4M47A

Structure of human dna polymerase complexed with 8-brg in the template base paired with incoming non-hydrolyzable gtp
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
324
structure length
314
Chain Sequence
NGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords DNA polymerase beta
publication title Structural basis for promutagenicity of 8-halogenated Guanine.
pubmed doi rcsb
source organism Homo sapiens
total genus 104
structure length 314
sequence length 324
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4m47A02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4m47A01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4m47A04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4m47A03
1Q78A 1ZQIA 3UXOA 3ZD9A 4UD5A 4WC5A 3C2LA 1NK6A 4DOCA 7ICNA 1ZQJA 2F1IA 4UBCA 2KZMA 7ICPA 4WC3A 3HWTA 2F1HA 4KMUA 4FHYA 4KLUA 3RH4A 8ICWA 2BE3A 4WBYA 2MUTA 1PZNA 5KT5A 4ED0A 2VA2A 4Z6CA 2DR9A 2ZJ5A 3PV8A 3V6KA 1MIWA 4WBZA 1S77D 2ZHAA 2JZBA 5KFHA 3M8RA 2M2WA 3HW8A 4FS1A 5J2BA 4RQ2A 5DB7A 2ZH5A 4QZBA 3PR4A 2C22A 3GIIA 5EWEA 3MDCA 2BPFA 3PW2A 2BCSA 5HRKA 4M6WA 1JQRA 2RDIA 4TUPA 3GV8B 2BPGA 2A1JA 2I1QA 5KT3A 5CWRA 1D9DA 2NRKA 9ICTA 1NK0A 4O3SA 3MABA 4ED6A 3SZ2A 5IILA 2XGPA 8ICFA 1BPEA 8ICIA 5HRDA 4X4OA 2W9MA 1HUOA 4F5PA 4ED8A 2ISOA 4KLLA 8ICUA 5KFJA 3H3AA 3M9OB 1NJXA 2FMSA 4F92B 5D46A 4F3OA 1ZQYA 3Q8KA 1R8CA 4P4OA 4F91B 2HHSA 1U45A 4NKTA 1XSPA 3PR5B 5DEDA 5KFGA 4RQ5A 5J29A 4RNMA 3LK9A 3UPQA 5KFQA 4M9NA 3AQLA 4KTQA 3JPRA 5KFEA 4TUSA 2ATLA 4EBJA 4DQQA 4RPZA 4NLKA 4RU9A 4ECYA 2VA3A 4EZ9A 4TQRA 4DFMA 1ZJNA 4LZDA 1SKSA 4EBDA 4YXJA 1QLNA 4AT8B 2DVIA 2W9CA 3H8SA 3RR8A 1MQ3A 3ISDA 3ISCA 2XC9A 3JPSA 4M0AA 1MC8A 9ICRA 3SI8A 4YN4A 4M9GA 2HHPA 4O3RA 4B9UA 4FHWA 1HUZA 5KT4A 2HVIA 4X0BA 2AQ0A 4GXJA 4M9JA 5DDYA 3T5KA 4B9TA 4FBTA 1KSPA 1U4BA 2P6UA 2XY5A 4ECZA 7ICJA 1NKEA 1BPYA 3MR5A 3B0XA 1DK3A 5KFXA 2O5AA 4R65A 3PW5A 2DRAA 2F1JA 4QWBA 4XA5A 2BCUA 5KFIA 3Q8RB 4DS4A 4EEYA 2Q0ZX 1SL0A 3G6YA 1RXVA 3AQNA 5CR0A 4EYIB 5HMLA 2Q66A 2BCVA 5F2VO 2BHNA 4RQ6A 3H4BA 4F5QA 2ZUBA 3LDAA 2PI4A 4YP3A 4I28A 5KT6A 3WFSC 5J0SA 3EZ5A 1BNOA 1NKCA 1Z00B 5F9NA 5J2DA 4GLXA 1S76D 5KG4A 4PGXA 2ZUCA 4F5NA 4I2AA 1L3SA 1X9WA 2VA8A 4YR3A 1KLNA 3KHHA 5CP2A 2ZH7A 4Q8EA 3C5FA 2PFOA 3RB6A 8ICGA 4WC1A 4ECRA 5C5JA 1SKWA 5KFRA 4ECQA 7ICUA 1VFGA 4M9LA 2NRXA 2C2DA 9ICSA 8ICLA 2OWOA 3IM1A 4Z6FA 4O3OA 4O0IA 3JPTA 4F4WA 5DBAA 3EPGA 4PHDA 1RYSA 3RJJA 5J0OA 4J9LA 9ICJA 4YR2A 4DSFA 1T7PA 2ZH8A 4JK1A 3Q8MA 3JPQA 4I2BA 3AU2A 2FMPA 4R66A 2ZTEA 5J0PA 4KLOA 2C2EA 5DQHA 1NK9A 5HREA 5DDMA 1ZQXA 2ZH1A 4QZIA 1NK7A 9ICMA 5HRIA 4TUQA 3TI0A 2JEJA 2HHVA 1TK5A 2AU0A 2DPJA 4DQIA 1T8EA 3UQ0A 4M04A 4R8UB 2FLPA 4LVSA 4QZEA 1BGXT 1V4AA 5J0RA 2W8KA 4MFAA 4YFKA 1ZETA 3C23A 3KHRA 2RFFA 5KFVA 5DLGA 4JWMA 1BPXA 4F4KA 4RQ4A 1KNYA 9ICOA 5HRHA 4Z6EA 5BOMA 1BPDA 2ZUDA 4O5EA 2HVHA 2ZJAA 3H8JA 3N4MB 8ICTA 2ASDA 8ICJA 4DF8A 3ZDBA 4P4PA 1JMSA 1ZQUA 3PW7A 3WFPA 3UPSA 4QW9A 2ZH9A 1NJZA 5HP4A 3FYHA 3C66A 4J9OA 3GILA 8ICVA 4RWOA 3RJHA 3C2KA 4ECUA 2ZTDA 1ZQLA 4B9LA 3PNCA 1L3UA 4C8LA 1JXEA 3QE9Y 5HRLA 1A76A 3ZD8A 4MF8A 4DFKA 5J2GA 4QZHA 1CUKA 2BGWA 4I2IA 3SV3A 2C2RA 1KFDA 9ICXA 2DR8A 2BCQA 4X4UA 3OV7A 4I2CA 3JPPA 4JV2A 8ICCA 9ICAA 8ICHA 2XO7A 2B21A 2O1PA 4BGDA 2NRWA 1QSYA 1ZQRA 2BQ3A 4ZH4A 3WFQE 5KG6A 3MDAA 3TANA 2IBKA 7ICFA 4RWNA 2XY7A 3HPOA 4ECVA 1BPZA 5KFPA 4DQRA 5L1LA 4B9NA 1UEUA 4FBUA 3OHBA 4JV1A 3RB0A 3OJSA 4UB4A 2IHNA 1IXRA 1U9LA 1MQ2A 4DSKA 3PO5A 3C5GA 3UXPA 1ZQWA 4QWEA 2PXIA 3PVXA 5KFMA 1XU4A 4K4GA 4E8FA 5KFUA 1X9SA 5DGAA 3RJGA 4DSJA 4ELTA 1YLQA 2ASLA 2KFZA 4KLFA 3QZ8A 4RPXA 3LWMA 2BR0A 3HIYA 1JIHA 1UETA 4G3IA 3OUYA 3JZ0A 2NRZA 4JUZA 4M9HA 5DB9A 3H4DA 4E0DA 4DSIA 4Q45A 3MR6A 3WFRE 8ICOA 4DEZA 3EWAA 5J0XA 2KN7A 1XO1A 1FA0A 3HJ4A 1S0VA 4WC6A 1V9PA 4M47A 4QZ8A 1XS9D 4RQ7A 4TQSA 3AUOA 2Y1JA 2ISPA 4O5KA 3QEBZ 1B22A 7ICQA 1KFSA 4QZAA 2BPCA 2MUTB 3Q8SB 4DFJA 5HMMA 1D8LA 5IINA 2AGOA 2HHQA 4DOBA 9ICWA 3RJEA 3EYZA 3AU6A 3OJUA 1UT8A 2JZBB 2UVVA 2R8KA 3BDPA 4O3NA 3ISBA 1WCLA 4K4HA 8ICNA 4J9NA 3FDSA 4AT9A 1C7YA 3OSPA 4EBKA 1OU5A 1Y88A 3H7IA 4YVZA 5CJ7A 1EXNA 1ZQKA 1JXLA 2UVRA 4KLTA 5L9XA 1ZQSA 7ICMA 1NO5A 4DQSA 4I29A 5J0YA 4R63A 1QSLA 3RJFA 4M6WB 4JWNA 2A1JB 4RNNA 3T5LA 5KFWA 4ED7A 3AQKA 4ECTA 4DL2A 3C1YA 5CB1A 4DLEA 5J2IA 4ED3A 2J6UA 4KLIA 1U47A 4FHVA 1SZPA 5DLFA 1UEVA 4NKUA 2AGQA 5KFFA 4UQGA 4DO9A 2KZZA 4UAWA 9ICIA 3GV7B 7ICLA 3GIJA 4YR0A 5F9LA 1XSLA 4UAZA 1UA0A 1KEJA 8ICPA 2Y1IA 7ICHA 3BQ1A 2M2VA 4WC2A 3OVAA 2KTQA 4DFPA 3C18A 2ZH2A 4Q8FA 3PW0A 4QZDA 1ZQPA 2V9WA 4C8MA 5KFKA 4RUCA 5J2JA 1T4GA 4RNOA 4FHXA 3V7LA 5DGBA 4FO6A 3RBEA 8ICKA 3GDXA 3UQ2A 3KHGA 4NLZA 4PPXA 5HHIA 3SYZA 4RQ1A 4P4MA 3MR3A 4JV0A 4F4YA 5HC9A 5D49A 5D4BA 4DWIA 2PI5A 1ZQZA 5KG3A 4YMMA 4PH5A 2M2UA 2W9CB 2BDPA 2R8IA 5J2HA 4X4SA 2ZH6A 2I9GA 2J6TA 5HRGA 3BQTA 4X4NA 8ICXA 1NJYA 4J9RA 3JPOA 5KT2A 1BPBA 5KFYA 3H38A 3V72A 1BVSA 2VANA 5KFTA 1S0NA 3MGHA 1LV5A 4BXOA 4IR9A 4AT7A 1SL2A 3H37A 4LZGA 2DR7A 4O3PA 4B9VA 4Q44A 3PMLA 1RZTA 2J6SA 3V6HA 4DL6A 2W9AA 1KFTA 1TV9A 4IG8A 4O5CA 4X4PA 3TQ1A 2V4QA 4QZCA 4MEXA 2DPIA 1SL1A 4X4VA 4DL7A 4KLHA 4DSLA 1ZQOA 5J2EA 4I27A 4P2HA 3ZDAA 3N97B 4LT6A 4RUAA 4UAYA 2V4RA 1ZQDA 2UVWA 1TAQA 5IIOA 4GXKA 3M9MB 3T5HA 2BCRA 4RT3A 1NK4A 4XUSA 3Q8PB 4J9KA 3PX0A 3H39A 4EZ6A 1ZQCA 1L5UA 5TZVA 4C8KA 1A77A 1X9MA 1S0OA 2ZHBA 1B43A 3OVSA 3G6VA 3PX6A 4XQ7A 5KTQA 1QTMA 1KDHA 4KLQA 4IQUA 5IIIA 3HJ1A 1TFRA 2ZTCA 4PHAA 4Z6DA 1F5AA 5EOZA 1TKDA 4RPYA 1ZQMA 4MF2A 2AQ4A 1N48A 1R8BA 4MFFA 4IQTA 4RQ8A 3PW4A 1ZQQA 4C8NA 3ZDDA 2HHWA 4M2YA 2P66A 2ASJA 3THVA 4ED1A 3C21A 1ZQBA 1TAUA 1HJPA 5KG2A 4BWMA 3HX0A 4X0AA 2KZ3A 2IMWP 8ICAA 3TFRA 3PY8A 4X4QA 4S3NA 5KFNA 4F5OA 3RRHA 4RT2A 2BQUA 1ZQEA 4IR1A 1MSWD 5DB8A 2HHXA 9ICLA 9ICKA 9ICFA 3H8WA 4BDPA 3MBYA 4KLDA 1RXWA 3B0YA 3RH5A 5J0WA 1NKBA 4O9MA 3M9NB 5J2FA 4ED2A 4F4ZA 4DQPA 1TFWA 2FLNA 4QWCA 3L9DA 4F2RA 5DG8A 5EWFA 3G6XA 4YG2A 5KFAA 5KFCA 2XGQA 4EYHB 3H40A 9ICHA 9ICUA 1BNPA 4YMOA 3JPNA 2PBEA 2FMQA 3GV5B 4F2SA 4M5DA 4KLSA 2BKEA 4QZFA 3RB4A 3V7JA 4IRKA 1NZPA 1K1QA 4I2DA 3IHQB 7ICRA 3HP6A 1DOQA 3LQCB 4DL5A 3QZ7A 2PFNA 4AT8A 4F93B 2NRTA 1SKRA 4RQ0A 1JX4A 2P6RA 4WC7A 4I2JA 7ICTA 1MIVA 3OVBA 4BWJA 5J0QA 3NYBA 2GWSA 2DR5A 4UD4A 1RPLA 1K1SA 5J2AA 2RDJA 3C2MA 3TAPA 9ICNA 1DGSA 3BQ0A 4ELUA 2W9BA 4F8RA 2BQRA 1LB2B 7ICVA 2KFNA 1NOMA 1ZQVA 4UBBA 4ECXA 2UVUA 1XWLA 4J9PA 1ZJMA 4WC0A 4I2EA 3OHAA 3RTVA 4Q43A 3LWLA 4J9MA 1S10A 2PFQA 4HYKA 3QEAZ 1TK0A 5HRBA 4X4RA 1WCNA 9ICVA 3OSNA 1KRPA 3JYYA 3C1ZA 3PX4A 1KTQA 2DFLA 5DBBA 5J2CA 3RAQA 1Z3EB 4O3QA 4PHPA 4B9SA 4QZGA 3K75D 4KITB 4GC6A 5L1KA 4KLMA 2FPMA 3ZDCA 5J0TA 3KTQA 2HHUA 1ZQGA 5L1IA 2JEFA 3PO4A 3TARA 4J9SA 4ECSA 3TFSA 3RB3A 8ICBA 5IIKA 1ZQNA 2IHMA 1Z00A 4YQWA 4B9MA 5HR9A 4RWQA 4EP7A 1NK8A 4YXMA 5CA7A 1ZYQA 4IRDA 7ICGA 3ZDEA 5BPCA 1ZQFA 4PHEA 3T5JA 4NXZA 2ID1A 4DF4A 4RWPA 4E80A 4DOAA 4ELVA 1JAJA 4FH5A 4DLGA 2R8HA 9ICCA 1TK8A 5DBCA 2AGPA 3NTUA 3V7KA 2PFPA 5KFOA 3ORYA 4RZRA 2FLLA 3OUYB 4IQWA 4UB3A 3GQCA 4PGYA 1CEZA 2W9BB 4DL4A 4MEYA 1S97A 1L3TA 5KT7A 5KFZA 2XCAA 4FS2A 3RRGA 3E2EA 1AROP 7ICEA 5HNKA 1DK2A 4X4TA 4ECWA 3EW9A 5DECA 1ZQAA 2LYHA 1QSSA 3Q8QB 2C28A 5IIJA 4YCXA 1RYRA 9ICEA 1TFYA 1L3VA 4R8UA 3SV4A 1U49A 9ICPA 3K4GA 1UA1A 4WCWA 2H5XA 1D9FA 1ZQHA 5DQGA 8ICZA 8ICRA 4DL3A 3V6JA 3KHLA 3BQ2A 4NM2A 5EWGA 3UXNA 4KLGA 7ICKA 4UB1A 3GIKA 5IIMA 2W8LA 4QZ9A 1NK5A 8ICYA 3WFOA 4QWDA 4R64A 4EBCA 3BJYA 1WOTA 4AT9B 2NRVA 2WTFA 1ZQTA 3PMNA 4EBEA 2XY6A 1MIYA 4YD2A 4UB5A 5J2KA 1TVAA 7ICSA 3T3FA 2JEIA 5KG1A 2R8JA 9ICGA 4IQVA 7ICOA 2ALZA 8ICMA 4GXIA 4YD1A 3RBDA 3RJIA 7ICIA 5J0UA 3OGUA 8ICQA 5DQIA 1N56A 5KFSA 4CCHA 4I2FA 2ZH4A 1H38A 2KP7A 4ATBB 5KG7A 4I2GA 5DKWA 4WC4A 4F4XA 4XRHA 4XQ8A 1U48A 2M2TA 1XSNA 4IRCA 4YMNA 1T3NA 2JEGA 5KG5A 3RH6A 1UT5A 1IM4A 5CHGA 4NM1A 4X5VA 2M9NA 3TAQA 4ATBA 2IA6A 5KG0A 2MAXA 2HW3A 4I2HA 2AJQA 4NY8A 1XC9A 5KFLA 1PX5A 3GFKB 2ZJ8A 3RJKA 4MFCA 2HHTA 4QW8A 4NLNA 4KLJA 3Q8LA 5JUMA 1R89A 3RAXA 2XCPA 3GIMA 5DB6A 3EPIA 9ICBA 4PGQA 4F50A 1R8AA 5HRFA 4J9QA 4E7XA 2ZH3A 3M8SA 9ICQA 3MFHA 4DSEA 4QWAA 1VJ7A 4FHPA 4FH3A 3ETLA 5KFBA 3AQMA 1NJWA 8ICEA 5L1JA 1COOA 4F5RA 4GC7A 1D8YA 5BOLA 4KLEA 8ICSA 2R8GA 4KN4A 4RQ3A 1S0MA 5HHHA 2FPKA 5KFDA 1X2IA 4C8OA 5DG9A 4UB2A 5DG7A 4KN7A 3HT3A 4K4IA 2FPLA 4BXOB 4AT7B 1S9FA 3RR7A 4NLGA 3MR2A 1JN3A 3NGDA 4DS5A 1Q79A 3MFIA 4TURA 3MGIA 2DRBA
chains in the Genus database with same CATH superfamily
