3MDA A;  9ICL A;  4X4P A;  5JUM A;  4QZG A;  5KFS A;  4JV0 A;  3MR2 A;  5IIJ A;  1ZQP A;  2J6T A;  1ZQD A;  4ATB B;  4WC4 A;  1PZN A;  2ZUD A;  5J0Q A;  4QZI A;  1L5U A;  8ICF A;  4BWM A;  5KG6 A;  5KFW A;  3GQC A;  5L1I A;  4BDP A;  2PI4 A;  2M2U A;  2ZHA A;  4R66 A;  4YN4 A;  3PX4 A;  4NXZ A;  5J2G A;  3H40 A;  5DBC A;  4DQI A;  4NM1 A;  4QW8 A;  4NKT A;  2M2T A;  5HRI A;  3OVS A;  2A1J B;  2PXI A;  3SYZ A;  5HRE A;  3MR5 A;  4ECQ A;  4LZG A;  4YR0 A;  5J0X A;  4X4U A;  3EWA A;  4BGD A;  3K4G A;  4RWO A;  7ICR A;  2KZZ A;  4M9G A;  9ICX A;  1WOT A;  1N56 A;  5J2J A;  2FMS A;  3RR7 A;  3E2E A;  4NKU A;  2ZHB A;  3Q8P B;  1T7P A;  3KHR A;  4X4S A;  5DB8 A;  3QE9 Y;  1PX5 A;  2BKE A;  4PHP A;  2NRV A;  2Y1I A;  7ICI A;  1XC9 A;  4DL3 A;  1MQ2 A;  2FPK A;  5DB7 A;  4FO6 A;  2B21 A;  1NZP A;  4RZR A;  4E8F A;  7ICT A;  1ZET A;  3PMN A;  1MC8 A;  4I27 A;  4X0B A;  4FHX A;  4QZE A;  4EBJ A;  5F9L A;  4O3O A;  5J0P A;  4B9U A;  4I28 A;  5KG1 A;  3QEA Z;  4O3S A;  8ICH A;  5HRL A;  9ICE A;  1ZQG A;  4KLG A;  3NYB A;  2W8L A;  4YG2 A;  5HP4 A;  3RB6 A;  1K1S A;  1HUZ A;  8ICR A;  8ICC A;  3ZD9 A;  4X4N A;  4IR9 A;  4MFC A;  3H4B A;  2ZJ8 A;  1DGS A;  1KSP A;  2JEF A;  3V7L A;  3ZDD A;  2XO7 A;  1QSY A;  4M5D A;  3C66 A;  2JZB A;  3PR5 B;  4NLN A;  7ICO A;  3MGI A;  4F5Q A;  1SL1 A;  4R65 A;  5L9X A;  4J9K A;  4PPX A;  2AJQ A;  4WC6 A;  5KFE A;  4O3Q A;  8ICP A;  5DLG A;  1NK4 A;  2ASL A;  2MUT B;  2FMQ A;  8ICW A;  4EBC A;  3RR8 A;  3RTV A;  4E7X A;  4F5N A;  3PW5 A;  4UB2 A;  3HX0 A;  2RFF A;  4KMU A;  3UQ2 A;  4DFJ A;  4LZD A;  5DG7 A;  1EXN A;  2ASJ A;  4QZC A;  2BCU A;  4B9L A;  2F1I A;  9ICH A;  5EWE A;  2AU0 A;  1A76 A;  3BQ2 A;  4ELT A;  2R8J A;  4F91 B;  3EPG A;  3LDA A;  3LQC B;  5L1J A;  4ED1 A;  1K1Q A;  4XQ7 A;  9ICN A;  4F5P A;  4X0A A;  4RWQ A;  3OHA A;  1V9P A;  1ZQM A;  4EZ9 A;  7ICP A;  4DQP A;  3H38 A;  1ZQY A;  4QWE A;  1HJP A;  1LV5 A;  5J2B A;  5HHI A;  1NKE A;  3FDS A;  1TFY A;  3Q8K A;  2BPF A;  1D9F A;  3H37 A;  3PW0 A;  2W9M A;  2DR5 A;  8ICE A;  3BQ1 A;  2KN7 A;  4C8L A;  1ZQE A;  5CP2 A;  1SKS A;  1SZP A;  9ICQ A;  4EP7 A;  1KTQ A;  5IIO A;  4MEX A;  8ICL A;  3H7I A;  7ICM A;  4DL4 A;  4RU9 A;  1BGX T;  3V7J A;  4GXJ A;  1Q78 A;  4DLG A;  4FBT A;  4ZH4 A;  2R8K A;  1Z3E B;  5HNK A;  5DB6 A;  5J2C A;  3RRH A;  1B43 A;  3TQ1 A;  3GIJ A;  1ZQA A;  4IRC A;  8ICO A;  8ICN A;  3MAB A;  4P4O A;  1KFT A;  2PFN A;  4RNN A;  4FHY A;  5EWG A;  3TAN A;  8ICA A;  4J9O A;  4M6W A;  3TFR A;  4WC5 A;  4K4H A;  4UQG A;  3GDX A;  4K4I A;  3V6K A;  1SKR A;  4WC2 A;  2M9N A;  5IIK A;  4TUQ A;  4KLI A;  7ICF A;  4ECY A;  4UB4 A;  9ICB A;  2JEJ A;  4MF8 A;  2KZ3 A;  4EBK A;  2HVH A;  4YVZ A;  3ZDC A;  3BJY A;  4IR1 A;  3JPT A;  4DSL A;  4Z6E A;  4TUR A;  1U45 A;  3OHB A;  5KT2 A;  2FLL A;  4C8K A;  5CB1 A;  2C28 A;  4ECU A;  1XSL A;  1D8Y A;  4I2G A;  4DSJ A;  2LYH A;  5F9N A;  5DBA A;  4QZF A;  3BDP A;  1FA0 A;  4KTQ A;  4PHD A;  1ZQS A;  4F50 A;  1MQ3 A;  2HHS A;  3UXP A;  2ZUC A;  1UT8 A;  5KG0 A;  4LVS A;  2J6U A;  4DWI A;  2KFZ A;  2HVI A;  1NOM A;  4DSK A;  8ICZ A;  7ICQ A;  2ZH9 A;  4ELV A;  3JYY A;  4F93 B;  4GXK A;  3H3A A;  3KHG A;  4RPZ A;  4DLE A;  3PML A;  2HHT A;  2M2V A;  4RT2 A;  4FHW A;  3K75 D;  1Q79 A;  1S0M A;  4QZA A;  2NRT A;  2O5A A;  4JK1 A;  2XY7 A;  1BPD A;  2ASD A;  3HIY A;  8ICU A;  3V6H A;  4YD2 A;  4PHE A;  2AGP A;  3MDC A;  1JIH A;  4RT3 A;  5KFK A;  3SZ2 A;  4DS4 A;  4FBU A;  3C5G A;  4X5V A;  1S76 D;  1D9D A;  4C8N A;  3H8W A;  1VFG A;  3AU6 A;  1TK5 A;  3OUY A;  4RPY A;  1BPE A;  2VA8 A;  2IHN A;  2JZB B;  1CUK A;  3G6V A;  4TQS A;  2R8I A;  4DL6 A;  4RQ6 A;  3RJJ A;  4BXO A;  4WBZ A;  3H4D A;  2KTQ A;  1ZYQ A;  2H5X A;  5J2F A;  4X4O A;  2XCA A;  3V7K A;  3PVX A;  2FLN A;  4UAW A;  3KHL A;  1U48 A;  2ZH1 A;  1ZJN A;  2Q0Z X;  1IXR A;  1DOQ A;  5KFB A;  1S0N A;  2M2W A;  3ISC A;  3RJI A;  1NJX A;  3RB0 A;  1YLQ A;  4KLD A;  5CR0 A;  2ZH6 A;  1RPL A;  3THV A;  3PR4 A;  1L3U A;  1X9M A;  4IRD A;  2ZH7 A;  1S97 A;  4J9R A;  4DL5 A;  3QEB Z;  1QSS A;  8ICX A;  2BPC A;  4QWC A;  1JAJ A;  4DQR A;  3N4M B;  4NLK A;  5KFN A;  3G6Y A;  3GV5 B;  7ICN A;  8ICJ A;  4WC7 A;  4DQQ A;  4DF8 A; 
#chains in the Genus database with same CATH topology