1ZQIA 3UXOA 3ZD9A 4UD5A 4WC5A 5AM1A 3SAFA 1NK6A 7ICNA 2KZMA 4WC3A 2JMGA 3HWTA 2XIDA 4FHYA 3MCRA 8ICWA 4GFJA 2H3FA 2CN1A 1KN5A 4Z6CA 2AH5A 4FS1A 2KV2A 1ZRMA 3PR4A 5CFSA 2C22A 3S6JA 1JQRA 3GV8B 2GH1A 4KB6A 3K7DA 2XGPA 3F53A 2ZIUB 1HUOA 4F5PA 4KLLA 1PK1A 4F92B 4P4OA 5G5HA 5KAIU 2HHSA 3QXGA 3PR5B 4RQ5A 4OAGA 2LMRA 4I0UA 4EBJA 2ESEA 4EZ9A 5AM4A 4DFMA 1SKSA 1Q3VA 1MC8A 4FHWA 5KT4A 5G5GA 4X0BA 3WKAA 4M9JA 2HI0A 4B9TA 4FBTA 1KSPA 2P6UA 1PVPA 1NKEA 5AICA 2F1JA 4QWBA 2BCUA 3Q8RB 4DS4A 2ZIXA 1SL0A 3G6YA 2Q66A 4OJPA 2BHNA 4EEBA 2RHFA 3LDAA 1ZQ1C 2WFAA 5AKXA 2DWQA 1NKCA 5KG4A 4PGXA 2ZUCA 4I2AA 1L3SA 2VA8A 3KHHA 3NRWA 1HIWA 3AMZA 4Q8EA 4ECRA 1VFGA 4ECQA 7ICUA 4IL6U 2ZIVB 5AKIA 3WU2U 3RJJA 4OAIZ 5DBAA 4J9LA 2ZH8A 1SXDA 4I2BA 2WF9A 2FMPA 4KLOA 2ZTEA 5HREA 2WF7A 1ZQXA 5L1MA 1NK7A 9ICMA 4TUQA 1TK5A 2DPJA 2FLPA 4LVSA 2G5IB 1Z1VA 2W8KA 5AI4A 1ZD5A 5DLGA 4EEDA 9ICOA 5HRHA 4Z6EA 1BPDA 2HVHA 2ZJAA 4Y2TA 8ICTA 2ASDA 1V97A 1JMSA 2IOFA 3QNMA 1WWUA 2KVCA 5HP4A 1JUDA 5D62A 8ICVA 2L5YA 3RJHA 1N2XA 3QE9Y 2KOBA 5J2GA 1CUKA 9ICXA 1X9XA 3WK8A 1XNSA 3OV7A 4I2CA 1QSYA 5KG6A 1SWVA 2LI6A 2XY7A 3HPOA 4ECVA 1BPZA 5KFPA 4DQRA 5L1LA 4B9NA 4JV1A 3RB0A 3OJSA 4O68A 1A0PA 2H3ZA 1MQ2A 3PVXA 4E8FA 4DFDA 5DGAA 3SD7A 4G3IA 5ALDA 4M9HA 4KM5A 4WQKA 5J0XA 2KN7A 1FA0A 3O0FA 2K4PA 1S0VA 4FFDA 3TACB 1V9PA 4QZ8A 2Y1JA 3QEBZ 3N7RC 2BPCA 3DDHA 3Q8SB 4LEVA 1D8LA 3IP4B 2AGOA 3AU6A 2R8KA 8ICNA 3KOOA 1C7YA 4EBKA 1OU5A 2K8AA 4KLTA 1JXLA 4C7ZA 3QU9A 4JWNA 3H0RB 3T5LA 3AQKA 3H0LB 4ECTA 5AKZA 5CB1A 4DLEA 5J2IA 2J6UA 2E5SA 1KKXA 1UEVA 1RYUA 2AGQA 4UAWA 3GV7B 1PUZA 1PK1B 4CGZA 4DFPA 3C18A 4Q8FA 1ZQPA 5KFKA 5DGBA 3RBEA 2GOLA 3LVWA 8ICKA 4WH5A 4U7CA 1TAMA 3MR3A 5D49A 4LEYA 1L7NA 1ZQZA 4X4SA 3JPOA 4NXVA 4BXOA 4LZGA 4PL1A 4O3PA 3PMLA 1RZTA 1KFTA 2CXYA 2HBKA 3N28A 1SL1A 2DPIA 4I27A 4P2HA 4LT6A 4RUAA 2ZIXB 3MGVA 3T5HA 4RT3A 1WYGA 1ZD3A 4MKPA 1A77A 4Y2VA 5B5EU 3OVSA 3G6VA 5KTQA 4IQUA 4PHAA 1N62A 1F5AA 4RPYA 1R8BA 2MA1A 4IQTA 3ZDDA 1WWVA 2ASJA 3C21A 1TAUA 2HN1A 4BWMA 1F44A 2IMWP 5D61A 1J2MA 3UMCA 4RT2A 1MSWD 3AEVA 4NLBA 2E1FA 3N7PD 4O9MA 5J0WA 2KICA 1OXJA 4DQPA 2FLNA 3E58A 3G6XA 2EDUA 4EYHB 9ICUA 2DGZA 3V7JA 7ICRA 4RWOA 2NRTA 4FO1A 1JX4A 4I2JA 3HJEA 3NYBA 2GWSA 1RPLA 3C2MA 3TAPA 2YY6A 2W9BA 4F8RA 1LB2B 1S5LU 7ICVA 2KFNA 4RQMA 1ZJMA 4WC0A 4C4RA 1PK3A 3QX7A 5H2FU 4X4RA 9ICVA 3OSNA 5GTHU 4B6JA 1Z3EB 2JRZA 4GC6A 5L1KA 3ZDCA 5J0TA 3KTQA 1ZQGA 4WOYA 4NWIA 3TARA 4XJEA 4B9MA 1JAJA 1X66A 1SB3C 5DBCA 5AK4A 2PFPA 1L7PA 3GQCA 4PGYA 2LHTA 3PSTA 1YZ6A 4J03A 5KT7A 2XCAA 3RRGA 3E2EA 5HNKA 4ECWA 3EW9A 5DECA 2K8BB 3I76A 2HSZA 3Q8QB 4K99A 9ICEA 4R8UA 3SV4A 5AKEA 3A0HU 5ALGA 1UCVA 2R18A 7ICKA 3KHLA 4NM2A 1NZBA 3GIKA 4QZ9A 4OAFA 2LBOA 4R64A 2NRVA 1ZQTA 5AKJA 3PMNA 4UW9A 2ZG6A 2JEIA 4GXIA 1F0MA 4NXUA 4YD1A 3RJIA 8ICQA 5AI6A 1N56A 5KG7A 2M2TA 4XRHA 1XSNA 5KNIA 5CRXA 5ALVA 2DKZA 2JV3A 5CHGA 4NM1A 4USAA 3TAQA 3QU2A 5KG0A 4I2HA 2AJQA 3GFKB 3ZI4A 2ZJ8A 2E8PA 3VCBA 3ONNA 4OO1J 3EPIA 1R8AA 4E7XA 2ZH3A 5EE3A 3PSFA 2EQYA 5KL8B 1L7OA 3SAGA 8ICEA 2LM1A 3D6JA 4KLEA 1D8YA 2R8GA 5AI9A 1S0MA 2QKQA 4C8OA 4UB2A 4K4IA 2WHEA 1L7MA 4BXOB 4NLGA 4CF5A 3JYYA 2WF6A 3NASA 3C2LA 1VJ5A 1ZQJA 2RRDA 1SV4A 2F1IA 1URJA 2W04A 4KLUA 3RH4A 1ED1A 4Y2QA 1JRPA 1JI7A 5AKLA 1S77D 5EE0A 3M8RA 3HW8A 4UAVA 4U6PA 5J2BA 4K8VA 5DB7A 1FIQA 3MDCA 3KZXA 5HRKA 3M1YA 2RDIA 4TUPA 2HBJA 5ALPA 9ICTA 1UHUA 3MABA 3SZ2A 5IILA 4X4OA 1BPEA 2ISOA 5ALYA 3IN5A 5KFJA 3H3AA 3M9OB 1NJXA 3OWGA 2DBYA 3F2BA 1U45A 5KFGA 4CE6A 4RNMA 4M9NA 3JPRA 5KFEA 4TUSA 5AKYA 4RPZA 2VA3A 3CYMA 4TQRA 1ZJNA 1MQ3A 3ISCA 5AIBA 3JPSA 4K98A 4YN4A 3BZKA 4B9UA 2AQ0A 5ALLA 4JB3A 3T5KA 3F5EA 5ALNA 1OUQA 1BPYA 2WB1F 3PSPA 1X6IA 3J81j 1DK3A 4Y2JA 4R65A 2DRAA 1NI3A 3GZFA 3NVYA 3ERCC 4EEYA 2Q0ZX 3AQNA 5AK5A 4RQ6A 3H4BA 4F5QA 4P0PA 2ZUBA 3BS7A 2JH7A 2W43A 1BNOA 2K4EA 5J2DA 4GLXA 1S76D 4F5NA 1X9WA 4O3MA 5CP2A 2OYYA 2G0AA 1SKWA 4K9AA 2NRXA 2C2DA 1N63A 3IM1A 3L3FX 4O0IA 8ICHA 3EPGA 9ICJA 3ER9B 2F3NA 1SZHA 3Q8MA 1N5WA 3AU2A 5DDMA 4M04A 3UQ0A 2GAFD 3DV9A 4R8UB 4QZEA 2WB1C 5J0RA 2H3IA 3C23A 5KFVA 4JWMA 4F4KA 1KNYA 5BOMA 2ZUDA 3NRZA 5JRTA 3H8JA 8ICJA 4P4PA 1ZQUA 4EGWA 2YQEA 2YB1A 3FYHA 3C66A 3L5KA 1QH9A 3C2KA 2EZXA 1L3UA 2EWRA 1JXEA 3FC4A 4MF8A 2ES6A 4QZHA 2DR8A 3WKCA 3SV3A 2FCLA 2DUYA 2AHOB 3JPPA 4JV2A 2BZFA 2O1PA 2B21A 2EAMA 2NRWA 2KMDA 2IBKA 7ICFA 4LJXA 4K9BA 2FJ6A 3NKUA 1UEUA 5AKHA 3OHBA 1KBUA 3D2QA 4DSKA 3ICXA 3C5GA 3UXPA 1ZQWA 1XU4A 4K4GA 1D8BA 2KVSA 3CK6A 3QZ8A 4NXXA 3HIYA 1JIHA 1UETA 4Y2PA 3K1ZA 3OUYA 2NRZA 1N61A 5DB9A 3H4DA 4E0DA 1L8LA 8ICOA 3EWAA 5ALUA 1CRXA 5EE9A 4K97A 1XS9D 4TQSA 5AKGA 2ISPA 1KFSA 1C20A 5IINA 2HHQA 4DOBA 5GTIU 3RJEA 5TISU 3EYZA 3OJUA 1GPJA 4O3NA 1WCLA 4K4HA 2VKQA 5ALSA 3OSPA 4AT9A 1Y88A 5CJ7A 2UVRA 3WKDA 5L9XA 3CW2C 3QYPA 2NYVA 4I29A 5J0YA 4R63A 1QSLA 3RJFA 4CNQA 2G06A 2B4VA 4KLIA 4FHVA 4NKUA 2KZZA 4DO9A 8ICXA 5AHXA 5F9LA 1UA0A 4PZNA 5AIAA 5F3XB 3BQ1A 2KTQA 3PW0A 4PL2A 3ETRA 1T4GA 2RLTA 4FHXA 3M6ZA 4FZMA 4A8EA 4P4MA 5HC9A 4DWIA 4F71A 2M2UA 2R8IA 4KX3A 5J2HA 2I9GA 1B4FA 4X4NA 5KT2A 4IR9A 1SL2A 3AL0B 2EAPA 4Q44A 5ALKA 4DL6A 4X4PA 1SGGA 4KLHA 3NVZA 4UAYA 1TAQA 4UB8U 4GXKA 1NK4A 4XUSA 4P0PB 3H39A 4EZ6A 1X9MA 1ECWA 3C28A 1TFRA 1B0XA 5JU5A 1N48A 1QCKA 3UMBA 3PW4A 2KKVA 4M2YA 1ZQBA 1HJPA 5KG2A 3RRHA 1ZQEA 5DB8A 1JROA 2HHXA 9ICLA 9ICKA 4C4TA 4KLDA 1RXWA 3TKAA 2B6GA 4P0QA 4F2RA 5KFAA 3JPNA 3SAHA 2BKEA 1NZPA 4DCCA 4IRKA 1K1QA 3E0FA 3IHQB 3LQCB 4AT8A 4DL5A 2PFNA 2P6RA 1MIVA 3OVBA 4BWJA 5J0QA 1CI4A 4UD4A 9ICNA 2YMQA 3KFUF 3KBBA 1XWLA 4EELA 2PKEA 1MN8A 3FM9A 2CRXA 3RTVA 4Q43A 3LWLA 2PFQA 5HRBA 5ALOA 2PMZF 5J2CA 4PHPA 1WG8A 3K75D 2WAQF 3CRXA 3KKAA 3PO4A 1DGJA 3RB3A 5IIKA 3QUTA 1ZQNA 2IHMA 4YQWA 2Q4TA 5AI0A 4RWQA 2JGAA 4EV6A 1NK8A 4YXMA 1ZQFA 2ZIWA 4DF4A 1UQVA 9ICCA 4OJ5A 1N60A 2E1EA 2AGPA 1ZRNA 3V7KA 2LYAA 3NVVA 4QIWF 3OUYB 4FE3A 2FLLA 4IQWA 4BUGA 4DL4A 2W54A 2W3SA 7ICEA 1DK2A 1AQ6A 2LYHA 1J2NA 4YCXA 2YMPA 5AK3A 3K4GA 1UA1A 4WCWA 1D9FA 5DQGA 3BQ2A 1XO0A 3LYSA 2W8LA 2PMZC 8ICYA 3OTQA 1SWWA 2YTUA 3BJYA 1WOTA 4AT9B 2WAQC 2XY6A 2YMLA 4UB5A 5J2KA 4UATA 7ICSA 2P35A 7ICOA 7ICIA 1V38A 3KKAC 3OGUA 2KP7A 1LVHA 5DKWA 4WC4A 4F4XA 4XQ8A 4IC9A 3R9KA 5KG5A 3RH6A 1UT5A 1IM4A 3BQ7A 1KW4A 3F2DA 3CNHA 3ED5A 2MAXA 2HW3A 1XC9A 4QIWC 4MFCA 2HHTA 1R89A 3RAXA 2XCPA 3RF9A 9ICBA 4PGQA 4F50A 3M8SA 4C7YA 2N1RA 4DSEA 3ETLA 1Z19A 5K4LA 5L1JA 1SIJA 2KJ9A 4GC7A 8ICSA 4KN4A 5KFDA 2FPKA 2FPLA 4UARA 3SEIA 3MR2A 3NGDA 3MFIA 1Q78A 3DEEA 4DOCA 2AXTU 2ZXHA 3WK7A 3QU4A 2F1HA 5ALRA 2Y0SC 1ZD4A 3PSIA 1O08A 3AQEA 4WBZA 1MIWA 5KFHA 4EX6A 5J8YA 2ZH5A 4QZBA 2G07A 2E3TA 2BPFA 3PW2A 4M6WA 1KL9A 2BPGA 2DQNB 2DKXA 2I1QA 5KT3A 5E79U 2NRKA 4O3SA 4ED6A 8ICFA 8ICIA 3IG8A 8ICUA 2FMSA 3CP8A 5D46A 4F3OA 5AM5A 3AQFA 1XSPA 4P0QB 5J29A 3UPQA 2W11A 2ATLA 2LM4A 2FDRA 4NLKA 4LZDA 1QLNA 4EBDA 2DVIA 4AT8B 2F8LA 3RR8A 3ISDA 2K4IA 2MSNA 2XC9A 4M0AA 4M9GA 1HUZA 2HVIA 4GXJA 5DDYA 2EAOA 2XY5A 4KMOB 2OH2A 5KFXA 3D2NA 5J8YC 5CR0A 2BCVA 3H0MB 5F2VO 2PI4A 1RDFA 3NVOA 4YP3A 3I28A 4I28A 3WFSC 5J0SA 2W55A 1OW5A 5F9NA 3SENA 4YR3A 3RFAA 3C5FA 3RB6A 2ZIWB 2G5HB 5KFRA 3PHZA 5ALJA 3OPXA 4Y2XA 9ICSA 8ICLA 2OWOA 3JPTA 4O3OA 4F4WA 4PHDA 2MRLA 4EENA 4YR2A 3IRUA 4JK1A 3JPQA 4JMUA 4R66A 5J0PA 2Y9TA 2BBHA 2C2EA 5DQHA 2JXJA 4QZIA 3HKZC 2HHVA 2AU0A 4NV0A 1T8EA 2KSOA 4YFKA 1ZETA 1BPXA 1M6YA 2BDUA 3F5AA 4EX7A 4O5EA 4DF8A 3ZDBA 3PW7A 3WFPA 3UPSA 2JR5A 2ZH9A 4J9OA 2D3DA 2ZTDA 4B9LA 3PNCA 4C8LA 4BX9C 2BGWA 2NO5A 2CPRA 2C2RA 4X4UA 4NL9A 3U26A 9ICAA 2XO7A 1X6JA 2WF5A 2KE7A 2HN2A 1IIPA 4ZH4A 3WFQE 2EZZA 2YX8A 2KHVA 4OCZA 4OJ6A 4CF3A 1RQLA 4FBUA 4JLXA 4UB4A 4LEZA 1U9LA 1HEKA 3PO5A 2HOIA 4QWEA 5KL1B 2PXIA 5KFMA 1J97A 5ALZA 1X9SA 1YLQA 2KFZA 3LWMA 3WKBA 3JZ0A 4DSIA 2A3VA 2E8MA 3SR6A 1XO1A 3AUOA 3I1YA 2K89A 3QUQA 3M7DA 5HMMA 3HILA 1FFVA 9ICWA 2OEHA 3WKEA 1EXNA 3M6KA 3WK6A 1ZQSA 7ICMA 4NL9C 4DQSA 4M6WB 3TADA 4RNNA 5KFWA 3C1YA 5HR7A 4ED3A 4ATBA 2KEYA 4NJ8A 1U47A 1SZPA 3BS5A 5KFFA 9ICIA 7ICLA 1ZD2P 3GIJA 4YR0A 1XSLA 2MU2A 8ICPA 7ICHA 4WC2A 2M2VA 2ZH2A 4C8MA 4RUCA 5J2JA 1N5XA 3V7LA 4FO6A 3NVWA 2JHDA 3GDXA 3UQ2A 4NLZA 2KJ5A 4RQ1A 4F4YA 4JV0A 1ZOLA 4YMMA 4PH5A 2BDPA 2HOFA 2J6TA 4WJ3B 1NJYA 1BVSA 1S0NA 5KFTA 4AT7A 3MGHA 4ICAA 4B9VA 4IG8A 2NO4A 2W9AA 2KHQA 4O5CA 3TQ1A 2V4QA 4DL7A 4RQNA 4DSLA 5J2EA 2EH9A 3H8MA 3N97B 3NS1A 2UVWA 2LKYA 3AM9A 2F77X 2IOHA 2Z7JA 4J9KA 1L5UA 2F2AB 2QLTA 3TADC 1S0OA 4FZNA 3HJ1A 5IIIA 2ZTCA 5EOZA 1ZQMA 2AQ4A 1T3QA 1KQQA 4Y2UA 4C8NA 1FFUA 3THVA 1VDVA 3ALRA 3HX0A 5AM0A 1Q3UA 8ICAA 4ACOA 3TFRA 2Y9UA 3PY8A 2O6KA 4F5OA 4PZOA 2I5HA 3D2SA 3H8WA 1NKBA 3M9NB 4ED2A 2EANA 4F4ZA 2HBLA 4QWCA 1GO3F 5CHEA 3K1RB 5EWFA 4YG2A 3H40A 4YMOA 2FMQA 3GV5B 3QUCA 2KSOB 4QZFA 3OVAA 3HP6A 1DOQA 1Z1BA 2W7OA 4F93B 1SKRA 4F72A 7ICTA 2E8NA 5J2AA 4AYBF 2QB0A 1DGSA 3BQ0A 2BQRA 2YMMA 4ECXA 1SV0A 5ALHA 5ALQA 4I2EA 4BJQA 4J9MA 1S10A 4HYKA 3QEAZ 1Z4OA 2RP5A 1KRPA 1S8OA 3C1ZA 2QARA 2DFLA 4UAUA 2I6XA 4O3QA 4AP9A 2W7PA 4B9SA 4QZGA 4KLMA 2FPMA 2IHOA 2HHUA 2JEFA 4ECSA 3TFSA 8ICBA 1Z00A 5HR9A 1K5OA 5CA7A 7ICGA 3ZDEA 5BPCA 4PHEA 4NXZA 3PZPA 4DOAA 4ELVA 4CRXA 4FH5A 2R8HA 4C0ZA 3LVVA 1TK8A 4LEWA 5KFOA 3ORYA 4UB3A 4Y2SA 1S97A 1L3TA 1AROP 4OAHA 4AYBC 2B0CA 2C28A 5IIJA 1RYRA 1U49A 5AI5A 8ICZA 8ICRA 3QU7A 5EWGA 4KLGA 4UB1A 5IIMA 1NK5A 3WFOA 1SV0C 2K4HA 4EBCA 4FZLA 5FP0A 2G09A 4YD2A 3L4PA 5KG1A 1VLBA 9ICGA 4IQVA 1A6SA 2ALZA 2IUBA 5J0UA 2ZH4A 4ATBB 4I2GA 3BS5B 1U48A 4IRCA 4YMNA 4X5VA 2M9NA 2IA6A 5B66U 5ALIA 1PX5A 5KFLA 3RJKA 4QW8A 4KLJA 3Q8LA 5JUMA 4N7RA 4OD0A 2A1AA 5HRFA 9ICQA 3MFHA 5KFBA 3AN1A 1ZXIA 1COOA 3C29A 2VIXA 4RQ3A 4OJLA 5HHHA 3VC8A 5HR6A 3NWIA 5DG9A 4KN7A 3HT3A 4AT7B 2RQ5A 1JN3A 2BBJA 2UVVA 3MGIA 2GLEA 4US8A 1DXSA 5ALMA 4UBCA 7ICPA 5CEHA 5T14A 4PJ0U 4KMUA 3IG5A 2BE3A 2LPEA 2MUTA 4WBYA 1PZNA 3EF2A 1Q8KA 5KT5A 4ED0A 2VA2A 1YT3A 2DR9A 2ZJ5A 3PV8A 2GO7A 3V6KA 2ZHAA 2JZBA 2VJ4A 2HBMA 2M2WA 3F2CA 4RQ2A 1FO4A 3GIIA 5EWEA 2BCSA 1NNLA 5B3PA 2A1JA 4MHVA 5CWRA 1D9DA 1NK0A 5AK6A 5HRDA 2W9MA 3JCFA 4ED8A 2F8KA 1V85A 1ZQYA 3Q8KA 1R8CA 4OJOA 4O6AA 4F91B 4NKTA 5DEDA 1RG6A 3LK9A 3AQLA 2H3VA 5KFQA 4KTQA 4DQQA 2KKPA 4RU9A 4ECYA 4HAIA 4YXJA 2W9CA 3H8SA 9ICRA 1LKYA 1X40A 3SI8A 2HHPA 4O3RA 5AM3A 2QB0B 2HMXA 1U4BA 2XICA 4ECZA 7ICJA 3MR5A 3B0XA 2O5AA 3PW5A 4XA5A 5KFIA 2QARB 3WK4A 1RXVA 4EYIB 5HMLA 2YB4A 4ZOHC 5KT6A 5ALWA 3EZ5A 2ODGA 1Z00B 1KLNA 2ZH7A 2Y0SF 2PFOA 8ICGA 4WC1A 5CFUA 2QB1A 5C5JA 4M9LA 4Z6FA 1RYSA 4G9BA 5J0OA 3WK5A 3UMGA 4DSFA 1T7PA 2B56A 2K8CB 3QUBA 4CDGA 1NK9A 2IOFK 2ZH1A 5HRIA 3TI0A 2DF4B 2JEJA 1JALA 5B3QA 4DQIA 2KIWA 1BGXT 1PVRA 1V4AA 1T94A 4MFAA 2RFFA 5ALTA 3KHRA 3IV6A 4RQ4A 1F5SA 1MA7A 3N4MB 4QW9A 1NJZA 3SQIA 3GILA 4ECUA 1ZQLA 5HRLA 1A76A 3ZD8A 4DFKA 4I2IA 1KFDA 2BCQA 4GIBA 1QQ7A 4BGDA 4IS7A 1ZQRA 2BQ3A 3MDAA 2OM6A 3TANA 4RWNA 4QJFB 2KIVA 2IHNA 1IXRA 3WK9A 2DL0A 5KFUA 3RJGA 4DSJA 4ELTA 2ASLA 4KLFA 1QQ6A 4RPXA 2BR0A 5D63A 4JUZA 2KK0A 4Q45A 3MR6A 3WFRE 4DEZA 3FAHA 3HJ4A 2F76X 5ALEA 4WC6A 4M47A 4RQ7A 4O5KA 2XVTA 1B22A 7ICQA 4QZAA 2MUTB 4DFJA 4K96A 3KZIU 4Y2YA 1UT8A 2JZBB 3BDPA 3ISBA 4J9NA 3FDSA 3HKZF 3H7IA 4YVZA 1ZQKA 4UB6U 1NO5A 4JLZA 2HOQA 5AM2A 2FE9A 2A1JB 4NXTA 4ED7A 4DL2A 5DLFA 1PVQA 4UQGA 2K60A 1Q46A 1L8OA 4UAZA 1KEJA 2Y1IA 4Y2RA 4QZDA 1IV8A 2V9WA 4RNOA 3SMVA 3KHGA 3T79A 2HCFA 4PPXA 3SYZA 5HHIA 1X42A 1UPHA 3HRDD 5D4BA 2D8CA 2PI5A 5KG3A 2W9CB 1LKYB 2ZH6A 2HDOA 5KAFU 4WQLA 5HRGA 3BQTA 1IG6A 2G08A 4J9RA 1BPBA 5KFYA 3H38A 3V72A 2VANA 1LV5A 2DR7A 2OXOA 3H37A 2W03A 2OHFA 2J6SA 3V6HA 1TV9A 4MEXA 4QZCA 4X4VA 1ZQOA 4KX5A 3ZDAA 2V4RA 1ZQDA 5IIOA 3M9MB 2BCRA 2A19A 3Q8PB 3PX0A 1ZQCA 1FEZA 5TZVA 4C8KA 2H3QA 2ZHBA 1B43A 4XQ7A 3PX6A 1QTMA 4KLQA 1KDHA 2F44A 4Z6DA 4O67A 1DRGA 1TKDA 4MF2A 4MFFA 2B51A 4RQ8A 1ZQQA 2HHWA 2P66A 3QU5A 4C4SA 4ED1A 3MC1A 4X0AA 2KZ3A 4X4QA 4S3NA 5KFNA 2ZIUA 2BQUA 4IR1A 4HX0A 1Z4NA 1SXEA 9ICFA 2W3RA 4BDPA 2JH1A 3MBYA 3B0YA 3RH5A 5J2FA 2YN4A 5AI8A 1TFWA 3L9DA 1RQNA 5DG8A 1COKA 9ICHA 2XGQA 1L6NA 5KFCA 2ZXIA 1BNPA 2PBEA 4M5DA 2M0NA 4QNLA 4F2SA 4KLSA 3RB4A 3GU3A 2KJ8A 4I2DA 3QZ7A 4WC7A 1O03A 4RQ0A 1YZ7A 2DR5A 2RDJA 1K1SA 4ELUA 1NOMA 1ZQVA 4UBBA 2UVUA 4J9PA 3UM9A 3OHAA 5A0LA 1TK0A 1WCNA 3PX4A 1KTQA 5DBBA 3RAQA 5ALFA 4KITB 2E8OA 5L1IA 4J9SA 2WF8A 2KNJA 2LYBA 4EP7A 1ZYQA 4IRDA 2NV3A 3T5JA 2ID1A 4RWPA 4E80A 4DLGA 2ZIVA 3BZCA 2D6FC 3NTUA 2FI1A 4RZRA 1CEZA 2W9BB 4MEYA 3A0BU 5KFZA 4FS2A 4X4TA 2KD1A 4US9A 1ZQAA 2GA9D 1QSSA 1TFYA 1L3VA 3EUB2 3B9JA 9ICPA 2H5XA 1ZQHA 4DL3A 3V6JA 8ICCA 3UXNA 4EEKA 5CFTA 3ER8C 4QWDA 2WTFA 3NUQA 4EBEA 1MIYA 4NLCA 1TVAA 3T3FA 2KG5A 2R8JA 8ICMA 4O69A 3RBDA 3KD3A 5DQIA 5KFSA 4CCHA 4I2FA 4C80A 1H38A 5EE1A 5C0YA 2EZYA 1WUDA 1T3NA 2JEGA 4UASA 4CF4A 5ALXA 4NY8A 1QQ5A 2OCEA 5AKKA 4NLNA 3N7SC 2VJ5A 3GIMA 5DB6A 5JTIA 4J9QA 1TE2A 4QWAA 1VJ7A 4FHPA 4FH3A 1RM6C 3AQMA 1NJWA 4NXWA 4F5RA 5BOLA 1P7DA 1X2IA 5DG7A 2XI9A 1S9FA 3RR7A 5JTGA 4DS5A 3IDWA 1Q79A 4TURA 2DRBA
chains in the Genus database with same CATH topology
1Q78A 1ZQIA 3UXOA 3ZD9A 4UD5A 4WC5A 3C2LA 1NK6A 4DOCA 7ICNA 1ZQJA 2F1IA 4UBCA 2KZMA 7ICPA 4WC3A 3HWTA 2F1HA 4KMUA 4FHYA 4KLUA 3RH4A 8ICWA 2BE3A 4WBYA 2MUTA 1PZNA 5KT5A 4ED0A 2VA2A 4Z6CA 2DR9A 2ZJ5A 3PV8A 3V6KA 1MIWA 4WBZA 1S77D 2ZHAA 2JZBA 5KFHA 3M8RA 2M2WA 3HW8A 4FS1A 5J2BA 4RQ2A 5DB7A 2ZH5A 4QZBA 3PR4A 2C22A 3GIIA 5EWEA 3MDCA 2BPFA 3PW2A 2BCSA 5HRKA 4M6WA 1JQRA 2RDIA 4TUPA 3GV8B 2BPGA 2A1JA 2I1QA 5KT3A 5CWRA 1D9DA 2NRKA 9ICTA 1NK0A 4O3SA 3MABA 4ED6A 3SZ2A 5IILA 2XGPA 8ICFA 1BPEA 8ICIA 5HRDA 4X4OA 2W9MA 1HUOA 4F5PA 4ED8A 2ISOA 4KLLA 8ICUA 5KFJA 3H3AA 3M9OB 1NJXA 2FMSA 4F92B 5D46A 4F3OA 1ZQYA 3Q8KA 1R8CA 4P4OA 4F91B 2HHSA 1U45A 4NKTA 1XSPA 3PR5B 5DEDA 5KFGA 4RQ5A 5J29A 4RNMA 3LK9A 3UPQA 5KFQA 4M9NA 3AQLA 4KTQA 3JPRA 5KFEA 4TUSA 2ATLA 4EBJA 4DQQA 4RPZA 4NLKA 4RU9A 4ECYA 2VA3A 4EZ9A 4TQRA 4DFMA 1ZJNA 4LZDA 1SKSA 4EBDA 4YXJA 1QLNA 4AT8B 2DVIA 2W9CA 3H8SA 3RR8A 1MQ3A 3ISDA 3ISCA 2XC9A 3JPSA 4M0AA 1MC8A 9ICRA 3SI8A 4YN4A 4M9GA 2HHPA 4O3RA 4B9UA 4FHWA 1HUZA 5KT4A 2HVIA 4X0BA 2AQ0A 4GXJA 4M9JA 5DDYA 3T5KA 4B9TA 4FBTA 1KSPA 1U4BA 2P6UA 2XY5A 4ECZA 7ICJA 1NKEA 1BPYA 3MR5A 3B0XA 1DK3A 5KFXA 2O5AA 4R65A 3PW5A 2DRAA 2F1JA 4QWBA 4XA5A 2BCUA 5KFIA 3Q8RB 4DS4A 4EEYA 2Q0ZX 1SL0A 3G6YA 1RXVA 3AQNA 5CR0A 4EYIB 5HMLA 2Q66A 2BCVA 5F2VO 2BHNA 4RQ6A 3H4BA 4F5QA 2ZUBA 3LDAA 2PI4A 4YP3A 4I28A 5KT6A 3WFSC 5J0SA 3EZ5A 1BNOA 1NKCA 1Z00B 5F9NA 5J2DA 4GLXA 1S76D 5KG4A 4PGXA 2ZUCA 4F5NA 4I2AA 1L3SA 1X9WA 2VA8A 4YR3A 1KLNA 3KHHA 5CP2A 2ZH7A 4Q8EA 3C5FA 2PFOA 3RB6A 8ICGA 4WC1A 4ECRA 5C5JA 1SKWA 5KFRA 4ECQA 7ICUA 1VFGA 4M9LA 2NRXA 2C2DA 9ICSA 8ICLA 2OWOA 3IM1A 4Z6FA 4O3OA 4O0IA 3JPTA 4F4WA 5DBAA 3EPGA 4PHDA 1RYSA 3RJJA 5J0OA 4J9LA 9ICJA 4YR2A 4DSFA 1T7PA 2ZH8A 4JK1A 3Q8MA 3JPQA 4I2BA 3AU2A 2FMPA 4R66A 2ZTEA 5J0PA 4KLOA 2C2EA 5DQHA 1NK9A 5HREA 5DDMA 1ZQXA 2ZH1A 4QZIA 1NK7A 9ICMA 5HRIA 4TUQA 3TI0A 2JEJA 2HHVA 1TK5A 2AU0A 2DPJA 4DQIA 1T8EA 3UQ0A 4M04A 4R8UB 2FLPA 4LVSA 4QZEA 1BGXT 1V4AA 5J0RA 2W8KA 4MFAA 4YFKA 1ZETA 3C23A 3KHRA 2RFFA 5KFVA 5DLGA 4JWMA 1BPXA 4F4KA 4RQ4A 1KNYA 9ICOA 5HRHA 4Z6EA 5BOMA 1BPDA 2ZUDA 4O5EA 2HVHA 2ZJAA 3H8JA 3N4MB 8ICTA 2ASDA 8ICJA 4DF8A 3ZDBA 4P4PA 1JMSA 1ZQUA 3PW7A 3WFPA 3UPSA 4QW9A 2ZH9A 1NJZA 5HP4A 3FYHA 3C66A 4J9OA 3GILA 8ICVA 4RWOA 3RJHA 3C2KA 4ECUA 2ZTDA 1ZQLA 4B9LA 3PNCA 1L3UA 4C8LA 1JXEA 3QE9Y 5HRLA 1A76A 3ZD8A 4MF8A 4DFKA 5J2GA 4QZHA 1CUKA 2BGWA 4I2IA 3SV3A 2C2RA 1KFDA 9ICXA 2DR8A 2BCQA 4X4UA 3OV7A 4I2CA 3JPPA 4JV2A 8ICCA 9ICAA 8ICHA 2XO7A 2B21A 2O1PA 4BGDA 2NRWA 1QSYA 1ZQRA 2BQ3A 4ZH4A 3WFQE 5KG6A 3MDAA 3TANA 2IBKA 7ICFA 4RWNA 2XY7A 3HPOA 4ECVA 1BPZA 5KFPA 4DQRA 5L1LA 4B9NA 1UEUA 4FBUA 3OHBA 4JV1A 3RB0A 3OJSA 4UB4A 2IHNA 1IXRA 1U9LA 1MQ2A 4DSKA 3PO5A 3C5GA 3UXPA 1ZQWA 4QWEA 2PXIA 3PVXA 5KFMA 1XU4A 4K4GA 4E8FA 5KFUA 1X9SA 5DGAA 3RJGA 4DSJA 4ELTA 1YLQA 2ASLA 2KFZA 4KLFA 3QZ8A 4RPXA 3LWMA 2BR0A 3HIYA 1JIHA 1UETA 4G3IA 3OUYA 3JZ0A 2NRZA 4JUZA 4M9HA 5DB9A 3H4DA 4E0DA 4DSIA 4Q45A 3MR6A 3WFRE 8ICOA 4DEZA 3EWAA 5J0XA 2KN7A 1XO1A 1FA0A 3HJ4A 1S0VA 4WC6A 1V9PA 4M47A 4QZ8A 1XS9D 4RQ7A 4TQSA 3AUOA 2Y1JA 2ISPA 4O5KA 3QEBZ 1B22A 7ICQA 1KFSA 4QZAA 2BPCA 2MUTB 3Q8SB 4DFJA 5HMMA 1D8LA 5IINA 2AGOA 2HHQA 4DOBA 9ICWA 3RJEA 3EYZA 3AU6A 3OJUA 1UT8A 2JZBB 2UVVA 2R8KA 3BDPA 4O3NA 3ISBA 1WCLA 4K4HA 8ICNA 4J9NA 3FDSA 4AT9A 1C7YA 3OSPA 4EBKA 1OU5A 1Y88A 3H7IA 4YVZA 5CJ7A 1EXNA 1ZQKA 1JXLA 2UVRA 4KLTA 5L9XA 1ZQSA 7ICMA 1NO5A 4DQSA 4I29A 5J0YA 4R63A 1QSLA 3RJFA 4M6WB 4JWNA 2A1JB 4RNNA 3T5LA 5KFWA 4ED7A 3AQKA 4ECTA 4DL2A 3C1YA 5CB1A 4DLEA 5J2IA 4ED3A 2J6UA 4KLIA 1U47A 4FHVA 1SZPA 5DLFA 1UEVA 4NKUA 2AGQA 5KFFA 4UQGA 4DO9A 2KZZA 4UAWA 9ICIA 3GV7B 7ICLA 3GIJA 4YR0A 5F9LA 1XSLA 4UAZA 1UA0A 1KEJA 8ICPA 2Y1IA 7ICHA 3BQ1A 2M2VA 4WC2A 3OVAA 2KTQA 4DFPA 3C18A 2ZH2A 4Q8FA 3PW0A 4QZDA 1ZQPA 2V9WA 4C8MA 5KFKA 4RUCA 5J2JA 1T4GA 4RNOA 4FHXA 3V7LA 5DGBA 4FO6A 3RBEA 8ICKA 3GDXA 3UQ2A 3KHGA 4NLZA 4PPXA 5HHIA 3SYZA 4RQ1A 4P4MA 3MR3A 4JV0A 4F4YA 5HC9A 5D49A 5D4BA 4DWIA 2PI5A 1ZQZA 5KG3A 4YMMA 4PH5A 2M2UA 2W9CB 2BDPA 2R8IA 5J2HA 4X4SA 2ZH6A 2I9GA 2J6TA 5HRGA 3BQTA 4X4NA 8ICXA 1NJYA 4J9RA 3JPOA 5KT2A 1BPBA 5KFYA 3H38A 3V72A 1BVSA 2VANA 5KFTA 1S0NA 3MGHA 1LV5A 4BXOA 4IR9A 4AT7A 1SL2A 3H37A 4LZGA 2DR7A 4O3PA 4B9VA 4Q44A 3PMLA 1RZTA 2J6SA 3V6HA 4DL6A 2W9AA 1KFTA 1TV9A 4IG8A 4O5CA 4X4PA 3TQ1A 2V4QA 4QZCA 4MEXA 2DPIA 1SL1A 4X4VA 4DL7A 4KLHA 4DSLA 1ZQOA 5J2EA 4I27A 4P2HA 3ZDAA 3N97B 4LT6A 4RUAA 4UAYA 2V4RA 1ZQDA 2UVWA 1TAQA 5IIOA 4GXKA 3M9MB 3T5HA 2BCRA 4RT3A 1NK4A 4XUSA 3Q8PB 4J9KA 3PX0A 3H39A 4EZ6A 1ZQCA 1L5UA 5TZVA 4C8KA 1A77A 1X9MA 1S0OA 2ZHBA 1B43A 3OVSA 3G6VA 3PX6A 4XQ7A 5KTQA 1QTMA 1KDHA 4KLQA 4IQUA 5IIIA 3HJ1A 1TFRA 2ZTCA 4PHAA 4Z6DA 1F5AA 5EOZA 1TKDA 4RPYA 1ZQMA 4MF2A 2AQ4A 1N48A 1R8BA 4MFFA 4IQTA 4RQ8A 3PW4A 1ZQQA 4C8NA 3ZDDA 2HHWA 4M2YA 2P66A 2ASJA 3THVA 4ED1A 3C21A 1ZQBA 1TAUA 1HJPA 5KG2A 4BWMA 3HX0A 4X0AA 2KZ3A 2IMWP 8ICAA 3TFRA 3PY8A 4X4QA 4S3NA 5KFNA 4F5OA 3RRHA 4RT2A 2BQUA 1ZQEA 4IR1A 1MSWD 5DB8A 2HHXA 9ICLA 9ICKA 9ICFA 3H8WA 4BDPA 3MBYA 4KLDA 1RXWA 3B0YA 3RH5A 5J0WA 1NKBA 4O9MA 3M9NB 5J2FA 4ED2A 4F4ZA 4DQPA 1TFWA 2FLNA 4QWCA 3L9DA 4F2RA 5DG8A 5EWFA 3G6XA 4YG2A 5KFAA 5KFCA 2XGQA 4EYHB 3H40A 9ICHA 9ICUA 1BNPA 4YMOA 3JPNA 2PBEA 2FMQA 3GV5B 4F2SA 4M5DA 4KLSA 2BKEA 4QZFA 3RB4A 3V7JA 4IRKA 1NZPA 1K1QA 4I2DA 3IHQB 7ICRA 3HP6A 1DOQA 3LQCB 4DL5A 3QZ7A 2PFNA 4AT8A 4F93B 2NRTA 