 3CRX A;  4NL9 A;  3A0H U;  4ECT A;  5CA7 A;  5J29 A;  5KG5 A;  4CNQ A;  2BDP A;  2NRK A;  4F92 B;  1RYU A;  3PSF A;  2P35 A;  3BQ7 A;  4AT8 A;  1WWV A;  4R64 A;  2UVR A;  8ICT A;  3TAQ A;  5J0U A;  4YP3 A;  3H39 A;  1Z00 A;  7ICU A;  5ALH A;  2BCS A;  1ZD3 A;  3WKC A;  5DED A;  3PSI A;  4KLS A;  4MHV A;  2K4I A;  5DQH A;  4Q8F A;  1XU4 A;  4UD5 A;  4OAH A;  2B0C A;  1MIV A;  1V97 A;  4IRK A;  3N97 B;  1WCN A;  2NO5 A;  3AQL A;  2GWS A;  3HJ1 A;  3VC8 A;  2W9C A;  4DCC A;  1S9F A;  3C2K A;  4FHV A;  5KFJ A;  5KFI A;  3KKA C;  4KLH A;  5AIA A;  5DG9 A;  2ZTD A;  5ALN A;  4M9H A;  4K98 A;  4F2R A;  1R89 A;  1OUQ A;  1X9W A;  3GIK A;  3RAQ A;  2AQ0 A;  5KFM A;  3WFQ E;  2XY5 A;  2QB0 B;  3K1Z A;  1NK5 A;  9ICF A;  3EYZ A;  3F5E A;  4RQ5 A;  4FH5 A;  3PX0 A;  2VA3 A;  2XIC A;  3OV7 A;  4BXO B;  5C5J A;  2AQ4 A;  2KJ5 A;  2KD1 A;  2BQR A;  2BHN A;  3HP6 A;  4ZOH C;  2ISO A;  2D6F C;  4HYK A;  4KM5 A;  5J2E A;  3M6Z A;  5HR9 A;  1SV0 A;  3PW2 A;  3JCF A;  5HR6 A;  3C1Z A;  1T3N A;  2XGQ A;  2F3N A;  3JPQ A;  4C8O A;  4DSI A;  3GII A;  5E79 U;  4DSF A;  2FE9 A;  2R8H A;  5KFR A;  2DR7 A;  1SL2 A;  2YQE A;  2P66 A;  3IG8 A;  4WQK A;  2DKX A;  2DR8 A;  3M6K A;  1MSW D;  1YT3 A;  2DRB A;  1Z1B A;  1B22 A;  1UPH A;  3QUQ A;  2NRX A;  1VJ7 A;  4G9B A;  3L9D A;  4UB5 A;  2YMM A;  3LVV A;  2ZH2 A;  5J2D A;  4US8 A;  2RDJ A;  2J6S A;  1L8O A;  3TAD A;  3JPS A;  3L4P A;  3AU2 A;  4RNO A;  1RG6 A;  9ICK A;  5ALL A;  2ZTC A;  3NVV A;  4NLZ A;  4F3O A;  4IC9 A;  4OJ5 A;  4JWM A;  2W04 A;  4WH5 A;  3BQT A;  4DFD A;  5KG3 A;  3JPR A;  4RQ7 A;  2K8A A;  3WK8 A;  4J9Q A;  4QZ9 A;  3JPN A;  4GXI A;  2YY6 A;  1UQV A;  2B4V A;  1A77 A;  4MFA A;  3RB3 A;  2K8B B;  3TKA A;  4O5E A;  3MR6 A;  3B9J A;  3ETL A;  4G3I A;  5TZV A;  3TI0 A;  4E0D A;  2PMZ F;  4YMM A;  4ECX A;  2PFQ A;  2JRZ A;  2R8G A;  3NGD A;  2PFP A;  4EV6 A;  3B0Y A;  3SR6 A;  8ICQ A;  2F2A B;  3GV8 B;  1COO A;  1S0V A;  4B6J A;  1ZRM A;  4O3P A;  2AGO A;  4I0U A;  5KFD A;  4F2S A;  2EDU A;  2W9B A;  4O3R A;  4IQU A;  3QZ7 A;  3NVZ A;  2E1F A;  1JUD A;  2JXJ A;  4XQ8 A;  9ICO A;  4EZ6 A;  4MEY A;  3BZC A;  4GC6 A;  4F5R A;  4S3N A;  9ICI A;  2W54 A;  3ZDA A;  2IA6 A;  5GTH U;  4CDG A;  5J2I A;  2DKZ A;  2F77 X;  4DEZ A;  2W11 A;  5BOL A;  5KFG A;  4XRH A;  5D62 A;  5KG4 A;  4ELU A;  1PVP A;  5J2K A;  9ICR A;  3FYH A;  1Q3U A;  2KEY A;  4UBB A;  3HJ4 A;  4C4R A;  2P6U A;  1U4B A;  4J9L A;  1UA0 A;  2WHE A;  1KLN A;  4LEV A;  5J0T A;  3PSP A;  5ALP A;  2ZJA A;  3D6J A;  2IBK A;  2V4Q A;  2W03 A;  1SL0 A;  4WC0 A;  3T5K A;  4TUP A;  5IIM A;  3M7D A;  1XS9 D;  2FCL A;  5DEC A;  1RXV A;  2KSO B;  1KDH A;  4KB6 A;  4C4S A;  4K97 A;  5EE3 A;  1ZQZ A;  3OVA A;  9ICJ A;  2W9A A;  3F53 A;  4BWJ A;  2V4R A;  2V9W A;  3TAP A;  1NK8 A;  2EH9 A;  8ICI A;  4AT9 B;  4O0I A;  1X2I A;  2NYV A;  3N28 A;  2C22 A;  2YTU A;  1Q8K A;  9ICL A;  2ZIW B;  4XJE A;  2KV2 A;  5KAF U;  5CHE A;  1ZQD A;  4Y2Q A;  2ZUD A;  8ICF A;  5KFW A;  5L1I A;  2ZIX A;  2ZHA A;  4BDP A;  4R66 A;  5J2G A;  2HSZ A;  4QJF B;  4NKT A;  1IIP A;  3OVS A;  3KOO A;  3SYZ A;  5HRE A;  3MR5 A;  4ECQ A;  2VJ4 A;  3K4G A;  1MA7 A;  5AKH A;  3H0L B;  1N56 A;  4JLZ A;  7ICI A;  4DL3 A;  1N60 A;  2B21 A;  1NZP A;  4RZR A;  7ICT A;  3HKZ F;  1ZET A;  1MC8 A;  1CRX A;  1F44 A;  5F9L A;  4B9U A;  5KG1 A;  1KKX A;  5HRL A;  4KLG A;  2RQ5 A;  4QIW F;  4PZO A;  3RB6 A;  4YG2 A;  1HUZ A;  2HI0 A;  3J81 j;  2GOL A;  3F2D A;  1X6I A;  1LVH A;  1KSP A;  4OAG A;  2E8M A;  3V7L A;  3ZDD A;  2XO7 A;  4OCZ A;  4M5D A;  2JHD A;  1A6S A;  3PR5 B;  4NLN A;  4F5Q A;  5L9X A;  4J9K A;  2AJQ A;  4O3Q A;  8ICP A;  5DLG A;  2ASL A;  1TAM A;  3H0R B;  3PW5 A;  3K1R B;  4ACO A;  5DG7 A;  5ALK A;  4LEZ A;  1ZD5 A;  2BCU A;  2F1I A;  3DV9 A;  2AU0 A;  1A76 A;  4XQ7 A;  5ALQ A;  3IP4 B;  9ICN A;  4EZ9 A;  1WWU A;  4UAV A;  7ICP A;  3NVY A;  1ZQY A;  1N5X A;  3ERC C;  1HJP A;  4Y2J A;  3FM9 A;  2W3S A;  3Q8K A;  2BPF A;  1J2M A;  1YZ6 A;  2DR5 A;  8ICE A;  3BQ1 A;  5AKZ A;  4C7Z A;  4KX5 A;  1SZP A;  3C28 A;  4MEX A;  5IIO A;  2F76 X;  3H7I A;  4DL4 A;  4RU9 A;  1BGX T;  4GXJ A;  1Q78 A;  4DLG A;  2H3F A;  5B3Q A;  8ICA A;  2JV3 A;  4J9O A;  3D2N A;  2E1E A;  3TFR A;  4UQG A;  3GDX A;  1SKR A;  4WC2 A;  5IIK A;  4TUQ A;  7ICF A;  4ECY A;  4UB4 A;  1S8O A;  2KZ3 A;  4MF8 A;  