1SKRA 4RQ0A 1JX4A 2P6RA 4WC7A 4I2JA 7ICTA 1MIVA 3OVBA 4BWJA 5J0QA 3NYBA 2GWSA 2DR5A 4UD4A 1RPLA 1K1SA 5J2AA 2RDJA 3C2MA 3TAPA 9ICNA 1DGSA 3BQ0A 4ELUA 2W9BA 4F8RA 2BQRA 1LB2B 7ICVA 2KFNA 1NOMA 1ZQVA 4UBBA 4ECXA 2UVUA 1XWLA 4J9PA 1ZJMA 4WC0A 4I2EA 3OHAA 3RTVA 4Q43A 3LWLA 4J9MA 1S10A 2PFQA 4HYKA 3QEAZ 1TK0A 5HRBA 4X4RA 1WCNA 9ICVA 3OSNA 1KRPA 3JYYA 3C1ZA 3PX4A 1KTQA 2DFLA 5DBBA 5J2CA 3RAQA 1Z3EB 4O3QA 4PHPA 4B9SA 4QZGA 3K75D 4KITB 4GC6A 5L1KA 4KLMA 2FPMA 3ZDCA 5J0TA 3KTQA 2HHUA 1ZQGA 5L1IA 2JEFA 3PO4A 3TARA 4J9SA 4ECSA 3TFSA 3RB3A 8ICBA 5IIKA 1ZQNA 2IHMA 1Z00A 4YQWA 4B9MA 5HR9A 4RWQA 4EP7A 1NK8A 4YXMA 5CA7A 1ZYQA 4IRDA 7ICGA 3ZDEA 5BPCA 1ZQFA 4PHEA 3T5JA 4NXZA 2ID1A 4DF4A 4RWPA 4E80A 4DOAA 4ELVA 1JAJA 4FH5A 4DLGA 2R8HA 9ICCA 1TK8A 5DBCA 2AGPA 3NTUA 3V7KA 2PFPA 5KFOA 3ORYA 4RZRA 2FLLA 3OUYB 4IQWA 4UB3A 3GQCA 4PGYA 1CEZA 2W9BB 4DL4A 4MEYA 1S97A 1L3TA 5KT7A 5KFZA 2XCAA 4FS2A 3RRGA 3E2EA 1AROP 7ICEA 5HNKA 1DK2A 4X4TA 4ECWA 3EW9A 5DECA 1ZQAA 2LYHA 1QSSA 3Q8QB 2C28A 5IIJA 4YCXA 1RYRA 9ICEA 1TFYA 1L3VA 4R8UA 3SV4A 1U49A 9ICPA 3K4GA 1UA1A 4WCWA 2H5XA 1D9FA 1ZQHA 5DQGA 8ICZA 8ICRA 4DL3A 3V6JA 3KHLA 3BQ2A 4NM2A 5EWGA 3UXNA 4KLGA 7ICKA 4UB1A 3GIKA 5IIMA 2W8LA 4QZ9A 1NK5A 8ICYA 3WFOA 4QWDA 4R64A 4EBCA 3BJYA 1WOTA 4AT9B 2NRVA 2WTFA 1ZQTA 3PMNA 4EBEA 2XY6A 1MIYA 4YD2A 4UB5A 5J2KA 1TVAA 7ICSA 3T3FA 2JEIA 5KG1A 2R8JA 9ICGA 4IQVA 7ICOA 2ALZA 8ICMA 4GXIA 4YD1A 3RBDA 3RJIA 7ICIA 5J0UA 3OGUA 8ICQA 5DQIA 1N56A 5KFSA 4CCHA 4I2FA 2ZH4A 1H38A 2KP7A 4ATBB 5KG7A 4I2GA 5DKWA 4WC4A 4F4XA 4XRHA 4XQ8A 1U48A 2M2TA 1XSNA 4IRCA 4YMNA 1T3NA 2JEGA 5KG5A 3RH6A 1UT5A 1IM4A 5CHGA 4NM1A 4X5VA 2M9NA 3TAQA 4ATBA 2IA6A 5KG0A 2MAXA 2HW3A 4I2HA 2AJQA 4NY8A 1XC9A 5KFLA 1PX5A 3GFKB 2ZJ8A 3RJKA 4MFCA 2HHTA 4QW8A 4NLNA 4KLJA 3Q8LA 5JUMA 1R89A 3RAXA 2XCPA 3GIMA 5DB6A 3EPIA 9ICBA 4PGQA 4F50A 1R8AA 5HRFA 4J9QA 4E7XA 2ZH3A 3M8SA 9ICQA 3MFHA 4DSEA 4QWAA 1VJ7A 4FHPA 4FH3A 3ETLA 5KFBA 3AQMA 1NJWA 8ICEA 5L1JA 1COOA 4F5RA 4GC7A 1D8YA 5BOLA 4KLEA 8ICSA 2R8GA 4KN4A 4RQ3A 1S0MA 5HHHA 2FPKA 5KFDA 1X2IA 4C8OA 5DG9A 4UB2A 5DG7A 4KN7A 3HT3A 4K4IA 2FPLA 4BXOB 4AT7B 1S9FA 3RR7A 4NLGA 3MR2A 1JN3A 3NGDA 4DS5A 1Q79A 3MFIA 4TURA 3MGIA 2DRBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q78 A;  1ZQI A;  3UXO A;  3ZD9 A;  4UD5 A;  4WC5 A;  3C2L A;  1NK6 A;  4DOC A;  7ICN A;  1ZQJ A;  2F1I A;  4UBC A;  2KZM A;  7ICP A;  4WC3 A;  3HWT A;  2F1H A;  4KMU A;  4FHY A;  4KLU A;  3RH4 A;  8ICW A;  2BE3 A;  4WBY A;  2MUT A;  1PZN A;  5KT5 A;  4ED0 A;  2VA2 A;  4Z6C A;  2DR9 A;  2ZJ5 A;  3PV8 A;  3V6K A;  1MIW A;  4WBZ A;  1S77 D;  2ZHA A;  2JZB A;  5KFH A;  3M8R A;  2M2W A;  3HW8 A;  4FS1 A;  5J2B A;  4RQ2 A;  5DB7 A;  2ZH5 A;  4QZB A;  3PR4 A;  2C22 A;  3GII A;  5EWE A;  3MDC A;  2BPF A;  3PW2 A;  2BCS A;  5HRK A;  4M6W A;  1JQR A;  2RDI A;  4TUP A;  3GV8 B;  2BPG A;  2A1J A;  2I1Q A;  5KT3 A;  5CWR A;  1D9D A;  2NRK A;  9ICT A;  1NK0 A;  4O3S A;  3MAB A;  4ED6 A;  3SZ2 A;  5IIL A;  2XGP A;  8ICF A;  1BPE A;  8ICI A;  5HRD A;  4X4O A;  2W9M A;  1HUO A;  4F5P A;  4ED8 A;  2ISO A;  4KLL A;  8ICU A;  5KFJ A;  3H3A A;  3M9O B;  1NJX A;  2FMS A;  4F92 B;  5D46 A;  4F3O A;  1ZQY A;  3Q8K A;  1R8C A;  4P4O A;  4F91 B;  2HHS A;  1U45 A;  4NKT A;  1XSP A;  3PR5 B;  5DED A;  5KFG A;  4RQ5 A;  5J29 A;  4RNM A;  3LK9 A;  3UPQ A;  5KFQ A;  4M9N A;  3AQL A;  4KTQ A;  3JPR A;  5KFE A;  4TUS A;  2ATL A;  4EBJ A;  4DQQ A;  4RPZ A;  4NLK A;  4RU9 A;  4ECY A;  2VA3 A;  4EZ9 A;  4TQR A;  4DFM A;  1ZJN A;  4LZD A;  1SKS A;  4EBD A;  4YXJ A;  1QLN A;  4AT8 B;  2DVI A;  2W9C A;  3H8S A;  3RR8 A;  1MQ3 A;  3ISD A;  3ISC A;  2XC9 A;  3JPS A;  4M0A A;  1MC8 A;  9ICR A;  3SI8 A;  4YN4 A;  4M9G A;  2HHP A;  4O3R A;  4B9U A;  4FHW A;  1HUZ A;  5KT4 A;  2HVI A;  4X0B A;  2AQ0 A;  4GXJ A;  4M9J A;  5DDY A;  3T5K A;  4B9T A;  4FBT A;  1KSP A;  1U4B A;  2P6U A;  2XY5 A;  4ECZ A;  7ICJ A;  1NKE A;  1BPY A;  3MR5 A;  3B0X A;  1DK3 A;  5KFX A;  2O5A A;  4R65 A;  3PW5 A;  2DRA A;  2F1J A;  4QWB A;  4XA5 A;  2BCU A;  5KFI A;  3Q8R B;  4DS4 A;  4EEY A;  2Q0Z X;  1SL0 A;  3G6Y A;  1RXV A;  3AQN A;  5CR0 A;  4EYI B;  5HML A;  2Q66 A;  2BCV A;  5F2V O;  2BHN A;  4RQ6 A;  3H4B A;  4F5Q A;  2ZUB A;  3LDA A;  2PI4 A;  4YP3 A;  4I28 A;  5KT6 A;  3WFS C;  5J0S A;  3EZ5 A;  1BNO A;  1NKC A;  1Z00 B;  5F9N A;  5J2D A;  4GLX A;  1S76 D;  5KG4 A;  4PGX A;  2ZUC A;  4F5N A;  4I2A A;  1L3S A;  1X9W A;  2VA8 A;  4YR3 A;  1KLN A;  3KHH A;  5CP2 A;  2ZH7 A;  4Q8E A;  3C5F A;  2PFO A;  3RB6 A;  8ICG A;  4WC1 A;  4ECR A;  5C5J A;  1SKW A;  5KFR A;  4ECQ A;  7ICU A;  1VFG A;  4M9L A;  2NRX A;  2C2D A;  9ICS A;  8ICL A;  2OWO A;  3IM1 A;  4Z6F A;  4O3O A;  4O0I A;  3JPT A;  4F4W A;  5DBA A;  3EPG A;  4PHD A;  1RYS A;  3RJJ A;  5J0O A;  4J9L A;  9ICJ A;  4YR2 A;  4DSF A;  1T7P A;  2ZH8 A;  4JK1 A;  3Q8M A;  3JPQ A;  4I2B A;  3AU2 A;  2FMP A;  4R66 A;  2ZTE A;  5J0P A;  4KLO A;  2C2E A;  5DQH A;  1NK9 A;  5HRE A;  5DDM A;  1ZQX A;  2ZH1 A;  4QZI A;  1NK7 A;  9ICM A;  5HRI A;  4TUQ A;  3TI0 A;  2JEJ A;  2HHV A;  1TK5 A;  2AU0 A;  2DPJ A;  4DQI A;  1T8E A;  3UQ0 A;  4M04 A;  4R8U B;  2FLP A;  4LVS A;  4QZE A;  1BGX T;  1V4A A;  5J0R A;  2W8K A;  4MFA A;  4YFK A;  1ZET A;  3C23 A;  3KHR A;  2RFF A;  5KFV A;  5DLG A;  4JWM A;  1BPX A;  4F4K A;  4RQ4 A;  1KNY A;  9ICO A;  5HRH A;  4Z6E A;  5BOM A;  1BPD A;  2ZUD A;  4O5E A;  2HVH A;  2ZJA A;  3H8J A;  3N4M B;  8ICT A;  2ASD A;  8ICJ A;  4DF8 A;  3ZDB A;  4P4P A;  1JMS A;  1ZQU A;  3PW7 A;  3WFP A;  3UPS A;  4QW9 A;  2ZH9 A;  1NJZ A;  5HP4 A;  3FYH A;  3C66 A;  4J9O A;  3GIL A;  8ICV A;  4RWO A;  3RJH A;  3C2K A;  4ECU A;  2ZTD A;  1ZQL A;  4B9L A;  3PNC A;  1L3U A;  4C8L A;  1JXE A;  3QE9 Y;  5HRL A;  1A76 A;  3ZD8 A;  4MF8 A;  4DFK A;  5J2G A;  4QZH A;  1CUK A;  2BGW A;  4I2I A;  3SV3 A;  2C2R A;  1KFD A;  9ICX A;  2DR8 A;  2BCQ A;  4X4U A;  3OV7 A;  4I2C A;  3JPP A;  4JV2 A;  8ICC A;  9ICA A;  8ICH A;  2XO7 A;  2B21 A;  2O1P A;  4BGD A;  2NRW A;  1QSY A;  1ZQR A;  2BQ3 A;  4ZH4 A;  3WFQ E;  5KG6 A;  3MDA A;  3TAN A;  2IBK A;  7ICF A;  4RWN A;  2XY7 A;  3HPO A;  4ECV A;  1BPZ A;  5KFP A;  4DQR A;  5L1L A;  4B9N A;  1UEU A;  4FBU A;  3OHB A;  4JV1 A;  3RB0 A;  3OJS A;  4UB4 A;  2IHN A;  1IXR A;  1U9L A;  1MQ2 A;  4DSK A;  3PO5 A;  3C5G A;  3UXP A;  1ZQW A;  4QWE A;  2PXI A;  3PVX A;  5KFM A;  1XU4 A;  4K4G A;  4E8F A;  5KFU A;  1X9S A;  5DGA A;  3RJG A;  4DSJ A;  4ELT A;  1YLQ A;  2ASL A;  2KFZ A;  4KLF A;  3QZ8 A;  4RPX A;  3LWM A;  2BR0 A;  3HIY A;  1JIH A;  1UET A;  4G3I A;  3OUY A;  3JZ0 A;  2NRZ A;  4JUZ A;  4M9H A;  5DB9 A;  3H4D A;  4E0D A;  4DSI A;  4Q45 A;  3MR6 A;  3WFR E;  8ICO A;  4DEZ A;  3EWA A;  5J0X A;  2KN7 A;  1XO1 A;  1FA0 A;  3HJ4 A;  1S0V A;  4WC6 A;  1V9P A;  4M47 A;  4QZ8 A;  1XS9 D;  4RQ7 A;  4TQS A;  3AUO A;  2Y1J A;  2ISP A;  4O5K A;  3QEB Z;  1B22 A;  7ICQ A;  1KFS A;  4QZA A;  2BPC A;  2MUT B;  3Q8S B;  4DFJ A;  5HMM A;  1D8L A;  5IIN A;  2AGO A;  2HHQ A;  4DOB A;  9ICW A;  3RJE A;  3EYZ A;  3AU6 A;  3OJU A;  1UT8 A;  2JZB B;  2UVV A;  2R8K A;  3BDP A;  4O3N A;  3ISB A;  1WCL A;  4K4H A;  8ICN A;  4J9N A;  3FDS A;  4AT9 A;  1C7Y A;  3OSP A;  4EBK A;  1OU5 A;  1Y88 A;  3H7I A;  4YVZ A;  5CJ7 A;  1EXN A;  1ZQK A;  1JXL A;  2UVR A;  4KLT A;  5L9X A;  1ZQS A;  7ICM A;  1NO5 A;  4DQS A;  4I29 A;  5J0Y A;  4R63 A;  1QSL A;  3RJF A;  4M6W B;  4JWN A;  2A1J B;  4RNN A;  3T5L A;  5KFW A;  4ED7 A;  3AQK A;  4ECT A;  4DL2 A;  3C1Y A;  5CB1 A;  4DLE A;  5J2I A;  4ED3 A;  2J6U A;  4KLI A;  1U47 A;  4FHV A;  1SZP A;  5DLF A;  1UEV A;  4NKU A;  2AGQ A;  5KFF A;  4UQG A;  4DO9 A;  2KZZ A;  4UAW A;  9ICI A;  3GV7 B;  7ICL A;  3GIJ A;  4YR0 A;  5F9L A;  1XSL A;  4UAZ A;  1UA0 A;  1KEJ A;  8ICP A;  2Y1I A;  7ICH A;  3BQ1 A;  2M2V A;  4WC2 A;  3OVA A;  2KTQ A;  4DFP A;  3C18 A;  2ZH2 A;  4Q8F A;  3PW0 A;  4QZD A;  1ZQP A;  2V9W A;  4C8M A;  5KFK A;  4RUC A;  5J2J A;  1T4G A;  4RNO A;  4FHX A;  3V7L A;  5DGB A;  4FO6 A;  3RBE A;  8ICK A;  3GDX A;  3UQ2 A;  3KHG A;  4NLZ A;  4PPX A;  5HHI A;  3SYZ A;  4RQ1 A;  4P4M A;  3MR3 A;  4JV0 A;  4F4Y A;  5HC9 A;  5D49 A;  5D4B A;  4DWI A;  2PI5 A;  1ZQZ A;  5KG3 A;  4YMM A;  4PH5 A;  2M2U A;  2W9C B;  2BDP A;  2R8I A;  5J2H A;  4X4S A;  2ZH6 A;  2I9G A;  2J6T A;  5HRG A;  3BQT A;  4X4N A;  8ICX A;  1NJY A;  4J9R A;  3JPO A;  5KT2 A;  1BPB A;  5KFY A;  3H38 A;  3V72 A;  1BVS A;  2VAN A;  5KFT A;  1S0N A;  3MGH A;  1LV5 A;  4BXO A;  4IR9 A;  4AT7 A;  1SL2 A;  3H37 A;  4LZG A;  2DR7 A;  4O3P A;  4B9V A;  4Q44 A;  3PML A;  1RZT A;  2J6S A;  3V6H A;  4DL6 A;  2W9A A;  1KFT A;  1TV9 A;  4IG8 A;  4O5C A;  4X4P A;  3TQ1 A;  2V4Q A;  4QZC A;  4MEX A;  2DPI A;  1SL1 A;  4X4V A;  4DL7 A;  4KLH A;  4DSL A;  1ZQO A;  5J2E A;  4I27 A;  4P2H A;  3ZDA A;  