2HVH A;  4Y2S A;  2FI1 A;  3ZDC A;  3BJY A;  4DSL A;  4Z6E A;  2EAN A;  4EEL A;  4I2G A;  2LYH A;  5F9N A;  2HHS A;  3UXP A;  2G5H B;  1UT8 A;  4CF5 A;  2G06 A;  8ICZ A;  4DSK A;  7ICQ A;  4F93 B;  2BBJ A;  4DLE A;  2M2V A;  3NRZ A;  4FHW A;  1Q79 A;  4JK1 A;  2G5I B;  4C0Z A;  3KKA A;  1X6J A;  1JIH A;  5KFK A;  2PMZ C;  3OTQ A;  4C8N A;  1VFG A;  2IUB A;  2JZB B;  1HIW A;  4TQS A;  3H4D A;  4OD0 A;  4X4O A;  3MCR A;  2FLN A;  3KHL A;  4C80 A;  2A19 A;  2PKE A;  3RJI A;  3THV A;  2GLE A;  3HJE A;  5AKJ A;  2RHF A;  4J9R A;  4DL5 A;  1QSS A;  8ICX A;  4K8V A;  8ICJ A;  1S5L U;  2OH2 A;  5TIS U;  4WCW A;  5B3P A;  4KLF A;  3OWG A;  1TKD A;  5KFH A;  1L7M A;  5DQG A;  4XA5 A;  3AQN A;  1ZOL A;  4QW9 A;  4GFJ A;  2HHW A;  4JUZ A;  2M0N A;  4KLM A;  5DQI A;  1VLB A;  2IHM A;  4DFM A;  1LKY B;  1RZT A;  2HBK A;  3GIM A;  4QZ8 A;  5J0O A;  3C18 A;  3QU2 A;  2ODG A;  4FHP A;  4M6W B;  3MFI A;  1WG8 A;  5AM1 A;  3T79 A;  5JU5 A;  3RBD A;  5GTI U;  4DL2 A;  1BPB A;  5AI4 A;  1TFR A;  4B9N A;  4TQR A;  1JI7 A;  3OJS A;  2Q66 A;  4KLE A;  3AQM A;  1KRP A;  3H8S A;  1BPZ A;  9ICC A;  4BUG A;  4X4V A;  1QLN A;  4K4G A;  4I2A A;  4RNM A;  4AYB F;  3EUB 2;  2ZIV A;  4AT7 A;  5DGA A;  1T8E A;  2WB1 F;  2XI9 A;  2RDI A;  3OUY B;  2BDU A;  2I5H A;  2LM1 A;  3WK6 A;  4Q8E A;  2Y9T A;  4JV2 A;  2DR9 A;  3EW9 A;  4UB6 U;  4CRX A;  4LT6 A;  3QU4 A;  4O5K A;  3JPO A;  3GV7 B;  1UET A;  4DFK A;  2BQU A;  1DK2 A;  5KFV A;  2HMX A;  9ICS A;  1DXS A;  7ICJ A;  2K89 A;  4IQW A;  2AHO B;  5DDM A;  2KZM A;  9ICG A;  1NK7 A;  3BZK A;  2E8N A;  4F4Y A;  5J0Y A;  4ECS A;  2K4E A;  5ALU A;  3MBY A;  3T5L A;  4AT8 B;  4WC3 A;  3SAH A;  2C2E A;  4IQT A;  4F72 A;  3EZ5 A;  3F2C A;  4F5O A;  1L3S A;  5KT5 A;  3OSP A;  5F2V O;  4ED0 A;  3O0F A;  5KTQ A;  5KFY A;  1V4A A;  2P6R A;  1ZQJ A;  4NM2 A;  5AI8 A;  1KFS A;  4O68 A;  3M9O B;  3PV8 A;  2FJ6 A;  3SV4 A;  4EX6 A;  5KG7 A;  3HKZ C;  4I2B A;  3KHH A;  2W9C B;  2CPR A;  8ICM A;  2KG5 A;  3RAX A;  1A0P A;  3FC4 A;  4RQ3 A;  4R63 A;  4QIW C;  3RB4 A;  2O1P A;  3AL0 B;  5KT3 A;  3AEV A;  4FZN A;  8ICK A;  1HUO A;  5L1K A;  3I28 A;  3UMG A;  1NJY A;  1ZQC A;  4OJ6 A;  4EX7 A;  4QWB A;  5KG2 A;  1Q3V A;  4M9L A;  2BCQ A;  4O5C A;  5DBB A;  2DL0 A;  1C20 A;  1IG6 A;  3UMB A;  2JH1 A;  4RQ1 A;  4KLL A;  4F4K A;  2HBL A;  7ICG A;  4O3N A;  1URJ A;  1DK3 A;  5KFL A;  5J2A A;  2IMW P;  4Q44 A;  4R8U A;  3QX7 A;  1RXW A;  2HN2 A;  5KFP A;  3PNC A;  4RQ0 A;  3FAH A;  2YMQ A;  4FFD A;  2ID1 A;  2AXT U;  3MR3 A;  2JEI A;  7ICL A;  1LB2 B;  3UXO A;  2WAQ F;  5AKG A;  9ICW A;  3OVB A;  5ALI A;  3ONN A;  1ZQT A;  3M9N B;  5HHH A;  2WTF A;  4PZN A;  3LWL A;  2I9G A;  1BPY A;  1GPJ A;  4WBY A;  4IG8 A;  4U7C A;  4KIT B;  3WU2 U;  2W7O A;  4RWN A;  2A1J A;  1UT5 A;  3DDH A;  4EED A;  4M0A A;  2BPG A;  5AI6 A;  2GO7 A;  2LM4 A;  1JQR A;  5IIN A;  3OJU A;  4WQL A;  4ECW A;  1BPX A;  4OJL A;  1K5O A;  4BX9 C;  1QSL A;  1OU5 A;  1O08 A;  2ZUB A;  4GIB A;  3UPS A;  2PFO A;  4X4Q A;  4Y2V A;  1ZQI A;  5J2H A;  3PY8 A;  2HHV A;  3ICX A;  4EYH B;  1S77 D;  2YMP A;  5BPC A;  4NXV A;  5KFF A;  5G5G A;  4NLB A;  2FMP A;  3NAS A;  4ECV A;  4P0Q A;  1ZQR A;  4I2J A;  1NKC A;  4LEY A;  5KL1 B;  2MUT A;  3G6X A;  5AK6 A;  2E5S A;  2QAR A;  1QQ5 A;  3PZP A;  2DFL A;  3OPX A;  2E8O A;  7ICK A;  1JN3 A;  4RQ8 A;  3PST A;  1JRO A;  2JMG A;  4O9M A;  3B0X A;  4Q43 A;  4LJX A;  2GH1 A;  4AP9 A;  1N48 A;  3JPP A;  3AN1 A;  4UAR A;  3TAC B;  3ISD A;  2DRA A;  4ED6 A;  1TAQ A;  5ALW A;  2I6X A;  2W9B B;  2PBE A;  1F5S A;  2AGQ A;  5ALO A;  5CFT A;  2HDO A;  5KFS A;  3WKB A;  4ATB B;  1D8B A;  3WKD A;  5J0Q A;  5KG6 A;  2M2U A;  3ER9 B;  2PI4 A;  4NXZ A;  5AKK A;  4QW8 A;  3QNM A;  3H8M A;  5J0X A;  2Y0S F;  4J03 A;  1N2X A;  5J2J A;  2ZHB A;  3KHR A;  2YN4 A;  4AYB C;  3L3F X;  5DB7 A;  1WUD A;  4FO6 A;  1Z19 A;  4JMU A;  3AQF A;  1L7O A;  4EBJ A;  4O3O A;  5ALZ A;  9ICE A;  1RQL A;  5HP4 A;  1K1S A;  8ICC A;  3ZD9 A;  2W55 A;  2LPE A;  3NWI A;  2WFA A;  3ETR A;  3RF9 A;  4R65 A;  4PPX A;  2KIW A;  4WC6 A;  5KFE A;  3RFA A;  8ICW A;  2EWR A;  3RR8 A;  2EQY A;  2RFF A;  4KMU A;  2G0A A;  3UQ2 A;  2ASJ A;  4Y2R A;  4ELT A;  5L1J A;  3QUB A;  4ED1 A;  4F5P A;  4HX0 A;  4X0A A;  2B51 A;  5ALS A;  1ZQM A;  3H38 A;  4QWE A;  1B4F A;  4UAT A;  1AQ6 A;  1D9F A;  3PW0 A;  2W9M A;  5CP2 A;  4EP7 A;  9ICQ A;  3QU9 A;  3R9K A;  5AHX A;  4ZH4 A;  4RQN A;  2R8K A;  5J2C A;  8ICN A;  3TQ1 A;  1ZQA A;  1L7N A;  1JAL A;  4EEN A;  5ALJ A;  2ZIX B;  2R18 A;  1OXJ A;  4WC5 A;  4K4I A;  2W7P A;  1DRG A;  2JEJ A;  4YVZ A;  4IR1 A;  2ESE A;  3NVW A;  2OEH A;  3OHB A;  5KT2 A;  4X4N A;  4ECU A;  4DSJ A;  5J8Y C;  4KTQ A;  1ZQS A;  3GU3 A;  4F50 A;  2VKQ A;  2KFZ A;  4U6P A;  2HVI A;  4UAU A;  2ZH9 A;  4ELV A;  4GXK A;  2MA1 A;  3KHG A;  3PML A;  2HHT A;  4RT2 A;  4BJQ A;  1S0M A;  2NRT A;  5HR7 A;  4WJ3 B;  1X66 A;  1BPD A;  1QQ7 A;  3V6H A;  1PK1 A;  3KBB A;  2BBH A;  4X5V A;  3A0B U;  1S76 D;  1D9D A;  1TK5 A;  3I76 A;  1BPE A;  2IHN A;  2KOB A;  4FZM A;  2R8I A;  4DL6 A;  4RQ6 A;  2XID A;  4WBZ A;  2KTQ A;  4ICA A;  2H5X A;  2OHF A;  2XCA A;  2G09 A;  3BS7 A;  2AH5 A;  2Z7J A;  3ISC A;  4OJO A;  1YLQ A;  4KLD A;  5CR0 A;  1RPL A;  1L3U A;  2EAP A;  5AKE A;  2K60 A;  4QWC A;  4NLK A;  5KFN A;  3GV5 B;  3V72 A;  5KFA A;  5JTG A;  5KFU A;  2C2R A;  2ZTE A;  2EZZ A;  3RJH A;  4KX3 A;  5BOM A;  4QZD A;  3LYS A;  2H3Z A;  5HRB A;  2KK0 A;  4B9M A;  3RH4 A;  5HC9 A;  3CW2 C;  2ATL A;  4DQS A;  1WCL A;  2F8L A;  4K96 A;  9ICV A;  5CFS A;  5FP0 A;  4PH5 A;  3CNH A;  3WK7 A;  5DG8 A;  4Q45 A;  1KN5 A;  3Q8S B;  5D61 A;  4F71 A;  1ZQV A;  4KN7 A;  3TAR A;  1SKW A;  3U26 A;  4DL7 A;  2DPI A;  3QZ8 A;  4E80 A;  5III A;  3C21 A;  3C1Y A;  4EYI B;  4UAS A;  1KNY A;  1XSN A;  1ZQN A;  4ED2 A;  1SB3 C;  3QYP A;  3ISB A;  4F8R A;  3V6J A;  1R8C A;  3IHQ B;  4AT9 A;  1MN8 A;  3WFO A;  3HT3 A;  2MSN A;  4X4T A;  1JXE A;  3KTQ A;  2QKQ A;  3KD3 A;  3SEN A;  2E3T A;  4B9T A;  1L7P A;  4WC1 A;  2ZH8 A;  1RYR A;  3L5K A;  4C8M A;  3QU5 A;  1TV9 A;  3RBE A;  4YXM A;  3NTU A;  3Q8L A;  4US9 A;  1ZQH A;  3WK9 A;  1N62 A;  2HN1 A;  2GA9 D;  2HHU A;  7ICV A;  5K4L A;  3BS5 A;  8ICY A;  2KVS A;  1H38 A;  5CWR A;  4J9M A;  2KFN A;  2NV3 A;  3GFK B;  1JX4 A;  1ZQL A;  1QH9 A;  4C4T A;  5D4B A;  5HRF A;  4QWD A;  3RRG A;  4XUS A;  4MF2 A;  5KFO A;  4EBE A;  4MFF A;  2HOF A;  2K4H A;  2BZF A;  4EBD A;  5F3X B;  5ALT A;  4PHA A;  4GLX A;  5J0S A;  2RRD A;  2JH7 A;  4YMO A;  5JTI A;  2Y9U A;  3IV6 A;  4I2I A;  1TAU A;  4PGY A;  2KIC A;  3T5J A;  4ED7 A;  2F1H A;  2E8P A;  8ICG A;  3UM9 A;  1JMS A;  1NK6 A;  4I2E A;  3IG5 A;  3NRW A;  2FLP A;  9ICU A;  3CP8 A;  1XWL A;  2UVW A;  4DOC A;  3HIY A;  2ZIV B;  5DDY A;  4AT7 B;  1S10 A;  2PI5 A;  5EWF A;  2W8K A;  4OJP A;  4YQW A;  1NKB A;  4DS5 A;  5D49 A;  3SD7 A;  1D8L A;  5CFU A;  1ZQK A;  5EE9 A;  4PL1 A;  5AIB A;  5KFQ A;  4P0P B;  4Z6D A;  1Z4O A;  1U49 A;  3ZDB A;  3M8S A;  2KHV A;  4YR2 A;  3OGU A;  3LWM A;  3MFH A;  3RH5 A;  2IOH A;  3N7R C;  1KW4 A;  2NRZ A;  1ZQF A;  4NJ8 A;  1IV8 A;  1TK0 A;  2IHO A;  2ZH5 A;  5AK4 A;  3ZI4 A;  1VDV A;  3PW7 A;  3AMZ A;  4I2D A;  5AI0 A;  3IDW A;  2MAX A;  1ZQU A;  3KZI U;  3M9M B;  4I29 A;  4NY8 A;  3RJG A;  4UB8 U;  3JZ0 A;  1UCV A;  4JV1 A;  4M2Y A;  2VJ5 A;  3HW8 A;  2BCV A;  1X9X A;  2KKP A;  2XY6 A;  1NI3 A;  2DVI A;  4GC7 A;  1J97 A;  4J9P A;  2H3Q A;  3SEI A;  1L3V A;  1DGJ A;  2ZXH A;  2L5Y A;  2VIX A;  3C5F A;  3C2M A;  1TVA A;  1X9S A;  5KFT A;  5L1L A;  5AKI A;  2F44 A;  3C2L A;  2ZH4 A;  4DOB A;  4Z6C A;  2ZIU A;  2JEG A;  5HMM A;  2A3V A;  2ZH3 A;  4X4R A;  5AKY A;  5CEH A;  4KN4 A;  2HBM A;  4P4P A;  5CRX A;  2K8C B;  4DFP A;  1ARO P;  1SWW A;  1Z00 B;  2KNJ A;  2BR0 A;  3PO5 A;  4DO9 A;  5DLF A;  5HRK A;  1NJW A;  2UVV A;  3C29 A;  2LI6 A;  3MGH A;  1V38 A;  2HOQ A;  5H2F U;  4M04 A;  3NUQ A;  2D3D A;  2HW3 A;  4RQ4 A;  1X40 A;  1KFD A;  2OYY A;  5J0W A;  1FEZ A;  4O6A A;  2FPM A;  4R8U B;  5C0Y A;  3N7P D;  1R8A A;  3WFR E;  1Y88 A;  1XO1 A;  1RQN A;  2NRW A;  4F4X A;  5KT7 A;  1CI4 A;  2N1R A;  5KT6 A;  4MKP A;  5EE0 A;  4J9N A;  3UXN A;  4ED3 A;  4Y2Y A;  1T4G A;  5CHG A;  2B6G A;  3NVO A;  3RJE A;  3Q8M A;  1N63 A;  1XSP A;  5JUM A;  1ZQP A;  4WC4 A;  1L5U A;  4BWM A;  3GQC A;  1NZB A;  4YN4 A;  4NM1 A;  5ALM A;  2M2T A;  5HRI A;  2A1J B;  2PXI A;  4X4U A;  4LZG A;  2RP5 A;  4YR0 A;  3EWA A;  2KJ8 A;  2KZZ A;  1WOT A;  5JRT A;  5DB8 A;  1PX5 A;  2BKE A;  2K4P A;  4PHP A;  2Y1I A;  1XC9 A;  2G07 A;  2A1A A;  1MQ2 A;  1XO0 A;  4E8F A;  4Y2X A;  4I27 A;  5AI9 A;  4X0B