3N97 B;  4LT6 A;  4RUA A;  4UAY A;  2V4R A;  1ZQD A;  2UVW A;  1TAQ A;  5IIO A;  4GXK A;  3M9M B;  3T5H A;  2BCR A;  4RT3 A;  1NK4 A;  4XUS A;  3Q8P B;  4J9K A;  3PX0 A;  3H39 A;  4EZ6 A;  1ZQC A;  1L5U A;  5TZV A;  4C8K A;  1A77 A;  1X9M A;  1S0O A;  2ZHB A;  1B43 A;  3OVS A;  3G6V A;  3PX6 A;  4XQ7 A;  5KTQ A;  1QTM A;  1KDH A;  4KLQ A;  4IQU A;  5III A;  3HJ1 A;  1TFR A;  2ZTC A;  4PHA A;  4Z6D A;  1F5A A;  5EOZ A;  1TKD A;  4RPY A;  1ZQM A;  4MF2 A;  2AQ4 A;  1N48 A;  1R8B A;  4MFF A;  4IQT A;  4RQ8 A;  3PW4 A;  1ZQQ A;  4C8N A;  3ZDD A;  2HHW A;  4M2Y A;  2P66 A;  2ASJ A;  3THV A;  4ED1 A;  3C21 A;  1ZQB A;  1TAU A;  1HJP A;  5KG2 A;  4BWM A;  3HX0 A;  4X0A A;  2KZ3 A;  2IMW P;  8ICA A;  3TFR A;  3PY8 A;  4X4Q A;  4S3N A;  5KFN A;  4F5O A;  3RRH A;  4RT2 A;  2BQU A;  1ZQE A;  4IR1 A;  1MSW D;  5DB8 A;  2HHX A;  9ICL A;  9ICK A;  9ICF A;  3H8W A;  4BDP A;  3MBY A;  4KLD A;  1RXW A;  3B0Y A;  3RH5 A;  5J0W A;  1NKB A;  4O9M A;  3M9N B;  5J2F A;  4ED2 A;  4F4Z A;  4DQP A;  1TFW A;  2FLN A;  4QWC A;  3L9D A;  4F2R A;  5DG8 A;  5EWF A;  3G6X A;  4YG2 A;  5KFA A;  5KFC A;  2XGQ A;  4EYH B;  3H40 A;  9ICH A;  9ICU A;  1BNP A;  4YMO A;  3JPN A;  2PBE A;  2FMQ A;  3GV5 B;  4F2S A;  4M5D A;  4KLS A;  2BKE A;  4QZF A;  3RB4 A;  3V7J A;  4IRK A;  1NZP A;  1K1Q A;  4I2D A;  3IHQ B;  7ICR A;  3HP6 A;  1DOQ A;  3LQC B;  4DL5 A;  3QZ7 A;  2PFN A;  4AT8 A;  4F93 B;  2NRT A;  1SKR A;  4RQ0 A;  1JX4 A;  2P6R A;  4WC7 A;  4I2J A;  7ICT A;  1MIV A;  3OVB A;  4BWJ A;  5J0Q A;  3NYB A;  2GWS A;  2DR5 A;  4UD4 A;  1RPL A;  1K1S A;  5J2A A;  2RDJ A;  3C2M A;  3TAP A;  9ICN A;  1DGS A;  3BQ0 A;  4ELU A;  2W9B A;  4F8R A;  2BQR A;  1LB2 B;  7ICV A;  2KFN A;  1NOM A;  1ZQV A;  4UBB A;  4ECX A;  2UVU A;  1XWL A;  4J9P A;  1ZJM A;  4WC0 A;  4I2E A;  3OHA A;  3RTV A;  4Q43 A;  3LWL A;  4J9M A;  1S10 A;  2PFQ A;  4HYK A;  3QEA Z;  1TK0 A;  5HRB A;  4X4R A;  1WCN A;  9ICV A;  3OSN A;  1KRP A;  3JYY A;  3C1Z A;  3PX4 A;  1KTQ A;  2DFL A;  5DBB A;  5J2C A;  3RAQ A;  1Z3E B;  4O3Q A;  4PHP A;  4B9S A;  4QZG A;  3K75 D;  4KIT B;  4GC6 A;  5L1K A;  4KLM A;  2FPM A;  3ZDC A;  5J0T A;  3KTQ A;  2HHU A;  1ZQG A;  5L1I A;  2JEF A;  3PO4 A;  3TAR A;  4J9S A;  4ECS A;  3TFS A;  3RB3 A;  8ICB A;  5IIK A;  1ZQN A;  2IHM A;  1Z00 A;  4YQW A;  4B9M A;  5HR9 A;  4RWQ A;  4EP7 A;  1NK8 A;  4YXM A;  5CA7 A;  1ZYQ A;  4IRD A;  7ICG A;  3ZDE A;  5BPC A;  1ZQF A;  4PHE A;  3T5J A;  4NXZ A;  2ID1 A;  4DF4 A;  4RWP A;  4E80 A;  4DOA A;  4ELV A;  1JAJ A;  4FH5 A;  4DLG A;  2R8H A;  9ICC A;  1TK8 A;  5DBC A;  2AGP A;  3NTU A;  3V7K A;  2PFP A;  5KFO A;  3ORY A;  4RZR A;  2FLL A;  3OUY B;  4IQW A;  4UB3 A;  3GQC A;  4PGY A;  1CEZ A;  2W9B B;  4DL4 A;  4MEY A;  1S97 A;  1L3T A;  5KT7 A;  5KFZ A;  2XCA A;  4FS2 A;  3RRG A;  3E2E A;  1ARO P;  7ICE A;  5HNK A;  1DK2 A;  4X4T A;  4ECW A;  3EW9 A;  5DEC A;  1ZQA A;  2LYH A;  1QSS A;  3Q8Q B;  2C28 A;  5IIJ A;  4YCX A;  1RYR A;  9ICE A;  1TFY A;  1L3V A;  4R8U A;  3SV4 A;  1U49 A;  9ICP A;  3K4G A;  1UA1 A;  4WCW A;  2H5X A;  1D9F A;  1ZQH A;  5DQG A;  8ICZ A;  8ICR A;  4DL3 A;  3V6J A;  3KHL A;  3BQ2 A;  4NM2 A;  5EWG A;  3UXN A;  4KLG A;  7ICK A;  4UB1 A;  3GIK A;  5IIM A;  2W8L A;  4QZ9 A;  1NK5 A;  8ICY A;  3WFO A;  4QWD A;  4R64 A;  4EBC A;  3BJY A;  1WOT A;  4AT9 B;  2NRV A;  2WTF A;  1ZQT A;  3PMN A;  4EBE A;  2XY6 A;  1MIY A;  4YD2 A;  4UB5 A;  5J2K A;  1TVA A;  7ICS A;  3T3F A;  2JEI A;  5KG1 A;  2R8J A;  9ICG A;  4IQV A;  7ICO A;  2ALZ A;  8ICM A;  4GXI A;  4YD1 A;  3RBD A;  3RJI A;  7ICI A;  5J0U A;  3OGU A;  8ICQ A;  5DQI A;  1N56 A;  5KFS A;  4CCH A;  4I2F A;  2ZH4 A;  1H38 A;  2KP7 A;  4ATB B;  5KG7 A;  4I2G A;  5DKW A;  4WC4 A;  4F4X A;  4XRH A;  4XQ8 A;  1U48 A;  2M2T A;  1XSN A;  4IRC A;  4YMN A;  1T3N A;  2JEG A;  5KG5 A;  3RH6 A;  1UT5 A;  1IM4 A;  5CHG A;  4NM1 A;  4X5V A;  2M9N A;  3TAQ A;  4ATB A;  2IA6 A;  5KG0 A;  2MAX A;  2HW3 A;  4I2H A;  2AJQ A;  4NY8 A;  1XC9 A;  5KFL A;  1PX5 A;  3GFK B;  2ZJ8 A;  3RJK A;  4MFC A;  2HHT A;  4QW8 A;  4NLN A;  4KLJ A;  3Q8L A;  5JUM A;  1R89 A;  3RAX A;  2XCP A;  3GIM A;  5DB6 A;  3EPI A;  9ICB A;  4PGQ A;  4F50 A;  1R8A A;  5HRF A;  4J9Q A;  4E7X A;  2ZH3 A;  3M8S A;  9ICQ A;  3MFH A;  4DSE A;  4QWA A;  1VJ7 A;  4FHP A;  4FH3 A;  3ETL A;  5KFB A;  3AQM A;  1NJW A;  8ICE A;  5L1J A;  1COO A;  4F5R A;  4GC7 A;  1D8Y A;  5BOL A;  4KLE A;  8ICS A;  2R8G A;  4KN4 A;  4RQ3 A;  1S0M A;  5HHH A;  2FPK A;  5KFD A;  1X2I A;  4C8O A;  5DG9 A;  4UB2 A;  5DG7 A;  4KN7 A;  3HT3 A;  4K4I A;  2FPL A;  4BXO B;  4AT7 B;  1S9F A;  3RR7 A;  4NLG A;  3MR2 A;  1JN3 A;  3NGD A;  4DS5 A;  1Q79 A;  3MFI A;  4TUR A;  3MGI A;  2DRB A; 
#chains in the Genus database with same CATH topology
 1ZQI A;  3UXO A;  3ZD9 A;  4UD5 A;  4WC5 A;  5AM1 A;  3SAF A;  1NK6 A;  7ICN A;  2KZM A;  4WC3 A;  2JMG A;  3HWT A;  2XID A;  4FHY A;  3MCR A;  8ICW A;  4GFJ A;  2H3F A;  2CN1 A;  1KN5 A;  4Z6C A;  2AH5 A;  4FS1 A;  2KV2 A;  1ZRM A;  3PR4 A;  5CFS A;  2C22 A;  3S6J A;  1JQR A;  3GV8 B;  2GH1 A;  4KB6 A;  3K7D A;  2XGP A;  3F53 A;  2ZIU B;  1HUO A;  4F5P A;  4KLL A;  1PK1 A;  4F92 B;  4P4O A;  5G5H A;  5KAI U;  2HHS A;  3QXG A;  3PR5 B;  4RQ5 A;  4OAG A;  2LMR A;  4I0U A;  4EBJ A;  2ESE A;  4EZ9 A;  5AM4 A;  4DFM A;  1SKS A;  1Q3V A;  1MC8 A;  4FHW A;  5KT4 A;  5G5G A;  4X0B A;  3WKA A;  4M9J A;  2HI0 A;  4B9T A;  4FBT A;  1KSP A;  2P6U A;  1PVP A;  1NKE A;  5AIC A;  2F1J A;  4QWB A;  2BCU A;  3Q8R B;  4DS4 A;  2ZIX A;  1SL0 A;  3G6Y A;  2Q66 A;  4OJP A;  2BHN A;  4EEB A;  2RHF A;  3LDA A;  1ZQ1 C;  2WFA A;  5AKX A;  2DWQ A;  1NKC A;  5KG4 A;  4PGX A;  2ZUC A;  4I2A A;  1L3S A;  2VA8 A;  3KHH A;  3NRW A;  1HIW A;  3AMZ A;  4Q8E A;  4ECR A;  1VFG A;  4ECQ A;  7ICU A;  4IL6 U;  2ZIV B;  5AKI A;  3WU2 U;  3RJJ A;  4OAI Z;  5DBA A;  4J9L A;  2ZH8 A;  1SXD A;  4I2B A;  2WF9 A;  2FMP A;  4KLO A;  2ZTE A;  5HRE A;  2WF7 A;  1ZQX A;  5L1M A;  1NK7 A;  9ICM A;  4TUQ A;  1TK5 A;  2DPJ A;  2FLP A;  4LVS A;  2G5I B;  1Z1V A;  2W8K A;  5AI4 A;  1ZD5 A;  5DLG A;  4EED A;  9ICO A;  5HRH A;  4Z6E A;  1BPD A;  2HVH A;  2ZJA A;  4Y2T A;  8ICT A;  2ASD A;  1V97 A;  1JMS A;  2IOF A;  3QNM A;  1WWU A;  2KVC A;  5HP4 A;  1JUD A;  5D62 A;  8ICV A;  2L5Y A;  3RJH A;  1N2X A;  3QE9 Y;  2KOB A;  5J2G A;  1CUK A;  9ICX A;  1X9X A;  3WK8 A;  1XNS A;  3OV7 A;  4I2C A;  1QSY A;  5KG6 A;  1SWV A;  2LI6 A;  2XY7 A;  3HPO A;  4ECV A;  1BPZ A;  5KFP A;  4DQR A;  5L1L A;  4B9N A;  4JV1 A;  3RB0 A;  3OJS A;  4O68 A;  1A0P A;  2H3Z A;  1MQ2 A;  3PVX A;  4E8F A;  4DFD A;  5DGA A;  3SD7 A;  4G3I A;  5ALD A;  4M9H A;  4KM5 A;  4WQK A;  5J0X A;  2KN7 A;  1FA0 A;  3O0F A;  2K4P A;  1S0V A;  4FFD A;  3TAC B;  1V9P A;  4QZ8 A;  2Y1J A;  3QEB Z;  3N7R C;  2BPC A;  3DDH A;  3Q8S B;  4LEV A;  1D8L A;  3IP4 B;  2AGO A;  3AU6 A;  2R8K A;  8ICN A;  3KOO A;  1C7Y A;  4EBK A;  1OU5 A;  2K8A A;  4KLT A;  1JXL A;  4C7Z A;  3QU9 A;  4JWN A;  3H0R B;  3T5L A;  3AQK A;  3H0L B;  4ECT A;  5AKZ A;  5CB1 A;  4DLE A;  5J2I A;  2J6U A;  2E5S A;  1KKX A;  1UEV A;  1RYU A;  2AGQ A;  4UAW A;  3GV7 B;  1PUZ A;  1PK1 B;  4CGZ A;  4DFP A;  3C18 A;  4Q8F A;  1ZQP A;  5KFK A;  5DGB A;  3RBE A;  2GOL A;  3LVW A;  8ICK A;  4WH5 A;  4U7C A;  1TAM A;  3MR3 A;  5D49 A;  4LEY A;  1L7N A;  1ZQZ A;  4X4S A;  3JPO A;  4NXV A;  4BXO A;  4LZG A;  4PL1 A;  4O3P A;  3PML A;  1RZT A;  1KFT A;  2CXY A;  2HBK A;  3N28 A;  1SL1 A;  2DPI A;  4I27 A;  4P2H A;  4LT6 A;  4RUA A;  2ZIX B;  3MGV A;  3T5H A;  4RT3 A;  1WYG A;  1ZD3 A;  4MKP A;  1A77 A;  4Y2V A;  5B5E U;  3OVS A;  3G6V A;  5KTQ A;  4IQU A;  4PHA A;  1N62 A;  1F5A A;  4RPY A;  1R8B A;  2MA1 A;  4IQT A;  3ZDD A;  1WWV A;  2ASJ A;  3C21 A;  1TAU A;  2HN1 A;  4BWM A;  1F44 A;  2IMW P;  5D61 A;  1J2M A;  3UMC A;  4RT2 A;  1MSW D;  3AEV A;  4NLB A;  2E1F A;  3N7P D;  4O9M A;  5J0W A;  2KIC A;  1OXJ A;  4DQP A;  2FLN A;  3E58 A;  3G6X A;  2EDU A;  4EYH B;  9ICU A;  2DGZ A;  3V7J A;  7ICR A;  4RWO A;  2NRT A;  4FO1 A;  1JX4 A;  4I2J A;  3HJE A;  3NYB A;  2GWS A;  1RPL A;  3C2M A;  3TAP A;  2YY6 A;  2W9B A;  4F8R A;  1LB2 B;  1S5L U;  7ICV A;  2KFN A;  4RQM A;  1ZJM A;  4WC0 A;  4C4R A;  1PK3 A;  3QX7 A;  5H2F U;  4X4R A;  9ICV A;  3OSN A;  5GTH U;  4B6J A;  1Z3E B;  2JRZ A;  4GC6 A;  5L1K A;  3ZDC A;  5J0T A;  3KTQ A;  1ZQG A;  4WOY A;  4NWI A;  3TAR A;  4XJE A;  4B9M A;  1JAJ A;  1X66 A;  1SB3 C;  5DBC A;  5AK4 A;  2PFP A;  1L7P A;  3GQC A;  4PGY A;  2LHT A;  3PST A;  1YZ6 A;  4J03 A;  5KT7 A;  2XCA A;  3RRG A;  3E2E A;  5HNK A;  4ECW A;  3EW9 A;  5DEC A;  2K8B B;  3I76 A;  2HSZ A;  3Q8Q B;  4K99 A;  9ICE A;  4R8U A;  3SV4 A;  5AKE A;  3A0H U;  5ALG A;  1UCV A;  2R18 A;  7ICK A;  3KHL A;  4NM2 A;  1NZB A;  3GIK A;  4QZ9 A;  