A;  1ZD2 P;  4FHX A;  3QUT A;  1ZD4 A;  3GZF A;  4QZE A;  1YZ7 A;  5J0P A;  4Y2U A;  4O3S A;  1PK3 A;  2W3R A;  4FE3 A;  5KAI U;  3NYB A;  5J8Y A;  2W8L A;  8ICR A;  2ZJ8 A;  1DGS A;  3HRD D;  3N7S C;  3C66 A;  5ALF A;  7ICO A;  3MGI A;  1SL1 A;  4QNL A;  3WKA A;  4P0Q B;  1NK4 A;  2MUT B;  2KKV A;  3RTV A;  2QAR B;  4DFJ A;  4LZD A;  1EXN A;  5AM4 A;  4B9L A;  5EWE A;  2HBJ A;  3DEE A;  3BQ2 A;  3LQC B;  2R8J A;  2DQN B;  4DQP A;  2WF6 A;  5J2B A;  5HHI A;  3H37 A;  2HCF A;  2KE7 A;  2QB1 A;  4C8L A;  1SKS A;  2FDR A;  8ICL A;  1B0X A;  3LVW A;  5ALD A;  2KJ9 A;  4LEW A;  1SZH A;  3GIJ A;  4IRC A;  5A0L A;  4P4O A;  1KFT A;  4RNN A;  4FHY A;  5EWG A;  2LMR A;  2CRX A;  4K9A A;  3K7D A;  3V6K A;  2M9N A;  4KLI A;  1T3Q A;  4EBK A;  3JPT A;  4TUR A;  2WF5 A;  5CB1 A;  2C28 A;  1XSL A;  1D8Y A;  2KIV A;  5DBA A;  1KBU A;  2QLT A;  1MQ3 A;  3E0F A;  4LVS A;  2DBY A;  1NOM A;  3JYY A;  3H3A A;  2MU2 A;  4RPZ A;  1FIQ A;  2W43 A;  8ICU A;  4YD2 A;  4PHE A;  2O6K A;  3MDC A;  2QB0 A;  5ALE A;  3SZ2 A;  4DS4 A;  3QXG A;  1SIJ A;  3H8W A;  3AU6 A;  4RPY A;  5D63 A;  3AQE A;  5AM3 A;  4BXO A;  4O69 A;  4CE6 A;  2KVC A;  3QUC A;  3PVX A;  3EF2 A;  2ZH1 A;  1ZJN A;  2Q0Z X;  1IXR A;  5KFB A;  1S0N A;  2ZH6 A;  1X9M A;  2ZH7 A;  1S97 A;  1JAJ A;  4DQR A;  4WC7 A;  1U48 A;  1ZXI A;  2UVU A;  4PGQ A;  4IQV A;  1TE2 A;  3VCB A;  4FH3 A;  3H8J A;  3ZDE A;  9ICT A;  3ORY A;  4M9J A;  4IL6 U;  2WB1 C;  4N7R A;  2YB4 A;  1NK9 A;  1BVS A;  4RPX A;  1F5A A;  5AM5 A;  1U47 A;  3WFS C;  1SXE A;  5HRH A;  3GIL A;  3SAF A;  3KFU F;  2I1Q A;  3C23 A;  4KLJ A;  1TFW A;  3F5A A;  4B9S A;  4PGX A;  1QTM A;  4YD1 A;  2KMD A;  2Y1J A;  4QZB A;  4RQ2 A;  1FO4 A;  1ZQW A;  5AIC A;  1ZRN A;  4OAI Z;  5DGB A;  3HWT A;  2XC9 A;  1L8L A;  3ER8 C;  3NS1 A;  4FS1 A;  4ATB A;  5KNI A;  1PK1 B;  4F4Z A;  4WOY A;  4NXX A;  1KL9 A;  1ZQX A;  3IM1 A;  1ZQO A;  2ZG6 A;  2Q4T A;  3AUO A;  1UEU A;  3RH6 A;  5ALX A;  4YCX A;  3OSN A;  1MIY A;  2HHQ A;  5AK3 A;  1OW5 A;  5KL8 B;  2ZJ5 A;  4NWI A;  1UA1 A;  2JR5 A;  4UAY A;  1ZQQ A;  1CEZ A;  5AK5 A;  4NL9 C;  2OWO A;  1P7D A;  4EGW A;  1UHU A;  5KFZ A;  2EZY A;  4K9B A;  4YMN A;  3RJK A;  2VA2 A;  4RQM A;  4USA A;  4UBC A;  2BGW A;  4NXU A;  2ISP A;  2LYA A;  3M1Y A;  4UB1 A;  2HHX A;  3LK9 A;  1NO5 A;  5KFX A;  3UMC A;  4NXT A;  1O03 A;  4M47 A;  3PW4 A;  3PX6 A;  2YX8 A;  5ALY A;  1RYS A;  4M9N A;  4A8E A;  1U9L A;  2ES6 A;  4FS2 A;  2XCP A;  5HRD A;  4CCH A;  1FFV A;  3I1Y A;  3E58 A;  4RWP A;  4YFK A;  4EEK A;  5HRG A;  3QU7 A;  1V85 A;  4DSE A;  3T5H A;  3ZD8 A;  5J0R A;  4EEY A;  3T3F A;  5KT4 A;  3D2S A;  3F2B A;  4QWA A;  5G5H A;  2WAQ C;  1R8B A;  2F1J A;  4YXJ A;  1M6Y A;  2ALZ A;  4ECZ A;  1FFU A;  2CXY A;  1N5W A;  2BCR A;  1X42 A;  2G08 A;  5B66 U;  9ICA A;  1SV0 C;  2IOF A;  2LBO A;  1PVQ A;  2OXO A;  4J9S A;  2WF7 A;  8ICV A;  3AM9 A;  4YR3 A;  1JRP A;  2KHQ A;  3BS5 B;  4Z6F A;  5KFC A;  2FPL A;  4DF4 A;  4OO1 J;  3PHZ A;  3WFP A;  2KSO A;  2DWQ A;  1ECW A;  2B56 A;  1SGG A;  5ALV A;  4TUS A;  4UD4 A;  4KLT A;  4ECR A;  4B9V A;  2WF9 A;  1PVR A;  4JWN A;  3SQI A;  1N61 A;  3CK6 A;  2DGZ A;  1MIW A;  2VAN A;  5AI5 A;  4QZH A;  2ZIW A;  3BQ0 A;  3TAD C;  4P2H A;  1BNP A;  1QCK A;  4ED8 A;  4I2F A;  5D46 A;  4F4W A;  2OM6 A;  1L6N A;  3M8R A;  4P4M A;  3UPQ A;  1IM4 A;  1S0O A;  4PL2 A;  1SV4 A;  8ICB A;  5DKW A;  3MGV A;  5AM0 A;  5T14 A;  1C7Y A;  4RUC A;  1GO3 F;  9ICM A;  4NV0 A;  3UQ0 A;  2KP7 A;  1ZQB A;  3S6J A;  4EEB A;  3Q8R B;  2EZX A;  5EOZ A;  1NJZ A;  5HML A;  4I2C A;  2EAM A;  4KLQ A;  4JLX A;  3WK5 A;  2XGP A;  7ICH A;  4I2H A;  1Q46 A;  3SI8 A;  1XNS A;  3D2Q A;  5IIL A;  1RDF A;  1NK0 A;  2C2D A;  3PO4 A;  3TFS A;  4NLG A;  1L3T A;  2H3I A;  2ZXI A;  3RJF A;  2Y0S C;  2D8C A;  8ICS A;  3NKU A;  5AKL A;  4CF4 A;  1VJ5 A;  7ICE A;  4RUA A;  5CJ7 A;  4IS7 A;  4UAZ A;  4UB3 A;  1KEJ A;  4KLO A;  3Q8Q B;  4DOA A;  1ED1 A;  7ICS A;  1ZJM A;  5B5E U;  3HPO A;  3AQK A;  3EPI A;  9ICP A;  2DPJ A;  1UEV A;  2BQ3 A;  2BE3 A;  1TK8 A;  2HOI A;  3ED5 A;  1JXL A;  5DB9 A;  2HHP A;  4C7Y A;  4KLU A;  4FO1 A;  3WK4 A;  4CGZ A;  1BNO A;  4X4P A;  3MDA A;  4QZG A;  4JV0 A;  3MR2 A;  5IIJ A;  2J6T A;  1PZN A;  4QZI A;  4KMO B;  1T94 A;  4NLC A;  3PX4 A;  3H40 A;  5DBC A;  4DQI A;  4BGD A;  3IRU A;  4RWO A;  7ICR A;  4M9G A;  9ICX A;  2FMS A;  3RR7 A;  4NKU A;  3E2E A;  3SAG A;  3Q8P B;  1T7P A;  4X4S A;  3QE9 Y;  2NRV A;  1KQQ A;  2FPK A;  3PMN A;  3MC1 A;  2ZIU B;  5ALR A;  2F8K A;  4I28 A;  3QEA Z;  2GAF D;  8ICH A;  1ZQG A;  1SWV A;  4IR9 A;  4MFC A;  3H4B A;  2JEF A;  1QSY A;  3IN5 A;  2JZB A;  1ZQ1 C;  4JB3 A;  1NNL A;  2YML A;  2FMQ A;  1PUZ A;  4EBC A;  1F0M A;  4NXW A;  4E7X A;  4F5N A;  4FZL A;  4UB2 A;  3HX0 A;  4QZC A;  9ICH A;  1Z1V A;  4F91 B;  3LDA A;  3EPG A;  1K1Q A;  1WYG A;  4RWQ A;  3OHA A;  1V9P A;  2H3V A;  4CF3 A;  2YB1 A;  1LV5 A;  2MRL A;  1NKE A;  2LHT A;  3FDS A;  1TFY A;  2LKY A;  2KN7 A;  1ZQE A;  2IOF K;  1KTQ A;  1LKY A;  7ICM A;  1SXD A;  3V7J A;  4P0P A;  5EE1 A;  4FBT A;  1Z3E B;  5HNK A;  5DB6 A;  3RRH A;  8ICO A;  1B43 A;  5AM2 A;  3MAB A;  3KZX A;  4HAI A;  3SMV A;  2PFN A;  3TAN A;  4PJ0 U;  3ALR A;  4M6W A;  4K4H A;  9ICB A;  4UW9 A;  4K99 A;  1U45 A;  2FLL A;  1COK A;  4C8K A;  1FA0 A;  4QZF A;  3BDP A;  4O3M A;  1HEK A;  4PHD A;  2OCE A;  2ZUC A;  2CN1 A;  5KG0 A;  2J6U A;  4DWI A;  2JGA A;  3H0M B;  4Y2T A;  3HIL A;  2LYB A;  3K75 D;  4QZA A;  1J2N A;  5ALG A;  2O5A A;  2XY7 A;  2ASD A;  1Z4N A;  2AGP A;  2DUY A;  4RT3 A;  4FBU A;  2WF8 A;  3C5G A;  2EAO A;  4OAF A;  2RLT A;  3OUY A;  4Y2P A;  2VA8 A;  1QQ6 A;  5AKX A;  1CUK A;  3G6V A;  3RJJ A;  1ZYQ A;  5J2F A;  2NO4 A;  3V7K A;  2DF4 B;  4UAW A;  1RM6 C;  1DOQ A;  2M2W A;  1NJX A;  3RB0 A;  3WKE A;  3PR4 A;  3CYM A;  5L1M A;  4IRD A;  2XVT A;  3QEB Z;  2BPC A;  3N4M B;  7ICN A;  4O67 A;  3G6Y A;  3SV3 A;  4DQQ A;  4DF8 A; 
#chains in the Genus database with same CATH homology
 5KFA A;  4WCW A;  5KFU A;  5CA7 A;  2ZTE A;  4ECT A;  2C2R A;  5J29 A;  3RJH A;  2UVU A;  4KLF A;  5KG5 A;  5BOM A;  4PGQ A;  5KFH A;  4F92 B;  4IQV A;  4QZD A;  5DQG A;  1TKD A;  2BDP A;  4XA5 A;  3AQN A;  4FH3 A;  3H8J A;  3ZDE A;  4QW9 A;  2HHW A;  4JUZ A;  9ICT A;  4AT8 A;  5HRB A;  3ORY A;  4M9J A;  4KLM A;  5DQI A;  4R64 A;  2UVR A;  4B9M A;  3RH4 A;  2IHM A;  4DFM A;  8ICT A;  5HC9 A;  3TAQ A;  5J0U A;  4YP3 A;  3H39 A;  1Z00 A;  1NK9 A;  1BVS A;  2ATL A;  4RPX A;  4DQS A;  1WCL A;  1RZT A;  7ICU A;  9ICV A;  3GIM A;  3V72 A;  2BCS A;  4QZ8 A;  1F5A A;  5J0O A;  4PH5 A;  1U47 A;  3C18 A;  3WFS C;  5DED A;  4KLS A;  5HRH A;  5DG8 A;  3GIL A;  4Q45 A;  4FHP A;  5DQH A;  4Q8F A;  4M6W B;  3MFI A;  1XU4 A;  3Q8S B;  4UD5 A;  1ZQV A;  2I1Q A;  3C23 A;  4KN7 A;  4KLJ A;  1MIV A;  3TAR A;  1TFW A;  4B9S A;  4PGX A;  1SKW A;  1QTM A;  4IRK A;  4YD1 A;  3N97 B;  4DL7 A;  1WCN A;  3QZ8 A;  3RBD A;  2DPI A;  5III A;  3C21 A;  3C1Y A;  4EYI B;  4DL2 A;  4E80 A;  3AQL A;  1BPB A;  1XSN A;  1TFR A;  2GWS A;  2Y1J A;  2W9C A;  1ZQN A;  4ED2 A;  4QZB A;  4B9N A;  3HJ1 A;  4RQ2 A;  4TQR A;  1ZQW A;  3OJS A;  1S9F A;  2Q66 A;  3C2K A;  3ISB A;  4F8R A;  4KLE A;  4FHV A;  3V6J A;  1R8C A;  5KFJ A;  1KRP A;  5KFI A;  3AQM A;  3H8S A;  4KLH A;  3IHQ B;  5DGB A;  3HWT A;  1BPZ A;  5DG9 A;  4AT9 A;  9ICC A;  4X4V A;  1QLN A;  2ZTD A;  3WFO A;  2XC9 A;  4K4G A;  4M9H A;  4I2A A;  4F2R A;  1R89 A;  4RNM A;  3HT3 A;  4FS1 A;  3GIK A;  3RAQ A;  1X9W A;  2AQ0 A;  5KFM A;  4AT7 A;  4X4T A;  1JXE A;  2XY5 A;  4ATB A;  3KTQ A;  3WFQ E;  4B9T A;  4F4Z A;  5DGA A;  1NK5 A;  1T8E A;  3IM1 A;  1ZQX A;  9ICF A;  1RYR A;  1ZQO A;  4WC1 A;  2ZH8 A;  4C8M A;  2RDI A;  1TV9 A;  3RBE A;  4YXM A;  3NTU A;  3EYZ A;  3AUO A;  3OUY B;  4RQ5 A;  3Q8L A;  1UEU A;  3RH6 A;  4FH5 A;  4YCX A;  3PX0 A;  2VA3 A;  3OV7 A;  3OSN A;  4BXO B;  4Q8E A;  1MIY A;  5C5J A;  1ZQH A;  4JV2 A;  2HHQ A;  2AQ4 A;  2DR9 A;  3EW9 A;  2ZJ5 A;  2BQR A;  1UA1 A;  2HHU A;  2BHN A;  1ZQQ A;  4UAY A;  3HP6 A;  7ICV A;  8ICY A;  1H38 A;  2ISO A;  1CEZ A;  4LT6 A;  4HYK A;  5CWR A;  4J9M A;  4O5K A;  2OWO A;  3JPO A;  3GV7 B;  2KFN A;  1UET A;  3GFK B;  4DFK A;  5J2E A;  2BQU A;  5HR9 A;  3PW2 A;  1DK2 A;  5KFZ A;  1JX4 A;  3C1Z A;  5KFV A;  9ICS A;  7ICJ A;  4YMN A;  3RJK A;  4IQW A;  1T3N A;  2VA2 A;  5DDM A;  2XGQ A;  2KZM A;  3JPQ A;  4UBC A;  4C8O A;  4DSI A;  2BGW A;  9ICG A;  1NK7 A;  1ZQL A;  4F4Y A;  5J0Y A;  5D4B A;  3GII A;  4QWD A;  4ECS A;  3RRG A;  5HRF A;  4XUS A;  4MF2 A;  3MBY A;  3T5L A;  4DSF A;  2ISP A;  2R8H A;  5KFR A;  5KFO A;  4EBE A;  4AT8 B;  4MFF