4OAF A;  2LBO A;  4R64 A;  2NRV A;  1ZQT A;  5AKJ A;  3PMN A;  4UW9 A;  2ZG6 A;  2JEI A;  4GXI A;  1F0M A;  4NXU A;  4YD1 A;  3RJI A;  8ICQ A;  5AI6 A;  1N56 A;  5KG7 A;  2M2T A;  4XRH A;  1XSN A;  5KNI A;  5CRX A;  5ALV A;  2DKZ A;  2JV3 A;  5CHG A;  4NM1 A;  4USA A;  3TAQ A;  3QU2 A;  5KG0 A;  4I2H A;  2AJQ A;  3GFK B;  3ZI4 A;  2ZJ8 A;  2E8P A;  3VCB A;  3ONN A;  4OO1 J;  3EPI A;  1R8A A;  4E7X A;  2ZH3 A;  5EE3 A;  3PSF A;  2EQY A;  5KL8 B;  1L7O A;  3SAG A;  8ICE A;  2LM1 A;  3D6J A;  4KLE A;  1D8Y A;  2R8G A;  5AI9 A;  1S0M A;  2QKQ A;  4C8O A;  4UB2 A;  4K4I A;  2WHE A;  1L7M A;  4BXO B;  4NLG A;  4CF5 A;  3JYY A;  2WF6 A;  3NAS A;  3C2L A;  1VJ5 A;  1ZQJ A;  2RRD A;  1SV4 A;  2F1I A;  1URJ A;  2W04 A;  4KLU A;  3RH4 A;  1ED1 A;  4Y2Q A;  1JRP A;  1JI7 A;  5AKL A;  1S77 D;  5EE0 A;  3M8R A;  3HW8 A;  4UAV A;  4U6P A;  5J2B A;  4K8V A;  5DB7 A;  1FIQ A;  3MDC A;  3KZX A;  5HRK A;  3M1Y A;  2RDI A;  4TUP A;  2HBJ A;  5ALP A;  9ICT A;  1UHU A;  3MAB A;  3SZ2 A;  5IIL A;  4X4O A;  1BPE A;  2ISO A;  5ALY A;  3IN5 A;  5KFJ A;  3H3A A;  3M9O B;  1NJX A;  3OWG A;  2DBY A;  3F2B A;  1U45 A;  5KFG A;  4CE6 A;  4RNM A;  4M9N A;  3JPR A;  5KFE A;  4TUS A;  5AKY A;  4RPZ A;  2VA3 A;  3CYM A;  4TQR A;  1ZJN A;  1MQ3 A;  3ISC A;  5AIB A;  3JPS A;  4K98 A;  4YN4 A;  3BZK A;  4B9U A;  2AQ0 A;  5ALL A;  4JB3 A;  3T5K A;  3F5E A;  5ALN A;  1OUQ A;  1BPY A;  2WB1 F;  3PSP A;  1X6I A;  3J81 j;  1DK3 A;  4Y2J A;  4R65 A;  2DRA A;  1NI3 A;  3GZF A;  3NVY A;  3ERC C;  4EEY A;  2Q0Z X;  3AQN A;  5AK5 A;  4RQ6 A;  3H4B A;  4F5Q A;  4P0P A;  2ZUB A;  3BS7 A;  2JH7 A;  2W43 A;  1BNO A;  2K4E A;  5J2D A;  4GLX A;  1S76 D;  4F5N A;  1X9W A;  4O3M A;  5CP2 A;  2OYY A;  2G0A A;  1SKW A;  4K9A A;  2NRX A;  2C2D A;  1N63 A;  3IM1 A;  3L3F X;  4O0I A;  8ICH A;  3EPG A;  9ICJ A;  3ER9 B;  2F3N A;  1SZH A;  3Q8M A;  1N5W A;  3AU2 A;  5DDM A;  4M04 A;  3UQ0 A;  2GAF D;  3DV9 A;  4R8U B;  4QZE A;  2WB1 C;  5J0R A;  2H3I A;  3C23 A;  5KFV A;  4JWM A;  4F4K A;  1KNY A;  5BOM A;  2ZUD A;  3NRZ A;  5JRT A;  3H8J A;  8ICJ A;  4P4P A;  1ZQU A;  4EGW A;  2YQE A;  2YB1 A;  3FYH A;  3C66 A;  3L5K A;  1QH9 A;  3C2K A;  2EZX A;  1L3U A;  2EWR A;  1JXE A;  3FC4 A;  4MF8 A;  2ES6 A;  4QZH A;  2DR8 A;  3WKC A;  3SV3 A;  2FCL A;  2DUY A;  2AHO B;  3JPP A;  4JV2 A;  2BZF A;  2O1P A;  2B21 A;  2EAM A;  2NRW A;  2KMD A;  2IBK A;  7ICF A;  4LJX A;  4K9B A;  2FJ6 A;  3NKU A;  1UEU A;  5AKH A;  3OHB A;  1KBU A;  3D2Q A;  4DSK A;  3ICX A;  3C5G A;  3UXP A;  1ZQW A;  1XU4 A;  4K4G A;  1D8B A;  2KVS A;  3CK6 A;  3QZ8 A;  4NXX A;  3HIY A;  1JIH A;  1UET A;  4Y2P A;  3K1Z A;  3OUY A;  2NRZ A;  1N61 A;  5DB9 A;  3H4D A;  4E0D A;  1L8L A;  8ICO A;  3EWA A;  5ALU A;  1CRX A;  5EE9 A;  4K97 A;  1XS9 D;  4TQS A;  5AKG A;  2ISP A;  1KFS A;  1C20 A;  5IIN A;  2HHQ A;  4DOB A;  5GTI U;  3RJE A;  5TIS U;  3EYZ A;  3OJU A;  1GPJ A;  4O3N A;  1WCL A;  4K4H A;  2VKQ A;  5ALS A;  3OSP A;  4AT9 A;  1Y88 A;  5CJ7 A;  2UVR A;  3WKD A;  5L9X A;  3CW2 C;  3QYP A;  2NYV A;  4I29 A;  5J0Y A;  4R63 A;  1QSL A;  3RJF A;  4CNQ A;  2G06 A;  2B4V A;  4KLI A;  4FHV A;  4NKU A;  2KZZ A;  4DO9 A;  8ICX A;  5AHX A;  5F9L A;  1UA0 A;  4PZN A;  5AIA A;  5F3X B;  3BQ1 A;  2KTQ A;  3PW0 A;  4PL2 A;  3ETR A;  1T4G A;  2RLT A;  4FHX A;  3M6Z A;  4FZM A;  4A8E A;  4P4M A;  5HC9 A;  4DWI A;  4F71 A;  2M2U A;  2R8I A;  4KX3 A;  5J2H A;  2I9G A;  1B4F A;  4X4N A;  5KT2 A;  4IR9 A;  1SL2 A;  3AL0 B;  2EAP A;  4Q44 A;  5ALK A;  4DL6 A;  4X4P A;  1SGG A;  4KLH A;  3NVZ A;  4UAY A;  1TAQ A;  4UB8 U;  4GXK A;  1NK4 A;  4XUS A;  4P0P B;  3H39 A;  4EZ6 A;  1X9M A;  1ECW A;  3C28 A;  1TFR A;  1B0X A;  5JU5 A;  1N48 A;  1QCK A;  3UMB A;  3PW4 A;  2KKV A;  4M2Y A;  1ZQB A;  1HJP A;  5KG2 A;  3RRH A;  1ZQE A;  5DB8 A;  1JRO A;  2HHX A;  9ICL A;  9ICK A;  4C4T A;  4KLD A;  1RXW A;  3TKA A;  2B6G A;  4P0Q A;  4F2R A;  5KFA A;  3JPN A;  3SAH A;  2BKE A;  1NZP A;  4DCC A;  4IRK A;  1K1Q A;  3E0F A;  3IHQ B;  3LQC B;  4AT8 A;  4DL5 A;  2PFN A;  2P6R A;  1MIV A;  3OVB A;  4BWJ A;  5J0Q A;  1CI4 A;  4UD4 A;  9ICN A;  2YMQ A;  3KFU F;  3KBB A;  1XWL A;  4EEL A;  2PKE A;  1MN8 A;  3FM9 A;  2CRX A;  3RTV A;  4Q43 A;  3LWL A;  2PFQ A;  5HRB A;  5ALO A;  2PMZ F;  5J2C A;  4PHP A;  1WG8 A;  3K75 D;  2WAQ F;  3CRX A;  3KKA A;  3PO4 A;  1DGJ A;  3RB3 A;  5IIK A;  3QUT A;  1ZQN A;  2IHM A;  4YQW A;  2Q4T A;  5AI0 A;  4RWQ A;  2JGA A;  4EV6 A;  1NK8 A;  4YXM A;  1ZQF A;  2ZIW A;  4DF4 A;  1UQV A;  9ICC A;  4OJ5 A;  1N60 A;  2E1E A;  2AGP A;  1ZRN A;  3V7K A;  2LYA A;  3NVV A;  4QIW F;  3OUY B;  4FE3 A;  2FLL A;  4IQW A;  4BUG A;  4DL4 A;  2W54 A;  2W3S A;  7ICE A;  1DK2 A;  1AQ6 A;  2LYH A;  1J2N A;  4YCX A;  2YMP A;  5AK3 A;  3K4G A;  1UA1 A;  4WCW A;  1D9F A;  5DQG A;  3BQ2 A;  1XO0 A;  3LYS A;  2W8L A;  2PMZ C;  8ICY A;  3OTQ A;  1SWW A;  2YTU A;  3BJY A;  1WOT A;  4AT9 B;  2WAQ C;  2XY6 A;  2YML A;  4UB5 A;  5J2K A;  4UAT A;  7ICS A;  2P35 A;  7ICO A;  7ICI A;  1V38 A;  3KKA C;  3OGU A;  2KP7 A;  1LVH A;  5DKW A;  4WC4 A;  4F4X A;  4XQ8 A;  4IC9 A;  3R9K A;  5KG5 A;  3RH6 A;  1UT5 A;  1IM4 A;  3BQ7 A;  1KW4 A;  3F2D A;  3CNH A;  3ED5 A;  2MAX A;  2HW3 A;  1XC9 A;  4QIW C;  4MFC A;  2HHT A;  1R89 A;  3RAX A;  2XCP A;  3RF9 A;  9ICB A;  4PGQ A;  4F50 A;  3M8S A;  4C7Y A;  2N1R A;  4DSE A;  3ETL A;  1Z19 A;  5K4L A;  5L1J A;  1SIJ A;  2KJ9 A;  4GC7 A;  8ICS A;  4KN4 A;  5KFD A;  2FPK A;  2FPL A;  4UAR A;  3SEI A;  3MR2 A;  3NGD A;  3MFI A;  1Q78 A;  3DEE A;  4DOC A;  2AXT U;  2ZXH A;  3WK7 A;  3QU4 A;  2F1H A;  5ALR A;  2Y0S C;  1ZD4 A;  3PSI A;  1O08 A;  3AQE A;  4WBZ A;  1MIW A;  5KFH A;  4EX6 A;  5J8Y A;  2ZH5 A;  4QZB A;  2G07 A;  2E3T A;  2BPF A;  3PW2 A;  4M6W A;  1KL9 A;  2BPG A;  2DQN B;  2DKX A;  2I1Q A;  5KT3 A;  5E79 U;  2NRK A;  4O3S A;  4ED6 A;  8ICF A;  8ICI A;  3IG8 A;  8ICU A;  2FMS A;  3CP8 A;  5D46 A;  4F3O A;  5AM5 A;  3AQF A;  1XSP A;  4P0Q B;  5J29 A;  3UPQ A;  2W11 A;  2ATL A;  2LM4 A;  2FDR A;  4NLK A;  4LZD A;  1QLN A;  4EBD A;  2DVI A;  4AT8 B;  2F8L A;  3RR8 A;  3ISD A;  2K4I A;  2MSN A;  2XC9 A;  4M0A A;  4M9G A;  1HUZ A;  2HVI A;  4GXJ A;  5DDY A;  2EAO A;  2XY5 A;  4KMO B;  2OH2 A;  5KFX A;  3D2N A;  5J8Y C;  5CR0 A;  2BCV A;  3H0M B;  5F2V O;  2PI4 A;  1RDF A;  3NVO A;  4YP3 A;  3I28 A;  4I28 A;  3WFS C;  5J0S A;  2W55 A;  1OW5 A;  5F9N A;  3SEN A;  4YR3 A;  3RFA A;  3C5F A;  3RB6 A;  2ZIW B;  2G5H B;  5KFR A;  3PHZ A;  5ALJ A;  3OPX A;  4Y2X A;  9ICS A;  8ICL A;  2OWO A;  3JPT A;  4O3O A;  4F4W A;  4PHD A;  2MRL A;  4EEN A;  4YR2 A;  3IRU A;  4JK1 A;  3JPQ A;  4JMU A;  4R66 A;  5J0P A;  2Y9T A;  2BBH A;  2C2E A;  5DQH A;  2JXJ A;  4QZI A;  3HKZ C;  2HHV A;  2AU0 A;  4NV0 A;  1T8E A;  2KSO A;  4YFK A;  1ZET A;  1BPX A;  1M6Y A;  2BDU A;  3F5A A;  4EX7 A;  4O5E A;  4DF8 A;  3ZDB A;  3PW7 A;  3WFP A;  3UPS A;  2JR5 A;  2ZH9 A;  4J9O A;  2D3D A;  2ZTD A;  4B9L A;  3PNC A;  4C8L A;  4BX9 C;  2BGW A;  2NO5 A;  2CPR A;  2C2R A;  4X4U A;  4NL9 A;  3U26 A;  9ICA A;  2XO7 A;  1X6J A;  2WF5 A;  2KE7 A;  2HN2 A;  1IIP A;  4ZH4 A;  3WFQ E;  2EZZ A;  2YX8 A;  2KHV A;  4OCZ A;  4OJ6 A;  4CF3 A;  1RQL A;  4FBU A;  4JLX A;  4UB4 A;  4LEZ A;  1U9L A;  1HEK A;  3PO5 A;  2HOI A;  4QWE A;  5KL1 B;  2PXI A;  5KFM A;  1J97 A;  5ALZ A;  1X9S A;  1YLQ A;  2KFZ A;  3LWM A;  3WKB A;  3JZ0 A;  4DSI A;  2A3V A;  2E8M A;  3SR6 A;  1XO1 A;  3AUO A;  3I1Y A;  2K89 A;  3QUQ A;  3M7D A;  5HMM A;  3HIL A;  1FFV A;  9ICW A;  2OEH A;  3WKE A;  1EXN A;  3M6K A;  3WK6 A;  1ZQS A;  7ICM A;  4NL9 C;  4DQS A;  4M6W B;  3TAD A;  4RNN A;  5KFW A;  3C1Y A;  5HR7 A;  4ED3 A;  4ATB A;  2KEY A;  4NJ8 A;  1U47 A;  1SZP A;  3BS5 A;  5KFF A;  9ICI A;  7ICL A;  1ZD2 P;  3GIJ A;  4YR0 A;  1XSL A;  2MU2 A;  8ICP A;  7ICH A;  4WC2 A;  2M2V A;  2ZH2 A;  4C8M A;  4RUC A;  5J2J A;  1N5X A;  3V7L A;  4FO6 A;  3NVW A;  2JHD A;  3GDX A;  3UQ2 A;  4NLZ A;  2KJ5 A;  4RQ1 A;  4F4Y A;  4JV0 A;  1ZOL A;  4YMM A;  4PH5 A;  2BDP A;  2HOF A;  2J6T A;  4WJ3 B;  1NJY A;  1BVS A;  1S0N A;  5KFT A;  4AT7 A;  3MGH A;  4ICA A;  4B9V A;  4IG8 A;  2NO4 A;  2W9A A;  2KHQ A;  4O5C A;  3TQ1 A;  2V4Q A;  4DL7 A;  4RQN A;  4DSL A;  5J2E A;  2EH9 A;  3H8M A;  3N97 B;  3NS1 A;  2UVW A;  2LKY A;  3AM9 A;  2F77 X;  2IOH A;  2Z7J A;  4J9K A;  1L5U A;  2F2A B;  2QLT A;  3TAD C;  1S0O A;  4FZN A;  3HJ1 A;  5III A;  2ZTC A;  5EOZ A;  1ZQM A;  2AQ4 A;  1T3Q A;  1KQQ A;  4Y2U A;  4C8N A;  1FFU A;  3THV A;  1VDV A;  3ALR A;  3HX0 A;  5AM0 A;  1Q3U A;  8ICA A;  4ACO A;  3TFR A;  2Y9U A;  3PY8 A;  2O6K A;  4F5O A;  4PZO A;  2I5H A;  3D2S A;  3H8W A;  1NKB A;  3M9N B;  4ED2 A;  2EAN A;  4F4Z A;  2HBL A;  4QWC A;  1GO3 F;  5CHE A;  3K1R B;  5EWF A;  4YG2 A;  3H40 A;  4YMO A;  2FMQ A;  