A;  1SL2 A;  2DR7 A;  4WC3 A;  2C2E A;  4UB1 A;  4IQT A;  3LK9 A;  2HHX A;  3EZ5 A;  2P66 A;  1NO5 A;  4F5O A;  1L3S A;  5KT5 A;  5KFX A;  4EBD A;  3OSP A;  2DR8 A;  1MSW D;  5F2V O;  4ED0 A;  4PHA A;  4GLX A;  5KTQ A;  2DRB A;  4M47 A;  5KFY A;  1B22 A;  1V4A A;  2P6R A;  3PW4 A;  3PX6 A;  5J0S A;  2NRX A;  4YMO A;  1ZQJ A;  4NM2 A;  1VJ7 A;  1KFS A;  1RYS A;  3L9D A;  4M9N A;  3M9O B;  3PV8 A;  4I2I A;  4UB5 A;  1TAU A;  2ZH2 A;  3SV4 A;  1U9L A;  5J2D A;  4FS2 A;  4PGY A;  2XCP A;  2RDJ A;  4CCH A;  5HRD A;  5KG7 A;  2J6S A;  4I2B A;  3JPS A;  3AU2 A;  4RNO A;  3KHH A;  2W9C B;  3T5J A;  4RWP A;  9ICK A;  4YFK A;  2ZTC A;  8ICM A;  4ED7 A;  5HRG A;  3RAX A;  4NLZ A;  2F1H A;  4RQ3 A;  4R63 A;  4DSE A;  4F3O A;  3RB4 A;  3T5H A;  8ICG A;  4JWM A;  2O1P A;  3ZD8 A;  1JMS A;  3BQT A;  5J0R A;  5KG3 A;  4EEY A;  3T3F A;  1NK6 A;  3JPR A;  2FLP A;  5KT3 A;  5KT4 A;  4I2E A;  9ICU A;  8ICK A;  1XWL A;  4RQ7 A;  2UVW A;  4QWA A;  4DOC A;  1HUO A;  5L1K A;  4J9Q A;  4QZ9 A;  3JPN A;  4GXI A;  2F1J A;  1NJY A;  5DDY A;  1ZQC A;  1R8B A;  1S10 A;  4YXJ A;  4AT7 B;  2PI5 A;  5EWF A;  4QWB A;  2W8K A;  1A77 A;  2ALZ A;  4YQW A;  4MFA A;  5KG2 A;  4ECZ A;  3RB3 A;  1NKB A;  4DS5 A;  5D49 A;  2BCR A;  2BCQ A;  4M9L A;  4O5C A;  4O5E A;  3MR6 A;  2NRK A;  1D8L A;  5DBB A;  9ICA A;  3ETL A;  1ZQK A;  4G3I A;  5TZV A;  5KFQ A;  4Z6D A;  1U49 A;  4J9S A;  8ICV A;  3ZDB A;  3M8S A;  4YR2 A;  4RQ1 A;  4YR3 A;  3TI0 A;  3OGU A;  3LWM A;  3MFH A;  3RH5 A;  4E0D A;  4Z6F A;  5KFC A;  2FPL A;  4DF4 A;  4F4K A;  4KLL A;  4YMM A;  2NRZ A;  4ECX A;  1ZQF A;  7ICG A;  4O3N A;  3WFP A;  2PFQ A;  2R8G A;  5KFL A;  3NGD A;  1DK3 A;  2PFP A;  5J2A A;  3B0Y A;  4Q44 A;  2IMW P;  1TK0 A;  4R8U A;  8ICQ A;  2ZH5 A;  1RXW A;  4TUS A;  5KFP A;  4UD4 A;  4KLT A;  3PNC A;  4RQ0 A;  4ECR A;  4B9V A;  3GV8 B;  1COO A;  3PW7 A;  1S0V A;  2ID1 A;  4JWN A;  4I2D A;  3MR3 A;  3M9M B;  2MAX A;  1ZQU A;  4O3P A;  2AGO A;  2JEI A;  7ICL A;  1LB2 B;  4I29 A;  5KFD A;  4F2S A;  4NY8 A;  3UXO A;  3RJG A;  1MIW A;  2W9B A;  3JZ0 A;  2VAN A;  9ICW A;  3OVB A;  1ZQT A;  4QZH A;  4O3R A;  4JV1 A;  3M9N B;  5HHH A;  4IQU A;  3QZ7 A;  2WTF A;  4M2Y A;  3LWL A;  3BQ0 A;  2I9G A;  4XQ8 A;  1BPY A;  9ICO A;  4WBY A;  4EZ6 A;  4IG8 A;  4P2H A;  1BNP A;  4KIT B;  3HW8 A;  4ED8 A;  4I2F A;  5D46 A;  4MEY A;  2BCV A;  4RWN A;  4F4W A;  4GC6 A;  4F5R A;  2A1J A;  9ICI A;  4S3N A;  2XY6 A;  1UT5 A;  3M8R A;  3ZDA A;  4M0A A;  2BPG A;  4P4M A;  4GC7 A;  3UPQ A;  2DVI A;  2IA6 A;  1IM4 A;  1S0O A;  4J9P A;  3SV3 A;  5J2I A;  5DKW A;  8ICB A;  1L3V A;  1C7Y A;  4RUC A;  1JQR A;  4DEZ A;  3C5F A;  3C2M A;  5BOL A;  3UQ0 A;  9ICM A;  5IIN A;  5KFG A;  1TVA A;  5KFT A;  3OJU A;  5L1L A;  1X9S A;  3C2L A;  4ECW A;  1BPX A;  2KP7 A;  1ZQB A;  4XRH A;  2ZH4 A;  4DOB A;  4Z6C A;  1QSL A;  3Q8R B;  1OU5 A;  2JEG A;  5HMM A;  2ZUB A;  5KG4 A;  4ELU A;  5EOZ A;  1NJZ A;  5J2K A;  2ZH3 A;  9ICR A;  4X4R A;  3FYH A;  5HML A;  4KN4 A;  3UPS A;  2PFO A;  4I2C A;  4KLQ A;  4P4P A;  4DFP A;  4X4Q A;  2XGP A;  7ICH A;  3PY8 A;  1ZQI A;  5J2H A;  4I2H A;  4UBB A;  2HHV A;  1ARO P;  3HJ4 A;  2P6U A;  1U4B A;  4EYH B;  4J9L A;  1S77 D;  3SI8 A;  1UA0 A;  5BPC A;  5IIL A;  1KLN A;  5KFF A;  1Z00 B;  5J0T A;  1NK0 A;  2C2D A;  2FMP A;  2BR0 A;  3PO5 A;  2ZJA A;  3TFS A;  4DO9 A;  4ECV A;  5DLF A;  1ZQR A;  4NLG A;  1NJW A;  1L3T A;  5HRK A;  3RJF A;  4I2J A;  1NKC A;  2UVV A;  2MUT A;  2IBK A;  2V4Q A;  3G6X A;  8ICS A;  3MGH A;  1SL0 A;  4WC0 A;  3T5K A;  4M04 A;  4TUP A;  5IIM A;  1XS9 D;  2HW3 A;  4RQ4 A;  4RUA A;  7ICE A;  5DEC A;  1RXV A;  1KFD A;  2DFL A;  5J0W A;  1KDH A;  5CJ7 A;  7ICK A;  1JN3 A;  4RQ8 A;  4UAZ A;  4UB3 A;  1KEJ A;  4KLO A;  2FPM A;  3Q8Q B;  4R8U B;  4DOA A;  1ZQZ A;  4O9M A;  7ICS A;  3B0X A;  4Q43 A;  1ZJM A;  9ICJ A;  1R8A A;  2W9A A;  3OVA A;  3WFR E;  3HPO A;  1Y88 A;  1XO1 A;  4BWJ A;  1KNY A;  2NRW A;  3AQK A;  2V4R A;  3EPI A;  4F4X A;  5KT7 A;  9ICP A;  2V9W A;  2DPJ A;  5KT6 A;  1UEV A;  3TAP A;  2BQ3 A;  1NK8 A;  1N48 A;  3JPP A;  4J9N A;  8ICI A;  3UXN A;  4O0I A;  2BE3 A;  4ED3 A;  1TK8 A;  3ISD A;  4AT9 B;  1JXL A;  5DB9 A;  1T4G A;  2DRA A;  5CHG A;  4ED6 A;  2HHP A;  1TAQ A;  1X2I A;  3PO4 A;  4KLU A;  3RJE A;  3Q8M A;  2W9B B;  2C22 A;  