3GV5 B;  3QUC A;  2KSO B;  4QZF A;  3OVA A;  3HP6 A;  1DOQ A;  1Z1B A;  2W7O A;  4F93 B;  1SKR A;  4F72 A;  7ICT A;  2E8N A;  5J2A A;  4AYB F;  2QB0 A;  1DGS A;  3BQ0 A;  2BQR A;  2YMM A;  4ECX A;  1SV0 A;  5ALH A;  5ALQ A;  4I2E A;  4BJQ A;  4J9M A;  1S10 A;  4HYK A;  3QEA Z;  1Z4O A;  2RP5 A;  1KRP A;  1S8O A;  3C1Z A;  2QAR A;  2DFL A;  4UAU A;  2I6X A;  4O3Q A;  4AP9 A;  2W7P A;  4B9S A;  4QZG A;  4KLM A;  2FPM A;  2IHO A;  2HHU A;  2JEF A;  4ECS A;  3TFS A;  8ICB A;  1Z00 A;  5HR9 A;  1K5O A;  5CA7 A;  7ICG A;  3ZDE A;  5BPC A;  4PHE A;  4NXZ A;  3PZP A;  4DOA A;  4ELV A;  4CRX A;  4FH5 A;  2R8H A;  4C0Z A;  3LVV A;  1TK8 A;  4LEW A;  5KFO A;  3ORY A;  4UB3 A;  4Y2S A;  1S97 A;  1L3T A;  1ARO P;  4OAH A;  4AYB C;  2B0C A;  2C28 A;  5IIJ A;  1RYR A;  1U49 A;  5AI5 A;  8ICZ A;  8ICR A;  3QU7 A;  5EWG A;  4KLG A;  4UB1 A;  5IIM A;  1NK5 A;  3WFO A;  1SV0 C;  2K4H A;  4EBC A;  4FZL A;  5FP0 A;  2G09 A;  4YD2 A;  3L4P A;  5KG1 A;  1VLB A;  9ICG A;  4IQV A;  1A6S A;  2ALZ A;  2IUB A;  5J0U A;  2ZH4 A;  4ATB B;  4I2G A;  3BS5 B;  1U48 A;  4IRC A;  4YMN A;  4X5V A;  2M9N A;  2IA6 A;  5B66 U;  5ALI A;  1PX5 A;  5KFL A;  3RJK A;  4QW8 A;  4KLJ A;  3Q8L A;  5JUM A;  4N7R A;  4OD0 A;  2A1A A;  5HRF A;  9ICQ A;  3MFH A;  5KFB A;  3AN1 A;  1ZXI A;  1COO A;  3C29 A;  2VIX A;  4RQ3 A;  4OJL A;  5HHH A;  3VC8 A;  5HR6 A;  3NWI A;  5DG9 A;  4KN7 A;  3HT3 A;  4AT7 B;  2RQ5 A;  1JN3 A;  2BBJ A;  2UVV A;  3MGI A;  2GLE A;  4US8 A;  1DXS A;  5ALM A;  4UBC A;  7ICP A;  5CEH A;  5T14 A;  4PJ0 U;  4KMU A;  3IG5 A;  2BE3 A;  2LPE A;  2MUT A;  4WBY A;  1PZN A;  3EF2 A;  1Q8K A;  5KT5 A;  4ED0 A;  2VA2 A;  1YT3 A;  2DR9 A;  2ZJ5 A;  3PV8 A;  2GO7 A;  3V6K A;  2ZHA A;  2JZB A;  2VJ4 A;  2HBM A;  2M2W A;  3F2C A;  4RQ2 A;  1FO4 A;  3GII A;  5EWE A;  2BCS A;  1NNL A;  5B3P A;  2A1J A;  4MHV A;  5CWR A;  1D9D A;  1NK0 A;  5AK6 A;  5HRD A;  2W9M A;  3JCF A;  4ED8 A;  2F8K A;  1V85 A;  1ZQY A;  3Q8K A;  1R8C A;  4OJO A;  4O6A A;  4F91 B;  4NKT A;  5DED A;  1RG6 A;  3LK9 A;  3AQL A;  2H3V A;  5KFQ A;  4KTQ A;  4DQQ A;  2KKP A;  4RU9 A;  4ECY A;  4HAI A;  4YXJ A;  2W9C A;  3H8S A;  9ICR A;  1LKY A;  1X40 A;  3SI8 A;  2HHP A;  4O3R A;  5AM3 A;  2QB0 B;  2HMX A;  1U4B A;  2XIC A;  4ECZ A;  7ICJ A;  3MR5 A;  3B0X A;  2O5A A;  3PW5 A;  4XA5 A;  5KFI A;  2QAR B;  3WK4 A;  1RXV A;  4EYI B;  5HML A;  2YB4 A;  4ZOH C;  5KT6 A;  5ALW A;  3EZ5 A;  2ODG A;  1Z00 B;  1KLN A;  2ZH7 A;  2Y0S F;  2PFO A;  8ICG A;  4WC1 A;  5CFU A;  2QB1 A;  5C5J A;  4M9L A;  4Z6F A;  1RYS A;  4G9B A;  5J0O A;  3WK5 A;  3UMG A;  4DSF A;  1T7P A;  2B56 A;  2K8C B;  3QUB A;  4CDG A;  1NK9 A;  2IOF K;  2ZH1 A;  5HRI A;  3TI0 A;  2DF4 B;  2JEJ A;  1JAL A;  5B3Q A;  4DQI A;  2KIW A;  1BGX T;  1PVR A;  1V4A A;  1T94 A;  4MFA A;  2RFF A;  5ALT A;  3KHR A;  3IV6 A;  4RQ4 A;  1F5S A;  1MA7 A;  3N4M B;  4QW9 A;  1NJZ A;  3SQI A;  3GIL A;  4ECU A;  1ZQL A;  5HRL A;  1A76 A;  3ZD8 A;  4DFK A;  4I2I A;  1KFD A;  2BCQ A;  4GIB A;  1QQ7 A;  4BGD A;  4IS7 A;  1ZQR A;  2BQ3 A;  3MDA A;  2OM6 A;  3TAN A;  4RWN A;  4QJF B;  2KIV A;  2IHN A;  1IXR A;  3WK9 A;  2DL0 A;  5KFU A;  3RJG A;  4DSJ A;  4ELT A;  2ASL A;  4KLF A;  1QQ6 A;  4RPX A;  2BR0 A;  5D63 A;  4JUZ A;  2KK0 A;  4Q45 A;  3MR6 A;  3WFR E;  4DEZ A;  3FAH A;  3HJ4 A;  2F76 X;  5ALE A;  4WC6 A;  4M47 A;  4RQ7 A;  4O5K A;  2XVT A;  1B22 A;  7ICQ A;  4QZA A;  2MUT B;  4DFJ A;  4K96 A;  3KZI U;  4Y2Y A;  1UT8 A;  2JZB B;  3BDP A;  3ISB A;  4J9N A;  3FDS A;  3HKZ F;  3H7I A;  4YVZ A;  1ZQK A;  4UB6 U;  1NO5 A;  4JLZ A;  2HOQ A;  5AM2 A;  2FE9 A;  2A1J B;  4NXT A;  4ED7 A;  4DL2 A;  5DLF A;  1PVQ A;  4UQG A;  2K60 A;  1Q46 A;  1L8O A;  4UAZ A;  1KEJ A;  2Y1I A;  4Y2R A;  4QZD A;  1IV8 A;  2V9W A;  4RNO A;  3SMV A;  3KHG A;  3T79 A;  2HCF A;  4PPX A;  3SYZ A;  5HHI A;  1X42 A;  1UPH A;  3HRD D;  5D4B A;  2D8C A;  2PI5 A;  5KG3 A;  2W9C B;  1LKY B;  2ZH6 A;  2HDO A;  5KAF U;  4WQL A;  5HRG A;  3BQT A;  1IG6 A;  2G08 A;  4J9R A;  1BPB A;  5KFY A;  3H38 A;  3V72 A;  2VAN A;  1LV5 A;  2DR7 A;  2OXO A;  3H37 A;  2W03 A;  2OHF A;  2J6S A;  3V6H A;  1TV9 A;  4MEX A;  4QZC A;  4X4V A;  1ZQO A;  4KX5 A;  3ZDA A;  2V4R A;  1ZQD A;  5IIO A;  3M9M B;  2BCR A;  2A19 A;  3Q8P B;  3PX0 A;  1ZQC A;  1FEZ A;  5TZV A;  4C8K A;  2H3Q A;  2ZHB A;  1B43 A;  4XQ7 A;  3PX6 A;  1QTM A;  4KLQ A;  1KDH A;  2F44 A;  4Z6D A;  4O67 A;  1DRG A;  1TKD A;  4MF2 A;  4MFF A;  2B51 A;  4RQ8 A;  1ZQQ A;  2HHW A;  2P66 A;  3QU5 A;  4C4S A;  4ED1 A;  3MC1 A;  4X0A A;  2KZ3 A;  4X4Q A;  4S3N A;  5KFN A;  2ZIU A;  2BQU A;  4IR1 A;  4HX0 A;  1Z4N A;  1SXE A;  9ICF A;  2W3R A;  4BDP A;  2JH1 A;  3MBY A;  3B0Y A;  3RH5 A;  5J2F A;  2YN4 A;  5AI8 A;  1TFW A;  3L9D A;  1RQN A;  5DG8 A;  1COK A;  9ICH A;  2XGQ A;  1L6N A;  5KFC A;  2ZXI A;  1BNP A;  2PBE A;  4M5D A;  2M0N A;  4QNL A;  4F2S A;  4KLS A;  3RB4 A;  3GU3 A;  2KJ8 A;  4I2D A;  3QZ7 A;  4WC7 A;  1O03 A;  4RQ0 A;  1YZ7 A;  2DR5 A;  2RDJ A;  1K1S A;  4ELU A;  1NOM A;  1ZQV A;  4UBB A;  2UVU A;  4J9P A;  3UM9 A;  3OHA A;  5A0L A;  1TK0 A;  1WCN A;  3PX4 A;  1KTQ A;  5DBB A;  3RAQ A;  5ALF A;  4KIT B;  2E8O A;  5L1I A;  4J9S A;  2WF8 A;  2KNJ A;  2LYB A;  4EP7 A;  1ZYQ A;  4IRD A;  2NV3 A;  3T5J A;  2ID1 A;  4RWP A;  4E80 A;  4DLG A;  2ZIV A;  3BZC A;  2D6F C;  3NTU A;  2FI1 A;  4RZR A;  1CEZ A;  2W9B B;  4MEY A;  3A0B U;  5KFZ A;  4FS2 A;  4X4T A;  2KD1 A;  4US9 A;  1ZQA A;  2GA9 D;  1QSS A;  1TFY A;  1L3V A;  3EUB 2;  3B9J A;  9ICP A;  2H5X A;  1ZQH A;  4DL3 A;  3V6J A;  8ICC A;  3UXN A;  4EEK A;  5CFT A;  3ER8 C;  4QWD A;  2WTF A;  3NUQ A;  4EBE A;  1MIY A;  4NLC A;  1TVA A;  3T3F A;  2KG5 A;  2R8J A;  8ICM A;  4O69 A;  3RBD A;  3KD3 A;  5DQI A;  5KFS A;  4CCH A;  4I2F A;  4C80 A;  1H38 A;  5EE1 A;  5C0Y A;  2EZY A;  1WUD A;  1T3N A;  2JEG A;  4UAS A;  4CF4 A;  5ALX A;  4NY8 A;  1QQ5 A;  2OCE A;  5AKK A;  4NLN A;  3N7S C;  2VJ5 A;  3GIM A;  5DB6 A;  5JTI A;  4J9Q A;  1TE2 A;  4QWA A;  1VJ7 A;  4FHP A;  4FH3 A;  1RM6 C;  3AQM A;  1NJW A;  4NXW A;  4F5R A;  5BOL A;  1P7D A;  1X2I A;  5DG7 A;  2XI9 A;  1S9F A;  3RR7 A;  5JTG A;  4DS5 A;  3IDW A;  1Q79 A;  4TUR A;  2DRB A; 
#chains in the Genus database with same CATH homology
 1Q78 A;  1ZQI A;  3UXO A;  3ZD9 A;  4UD5 A;  4WC5 A;  3C2L A;  1NK6 A;  4DOC A;  7ICN A;  1ZQJ A;  2F1I A;  4UBC A;  2KZM A;  7ICP A;  4WC3 A;  3HWT A;  2F1H A;  4KMU A;  4FHY A;  4KLU A;  3RH4 A;  8ICW A;  2BE3 A;  4WBY A;  2MUT A;  1PZN A;  5KT5 A;  4ED0 A;  2VA2 A;  4Z6C A;  2DR9 A;  2ZJ5 A;  3PV8 A;  3V6K A;  1MIW A;  4WBZ A;  1S77 D;  2ZHA A;  2JZB A;  5KFH A;  3M8R A;  2M2W A;  3HW8 A;  4FS1 A;  5J2B A;  4RQ2 A;  5DB7 A;  2ZH5 A;  4QZB A;  3PR4 A;  2C22 A;  3GII A;  5EWE A;  3MDC A;  2BPF A;  3PW2 A;  2BCS A;  5HRK A;  4M6W A;  1JQR A;  2RDI A;  4TUP A;  3GV8 B;  2BPG A;  2A1J A;  2I1Q A;  5KT3 A;  5CWR A;  1D9D A;  2NRK A;  9ICT A;  1NK0 A;  4O3S A;  3MAB A;  4ED6 A;  3SZ2 A;  5IIL A;  2XGP A;  8ICF A;  1BPE A;  8ICI A;  5HRD A;  4X4O A;  2W9M A;  1HUO A;  4F5P A;  4ED8 A;  2ISO A;  4KLL A;  8ICU A;  5KFJ A;  3H3A A;  3M9O B;  1NJX A;  2FMS A;  4F92 B;  5D46 A;  4F3O A;  1ZQY A;  3Q8K A;  1R8C A;  4P4O A;  4F91 B;  2HHS A;  1U45 A;  4NKT A;  1XSP A;  3PR5 B;  5DED A;  5KFG A;  4RQ5 A;  5J29 A;  4RNM A;  3LK9 A;  3UPQ A;  5KFQ A;  4M9N A;  3AQL A;  4KTQ A;  3JPR A;  5KFE A;  4TUS A;  2ATL A;  4EBJ A;  4DQQ A;  4RPZ A;  4NLK A;  4RU9 A;  4ECY A;  2VA3 A;  4EZ9 A;  4TQR A;  4DFM A;  1ZJN A;  4LZD A;  1SKS A;  4EBD A;  4YXJ A;  1QLN A;  4AT8 B;  2DVI A;  2W9C A;  3H8S A;  3RR8 A;  1MQ3 A;  3ISD A;  3ISC A;  2XC9 A;  3JPS A;  4M0A A;  1MC8 A;  9ICR A;  3SI8 A;  4YN4 A;  4M9G A;  2HHP A;  4O3R A;  4B9U A;  4FHW A;  1HUZ A;  5KT4 A;  2HVI A;  4X0B A;  2AQ0 A;  4GXJ A;  4M9J A;  5DDY A;  3T5K A;  4B9T A;  4FBT A;  1KSP A;  1U4B A;  2P6U A;  2XY5 A;  4ECZ A;  7ICJ A;  1NKE A;  1BPY A;  3MR5 A;  3B0X A;  1DK3 A;  5KFX A;  2O5A A;  4R65 A;  3PW5 A;  2DRA A;  2F1J A;  4QWB A;  4XA5 A;  2BCU A;  5KFI A;  3Q8R B;  4DS4 A;  4EEY A;  2Q0Z X;  1SL0 A;  3G6Y A;  1RXV A;  3AQN A;  5CR0 A;  4EYI B;  5HML A;  2Q66 A;  2BCV A;  5F2V O;  2BHN A;  4RQ6 A;  3H4B A;  4F5Q A;  2ZUB A;  3LDA A;  2PI4 A;  4YP3 A;  4I28 A;  5KT6 A;  3WFS C;  5J0S A;  3EZ5 A;  1BNO A;  1NKC A;  1Z00 B;  5F9N A;  5J2D A;  4GLX A;  1S76 D;  5KG4 A;  4PGX A;  2ZUC A;  4F5N A;  4I2A A;  1L3S A;  1X9W A;  2VA8 A;  4YR3 A;  1KLN A;  3KHH A;  5CP2 A;  2ZH7 A;  4Q8E A;  3C5F A;  2PFO A;  3RB6 A;  8ICG A;  4WC1 A;  4ECR A;  5C5J A;  1SKW A;  5KFR A;  4ECQ A;  7ICU A;  1VFG A;  4M9L A;  2NRX A;  2C2D A;  9ICS A;  8ICL A;  2OWO A;  3IM1 A;  4Z6F A;  4O3O A;  4O0I A;  3JPT A;  4F4W A;  5DBA A;  3EPG A;  4PHD A;  1RYS A;  3RJJ A;  5J0O A;  4J9L