1BNO A;  2PBE A;  1XSP A;  2AGQ A;  3MDA A;  9ICL A;  4X4P A;  5JUM A;  4QZG A;  5KFS A;  4JV0 A;  3MR2 A;  5IIJ A;  1ZQP A;  2J6T A;  1ZQD A;  4ATB B;  4WC4 A;  1PZN A;  2ZUD A;  5J0Q A;  4QZI A;  1L5U A;  8ICF A;  4BWM A;  5KG6 A;  5KFW A;  3GQC A;  5L1I A;  4BDP A;  2PI4 A;  2M2U A;  2ZHA A;  4R66 A;  4YN4 A;  3PX4 A;  4NXZ A;  5J2G A;  3H40 A;  5DBC A;  4DQI A;  4NM1 A;  4QW8 A;  4NKT A;  2M2T A;  5HRI A;  3OVS A;  2A1J B;  2PXI A;  3SYZ A;  5HRE A;  3MR5 A;  4ECQ A;  4LZG A;  4YR0 A;  5J0X A;  4X4U A;  3EWA A;  4BGD A;  3K4G A;  4RWO A;  7ICR A;  2KZZ A;  4M9G A;  9ICX A;  1WOT A;  1N56 A;  5J2J A;  2FMS A;  3RR7 A;  3E2E A;  4NKU A;  2ZHB A;  3Q8P B;  1T7P A;  3KHR A;  4X4S A;  5DB8 A;  3QE9 Y;  1PX5 A;  2BKE A;  4PHP A;  2NRV A;  2Y1I A;  7ICI A;  1XC9 A;  4DL3 A;  1MQ2 A;  2FPK A;  5DB7 A;  4FO6 A;  2B21 A;  1NZP A;  4RZR A;  4E8F A;  7ICT A;  1ZET A;  3PMN A;  1MC8 A;  4I27 A;  4X0B A;  4FHX A;  4QZE A;  4EBJ A;  5F9L A;  4O3O A;  5J0P A;  4B9U A;  4I28 A;  5KG1 A;  3QEA Z;  4O3S A;  8ICH A;  5HRL A;  9ICE A;  1ZQG A;  4KLG A;  3NYB A;  2W8L A;  4YG2 A;  5HP4 A;  3RB6 A;  1K1S A;  1HUZ A;  8ICR A;  8ICC A;  3ZD9 A;  4X4N A;  4IR9 A;  4MFC A;  3H4B A;  2ZJ8 A;  1DGS A;  1KSP A;  2JEF A;  3V7L A;  3ZDD A;  2XO7 A;  1QSY A;  4M5D A;  3C66 A;  2JZB A;  3PR5 B;  4NLN A;  7ICO A;  3MGI A;  4F5Q A;  1SL1 A;  4R65 A;  5L9X A;  4J9K A;  4PPX A;  2AJQ A;  4WC6 A;  5KFE A;  4O3Q A;  8ICP A;  5DLG A;  1NK4 A;  2ASL A;  2MUT B;  2FMQ A;  8ICW A;  4EBC A;  3RR8 A;  3RTV A;  4E7X A;  4F5N A;  3PW5 A;  4UB2 A;  3HX0 A;  2RFF A;  4KMU A;  3UQ2 A;  4DFJ A;  4LZD A;  5DG7 A;  1EXN A;  2ASJ A;  4QZC A;  2BCU A;  4B9L A;  2F1I A;  9ICH A;  5EWE A;  2AU0 A;  1A76 A;  3BQ2 A;  4ELT A;  2R8J A;  4F91 B;  3EPG A;  3LDA A;  3LQC B;  5L1J A;  4ED1 A;  1K1Q A;  4XQ7 A;  9ICN A;  4F5P A;  4X0A A;  4RWQ A;  3OHA A;  1V9P A;  1ZQM A;  4EZ9 A;  7ICP A;  4DQP A;  3H38 A;  1ZQY A;  4QWE A;  1HJP A;  1LV5 A;  5J2B A;  5HHI A;  1NKE A;  3FDS A;  1TFY A;  3Q8K A;  2BPF A;  1D9F A;  3H37 A;  3PW0 A;  2W9M A;  2DR5 A;  8ICE A;  3BQ1 A;  2KN7 A;  4C8L A;  1ZQE A;  5CP2 A;  1SKS A;  1SZP A;  9ICQ A;  4EP7 A;  1KTQ A;  5IIO A;  4MEX A;  8ICL A;  3H7I A;  7ICM A;  4DL4 A;  4RU9 A;  1BGX T;  3V7J A;  4GXJ A;  1Q78 A;  4DLG A;  4FBT A;  4ZH4 A;  2R8K A;  1Z3E B;  5HNK A;  5DB6 A;  5J2C A;  3RRH A;  1B43 A;  3TQ1 A;  3GIJ A;  1ZQA A;  4IRC A;  8ICO A;  8ICN A;  3MAB A;  4P4O A;  1KFT A;  2PFN A;  4RNN A;  4FHY A;  5EWG A;  3TAN A;  8ICA A;  4J9O A;  4M6W A;  3TFR A;  4WC5 A;  4K4H A;  4UQG A;  3GDX A;  4K4I A;  3V6K A;  1SKR A;  4WC2 A;  2M9N A;  5IIK A;  4TUQ A;  4KLI A;  7ICF A;  4ECY A;  4UB4 A;  9ICB A;  2JEJ A;  4MF8 A;  2KZ3 A;  4EBK A;  2HVH A;  4YVZ A;  3ZDC A;  3BJY A;  4IR1 A;  3JPT A;  4DSL A;  4Z6E A;  4TUR A;  1U45 A;  3OHB A;  5KT2 A;  2FLL A;  4C8K A;  5CB1 A;  2C28 A;  4ECU A;  1XSL A;  1D8Y A;  4I2G A;  4DSJ A;  2LYH A;  5F9N A;  5DBA A;  4QZF A;  3BDP A;  1FA0 A;  4KTQ A;  4PHD A;  1ZQS A;  4F50 A;  1MQ3 A;  2HHS A;  3UXP A;  2ZUC A;  1UT8 A;  5KG0 A;  4LVS A;  2J6U A;  4DWI A;  2KFZ A;  2HVI A;  1NOM A;  4DSK A;  8ICZ A;  7ICQ A;  2ZH9 A;  4ELV A;  3JYY A;  4F93 B;  4GXK A;  3H3A A;  3KHG A;  4RPZ A;  4DLE A;  3PML A;  2HHT A;  2M2V A;  4RT2 A;  4FHW A;  3K75 D;  1Q79 A;  1S0M A;  4QZA A;  2NRT A;  2O5A A;  4JK1 A;  2XY7 A;  1BPD A;  2ASD A;  3HIY A;  8ICU A;  3V6H A;  4YD2 A;  4PHE A;  2AGP A;  3MDC A;  1JIH A;  4RT3 A;  5KFK A;  3SZ2 A;  4DS4 A;  4FBU A;  3C5G A;  4X5V A;  1S76 D;  1D9D A;  4C8N A;  3H8W A;  1VFG A;  3AU6 A;  1TK5 A;  3OUY A;  4RPY A;  1BPE A;  2VA8 A;  2IHN A;  2JZB B;  1CUK A;  3G6V A;  4TQS A;  2R8I A;  4DL6 A;  4RQ6 A;  3RJJ A;  4BXO A;  4WBZ A;  3H4D A;  2KTQ A;  1ZYQ A;  2H5X A;  5J2F A;  4X4O A;  2XCA A;  3V7K A;  3PVX A;  2FLN A;  4UAW A;  3KHL A;  1U48 A;  2ZH1 A;  1ZJN A;  2Q0Z X;  1IXR A;  1DOQ A;  5KFB A;  1S0N A;  2M2W A;  3ISC A;  3RJI A;  1NJX A;  3RB0 A;  1YLQ A;  4KLD A;  5CR0 A;  2ZH6 A;  1RPL A;  3THV A;  3PR4 A;  1L3U A;  1X9M A;  4IRD A;  2ZH7 A;  1S97 A;  4J9R A;  4DL5 A;  3QEB Z;  1QSS A;  8ICX A;  2BPC A;  4QWC A;  1JAJ A;  4DQR A;  3N4M B;  4NLK A;  5KFN A;  3G6Y A;  3GV5 B;  7ICN A;  8ICJ A;  4WC7 A;  4DQQ A;  4DF8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...