A;  9ICJ A;  4YR2 A;  4DSF A;  1T7P A;  2ZH8 A;  4JK1 A;  3Q8M A;  3JPQ A;  4I2B A;  3AU2 A;  2FMP A;  4R66 A;  2ZTE A;  5J0P A;  4KLO A;  2C2E A;  5DQH A;  1NK9 A;  5HRE A;  5DDM A;  1ZQX A;  2ZH1 A;  4QZI A;  1NK7 A;  9ICM A;  5HRI A;  4TUQ A;  3TI0 A;  2JEJ A;  2HHV A;  1TK5 A;  2AU0 A;  2DPJ A;  4DQI A;  1T8E A;  3UQ0 A;  4M04 A;  4R8U B;  2FLP A;  4LVS A;  4QZE A;  1BGX T;  1V4A A;  5J0R A;  2W8K A;  4MFA A;  4YFK A;  1ZET A;  3C23 A;  3KHR A;  2RFF A;  5KFV A;  5DLG A;  4JWM A;  1BPX A;  4F4K A;  4RQ4 A;  1KNY A;  9ICO A;  5HRH A;  4Z6E A;  5BOM A;  1BPD A;  2ZUD A;  4O5E A;  2HVH A;  2ZJA A;  3H8J A;  3N4M B;  8ICT A;  2ASD A;  8ICJ A;  4DF8 A;  3ZDB A;  4P4P A;  1JMS A;  1ZQU A;  3PW7 A;  3WFP A;  3UPS A;  4QW9 A;  2ZH9 A;  1NJZ A;  5HP4 A;  3FYH A;  3C66 A;  4J9O A;  3GIL A;  8ICV A;  4RWO A;  3RJH A;  3C2K A;  4ECU A;  2ZTD A;  1ZQL A;  4B9L A;  3PNC A;  1L3U A;  4C8L A;  1JXE A;  3QE9 Y;  5HRL A;  1A76 A;  3ZD8 A;  4MF8 A;  4DFK A;  5J2G A;  4QZH A;  1CUK A;  2BGW A;  4I2I A;  3SV3 A;  2C2R A;  1KFD A;  9ICX A;  2DR8 A;  2BCQ A;  4X4U A;  3OV7 A;  4I2C A;  3JPP A;  4JV2 A;  8ICC A;  9ICA A;  8ICH A;  2XO7 A;  2B21 A;  2O1P A;  4BGD A;  2NRW A;  1QSY A;  1ZQR A;  2BQ3 A;  4ZH4 A;  3WFQ E;  5KG6 A;  3MDA A;  3TAN A;  2IBK A;  7ICF A;  4RWN A;  2XY7 A;  3HPO A;  4ECV A;  1BPZ A;  5KFP A;  4DQR A;  5L1L A;  4B9N A;  1UEU A;  4FBU A;  3OHB A;  4JV1 A;  3RB0 A;  3OJS A;  4UB4 A;  2IHN A;  1IXR A;  1U9L A;  1MQ2 A;  4DSK A;  3PO5 A;  3C5G A;  3UXP A;  1ZQW A;  4QWE A;  2PXI A;  3PVX A;  5KFM A;  1XU4 A;  4K4G A;  4E8F A;  5KFU A;  1X9S A;  5DGA A;  3RJG A;  4DSJ A;  4ELT A;  1YLQ A;  2ASL A;  2KFZ A;  4KLF A;  3QZ8 A;  4RPX A;  3LWM A;  2BR0 A;  3HIY A;  1JIH A;  1UET A;  4G3I A;  3OUY A;  3JZ0 A;  2NRZ A;  4JUZ A;  4M9H A;  5DB9 A;  3H4D A;  4E0D A;  4DSI A;  4Q45 A;  3MR6 A;  3WFR E;  8ICO A;  4DEZ A;  3EWA A;  5J0X A;  2KN7 A;  1XO1 A;  1FA0 A;  3HJ4 A;  1S0V A;  4WC6 A;  1V9P A;  4M47 A;  4QZ8 A;  1XS9 D;  4RQ7 A;  4TQS A;  3AUO A;  2Y1J A;  2ISP A;  4O5K A;  3QEB Z;  1B22 A;  7ICQ A;  1KFS A;  4QZA A;  2BPC A;  2MUT B;  3Q8S B;  4DFJ A;  5HMM A;  1D8L A;  5IIN A;  2AGO A;  2HHQ A;  4DOB A;  9ICW A;  3RJE A;  3EYZ A;  3AU6 A;  3OJU A;  1UT8 A;  2JZB B;  2UVV A;  2R8K A;  3BDP A;  4O3N A;  3ISB A;  1WCL A;  4K4H A;  8ICN A;  4J9N A;  3FDS A;  4AT9 A;  1C7Y A;  3OSP A;  4EBK A;  1OU5 A;  1Y88 A;  3H7I A;  4YVZ A;  5CJ7 A;  1EXN A;  1ZQK A;  1JXL A;  2UVR A;  4KLT A;  5L9X A;  1ZQS A;  7ICM A;  1NO5 A;  4DQS A;  4I29 A;  5J0Y A;  4R63 A;  1QSL A;  3RJF A;  4M6W B;  4JWN A;  2A1J B;  4RNN A;  3T5L A;  5KFW A;  4ED7 A;  3AQK A;  4ECT A;  4DL2 A;  3C1Y A;  5CB1 A;  4DLE A;  5J2I A;  4ED3 A;  2J6U A;  4KLI A;  1U47 A;  4FHV A;  1SZP A;  5DLF A;  1UEV A;  4NKU A;  2AGQ A;  5KFF A;  4UQG A;  4DO9 A;  2KZZ A;  4UAW A;  9ICI A;  3GV7 B;  7ICL A;  3GIJ A;  4YR0 A;  5F9L A;  1XSL A;  4UAZ A;  1UA0 A;  1KEJ A;  8ICP A;  2Y1I A;  7ICH A;  3BQ1 A;  2M2V A;  4WC2 A;  3OVA A;  2KTQ A;  4DFP A;  3C18 A;  2ZH2 A;  4Q8F A;  3PW0 A;  4QZD A;  1ZQP A;  2V9W A;  4C8M A;  5KFK A;  4RUC A;  5J2J A;  1T4G A;  4RNO A;  4FHX A;  3V7L A;  5DGB A;  4FO6 A;  3RBE A;  8ICK A;  3GDX A;  3UQ2 A;  3KHG A;  4NLZ A;  4PPX A;  5HHI A;  3SYZ A;  4RQ1 A;  4P4M A;  3MR3 A;  4JV0 A;  4F4Y A;  5HC9 A;  5D49 A;  5D4B A;  4DWI A;  2PI5 A;  1ZQZ A;  5KG3 A;  4YMM A;  4PH5 A;  2M2U A;  2W9C B;  2BDP A;  2R8I A;  5J2H A;  4X4S A;  2ZH6 A;  2I9G A;  2J6T A;  5HRG A;  3BQT A;  4X4N A;  8ICX A;  1NJY A;  4J9R A;  3JPO A;  5KT2 A;  1BPB A;  5KFY A;  3H38 A;  3V72 A;  1BVS A;  2VAN A;  5KFT A;  1S0N A;  3MGH A;  1LV5 A;  4BXO A;  4IR9 A;  4AT7 A;  1SL2 A;  3H37 A;  4LZG A;  2DR7 A;  4O3P A;  4B9V A;  4Q44 A;  3PML A;  1RZT A;  2J6S A;  3V6H A;  4DL6 A;  2W9A A;  1KFT A;  1TV9 A;  4IG8 A;  4O5C A;  4X4P A;  3TQ1 A;  2V4Q A;  4QZC A;  4MEX A;  2DPI A;  1SL1 A;  4X4V A;  4DL7 A;  4KLH A;  4DSL A;  1ZQO A;  5J2E A;  4I27 A;  4P2H A;  3ZDA A;  3N97 B;  4LT6 A;  4RUA A;  4UAY A;  2V4R A;  1ZQD A;  2UVW A;  1TAQ A;  5IIO A;  4GXK A;  3M9M B;  3T5H A;  2BCR A;  4RT3 A;  1NK4 A;  4XUS A;  3Q8P B;  4J9K A;  3PX0 A;  3H39 A;  4EZ6 A;  1ZQC A;  1L5U A;  5TZV A;  4C8K A;  1A77 A;  1X9M A;  1S0O A;  2ZHB A;  1B43 A;  3OVS A;  3G6V A;  3PX6 A;  4XQ7 A;  5KTQ A;  1QTM A;  1KDH A;  4KLQ A;  4IQU A;  5III A;  3HJ1 A;  1TFR A;  2ZTC A;  4PHA A;  4Z6D A;  1F5A A;  5EOZ A;  1TKD A;  4RPY A;  1ZQM A;  4MF2 A;  2AQ4 A;  1N48 A;  1R8B A;  4MFF A;  4IQT A;  4RQ8 A;  3PW4 A;  1ZQQ A;  4C8N A;  3ZDD A;  2HHW A;  4M2Y A;  2P66 A;  2ASJ A;  3THV A;  4ED1 A;  3C21 A;  1ZQB A;  1TAU A;  1HJP A;  5KG2 A;  4BWM A;  3HX0 A;  4X0A A;  2KZ3 A;  2IMW P;  8ICA A;  3TFR A;  3PY8 A;  4X4Q A;  4S3N A;  5KFN A;  4F5O A;  3RRH A;  4RT2 A;  2BQU A;  1ZQE A;  4IR1 A;  1MSW D;  5DB8 A;  2HHX A;  9ICL A;  9ICK A;  9ICF A;  3H8W A;  4BDP A;  3MBY A;  4KLD A;  1RXW A;  3B0Y A;  3RH5 A;  5J0W A;  1NKB A;  4O9M A;  3M9N B;  5J2F A;  4ED2 A;  4F4Z A;  4DQP A;  1TFW A;  2FLN A;  4QWC A;  3L9D A;  4F2R A;  5DG8 A;  5EWF A;  3G6X A;  4YG2 A;  5KFA A;  5KFC A;  2XGQ A;  4EYH B;  3H40 A;  9ICH A;  9ICU A;  1BNP A;  4YMO A;  3JPN A;  2PBE A;  2FMQ A;  3GV5 B;  4F2S A;  4M5D A;  4KLS A;  2BKE A;  4QZF A;  3RB4 A;  3V7J A;  4IRK A;  1NZP A;  1K1Q A;  4I2D A;  3IHQ B;  7ICR A;  3HP6 A;  1DOQ A;  3LQC B;  4DL5 A;  3QZ7 A;  2PFN A;  4AT8 A;  4F93 B;  2NRT A;  1SKR A;  4RQ0 A;  1JX4 A;  2P6R A;  4WC7 A;  4I2J A;  7ICT A;  1MIV A;  3OVB A;  4BWJ A;  5J0Q A;  3NYB A;  2GWS A;  2DR5 A;  4UD4 A;  1RPL A;  1K1S A;  5J2A A;  2RDJ A;  3C2M A;  3TAP A;  9ICN A;  1DGS A;  3BQ0 A;  4ELU A;  2W9B A;  4F8R A;  2BQR A;  1LB2 B;  7ICV A;  2KFN A;  1NOM A;  1ZQV A;  4UBB A;  4ECX A;  2UVU A;  1XWL A;  4J9P A;  1ZJM A;  4WC0 A;  4I2E A;  3OHA A;  3RTV A;  4Q43 A;  3LWL A;  4J9M A;  1S10 A;  2PFQ A;  4HYK A;  3QEA Z;  1TK0 A;  5HRB A;  4X4R A;  1WCN A;  9ICV A;  3OSN A;  1KRP A;  3JYY A;  3C1Z A;  3PX4 A;  1KTQ A;  2DFL A;  5DBB A;  5J2C A;  3RAQ A;  1Z3E B;  4O3Q A;  4PHP A;  4B9S A;  4QZG A;  3K75 D;  4KIT B;  4GC6 A;  5L1K A;  4KLM A;  2FPM A;  3ZDC A;  5J0T A;  3KTQ A;  2HHU A;  1ZQG A;  5L1I A;  2JEF A;  3PO4 A;  3TAR A;  4J9S A;  4ECS A;  3TFS A;  3RB3 A;  8ICB A;  5IIK A;  1ZQN A;  2IHM A;  1Z00 A;  4YQW A;  4B9M A;  5HR9 A;  4RWQ A;  4EP7 A;  1NK8 A;  4YXM A;  5CA7 A;  1ZYQ A;  4IRD A;  7ICG A;  3ZDE A;  5BPC A;  1ZQF A;  4PHE A;  3T5J A;  4NXZ A;  2ID1 A;  4DF4 A;  4RWP A;  4E80 A;  4DOA A;  4ELV A;  1JAJ A;  4FH5 A;  4DLG A;  2R8H A;  9ICC A;  1TK8 A;  5DBC A;  2AGP A;  3NTU A;  3V7K A;  2PFP A;  5KFO A;  3ORY A;  4RZR A;  2FLL A;  3OUY B;  4IQW A;  4UB3 A;  3GQC A;  4PGY A;  1CEZ A;  2W9B B;  4DL4 A;  4MEY A;  1S97 A;  1L3T A;  5KT7 A;  5KFZ A;  2XCA A;  4FS2 A;  3RRG A;  3E2E A;  1ARO P;  7ICE A;  5HNK A;  1DK2 A;  4X4T A;  4ECW A;  3EW9 A;  5DEC A;  1ZQA A;  2LYH A;  1QSS A;  3Q8Q B;  2C28 A;  5IIJ A;  4YCX A;  1RYR A;  9ICE A;  1TFY A;  1L3V A;  4R8U A;  3SV4 A;  1U49 A;  9ICP A;  3K4G A;  1UA1 A;  4WCW A;  2H5X A;  1D9F A;  1ZQH A;  5DQG A;  8ICZ A;  8ICR A;  4DL3 A;  3V6J A;  3KHL A;  3BQ2 A;  4NM2 A;  5EWG A;  3UXN A;  4KLG A;  7ICK A;  4UB1 A;  3GIK A;  5IIM A;  2W8L A;  4QZ9 A;  1NK5 A;  8ICY A;  3WFO A;  4QWD A;  4R64 A;  4EBC A;  3BJY A;  1WOT A;  4AT9 B;  2NRV A;  2WTF A;  1ZQT A;  3PMN A;  4EBE A;  2XY6 A;  1MIY A;  4YD2 A;  4UB5 A;  5J2K A;  1TVA A;  7ICS A;  3T3F A;  2JEI A;  5KG1 A;  2R8J A;  9ICG A;  4IQV A;  7ICO A;  2ALZ A;  8ICM A;  4GXI A;  4YD1 A;  3RBD A;  3RJI A;  7ICI A;  5J0U A;  3OGU A;  8ICQ A;  5DQI A;  1N56 A;  5KFS A;  4CCH A;  4I2F A;  2ZH4 A;  1H38 A;  2KP7 A;  4ATB B;  5KG7 A;  4I2G A;  5DKW A;  4WC4 A;  4F4X A;  4XRH A;  4XQ8 A;  1U48 A;  2M2T A;  1XSN A;  4IRC A;  4YMN A;  1T3N A;  2JEG A;  5KG5 A;  3RH6 A;  1UT5 A;  1IM4 A;  5CHG A;  4NM1 A;  4X5V A;  2M9N A;  3TAQ A;  4ATB A;  2IA6 A;  5KG0 A;  2MAX A;  2HW3 A;  4I2H A;  2AJQ A;  4NY8 A;  1XC9 A;  5KFL A;  1PX5 A;  3GFK B;  2ZJ8 A;  3RJK A;  4MFC A;  2HHT A;  4QW8 A;  4NLN A;  4KLJ A;  3Q8L A;  5JUM A;  1R89 A;  3RAX A;  2XCP A;  3GIM A;  5DB6 A;  3EPI A;  9ICB A;  4PGQ A;  4F50 A;  1R8A A;  5HRF A;  4J9Q A;  4E7X A;  2ZH3 A;  3M8S A;  9ICQ A;  3MFH A;  4DSE A;  4QWA A;  1VJ7 A;  4FHP A;  4FH3 A;  3ETL A;  5KFB A;  3AQM A;  1NJW A;  8ICE A;  5L1J A;  1COO A;  4F5R A;  4GC7 A;  1D8Y A;  5BOL A;  4KLE A;  8ICS A;  2R8G A;  4KN4 A;  4RQ3 A;  1S0M A;  5HHH A;  2FPK A;  5KFD A;  1X2I A;  4C8O A;  5DG9 A;  4UB2 A;  5DG7 A;  4KN7 A;  3HT3 A;  4K4I A;  2FPL A;  4BXO B;  4AT7 B;  1S9F A;  3RR7 A;  4NLG A;  3MR2 A;  1JN3 A;  3NGD A;  4DS5 A;  1Q79 A;  3MFI A;  4TUR A;  3MGI A;  2DRB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...