4M47A

Structure of human dna polymerase complexed with 8-brg in the template base paired with incoming non-hydrolyzable gtp
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
324
structure length
314
Chain Sequence
NGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title Structural basis for promutagenicity of 8-halogenated Guanine.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
total genus 104
structure length 314
sequence length 324
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4m47A02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4m47A01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4m47A04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4m47A03
2ISOA 5KTQA 3UXPA 5KG6A 2PFNA 4BDPA 5DG9A 3AU6A 1JMSA 3QZ8A 3TARA 5KG7A 3RJIA 5EOZA 2J6SA 4J9PA 3AQNA 4J9KA 5J2IA 8ICQA 1ZQQA 5DKWA 1X9MA 3ZD8A 1ZQMA 4TUQA 4X4VA 2VA8A 3GV5B 5HRLA 1S97A 1V4AA 4PPXA 4YXJA 1SKRA 4RQ6A 4NLKA 5HRKA 5DB8A 5IILA 2DRAA 2KFZA 4EYIB 3C18A 3OGUA 5EWFA 1Q79A 5KFDA 4R8UA 1NKBA 1ZQZA 3AU2A 1Y88A 4LZDA 1QLNA 3T5JA 1S10A 4C8MA 4P4MA 1NK0A 4DFMA 5J0QA 1ZQIA 3PO5A 4DF8A 9ICNA 1U47A 3HW8A 5J0TA 3Q8SB 4YCXA 5DGBA 3H40A 2PXIA 2FMSA 3HX0A 1T3NA 3NTUA 4O0IA 4R63A 4O3OA 4IRCA 8ICUA 4AT9B 4YMMA 3SZ2A 8ICTA 3V6KA 4DFJA 2Y1IA 2UVVA 3T3FA 1ZQTA 4PHAA 5BPCA 3RJKA 4J9QA 4RUCA 5DB7A 4J9LA 5JUMA 4O9MA 4X4PA 7ICIA 3PW2A 9ICIA 5D4BA 5F2VO 4FBTA 2PBEA 4I2DA 5TZVA 3ZDDA 2HHVA 2BHNA 3M9MB 4RPXA 1KFTA 2DPJA 3UXNA 4HYKA 4JV0A 3PR5B 2ASJA 4DSJA 1L3VA 4WC5A 4TQRA 4IQWA 3MR5A 7ICGA 4X0AA 5DBCA 3L9DA 1XS9D 4CCHA 4NLGA 5HHIA 5KT5A 1ZQGA 4DEZA 3C5GA 3PV8A 3RAXA 2NRTA 1MQ3A 4M9JA 4NY8A 4YQWA 3Q8PB 3RBDA 1RYSA 1ZQHA 2AQ0A 4M5DA 4X4QA 1U9LA 3Q8RB 3PY8A 4JV2A 4EP7A 4M6WA 3WFSC 1KTQA 2BCQA 5J2FA 4RQ1A 1NK6A 4PH5A 2VA3A 1XSPA 5KFAA 3LWMA 4DO9A 1ZQJA 4F3OA 8ICVA 5KFLA 1RXWA 4QWAA 4ZH4A 5CWRA 2ATLA 2ID1A 3H3AA 3TI0A 2KZMA 2ZJ5A 5DG7A 1TV9A 4GXKA 1A76A 2PFOA 1Z00A 3RJHA 2O1PA 4WCWA 4EBJA 7ICTA 1CEZA 1TVAA 4Z6CA 9ICJA 2P66A 4TURA 4I2HA 2P6UA 3JPRA 4EYHB 5KT2A 4E0DA 7ICMA 2I9GA 2M9NA 1IXRA 5KT6A 1RZTA 4IR9A 3ETLA 8ICKA 4KLFA 1TKDA 1L3SA 2DR7A 5DLGA 4X5VA 1XC9A 1NKEA 2ZH9A 4F4ZA 5HC9A 2PFQA 2Y1JA 2PI5A 3MR2A 2HHWA 4AT8B 1N56A 2Q0ZX 3SV3A 4K4IA 2AGQA 4WC0A 4ECVA 2W8LA 4RQ8A 4PGQA 5KFPA 1PX5A 4E7XA 3ISBA 3PMNA 1MIWA 3OSNA 1UETA 1S76D 4GC6A 1ZQNA 2HHUA 3ISDA 3FDSA 3TFSA 3C21A 3GIJA 1SL1A 1KLNA 2IBKA 3V72A 4Z6DA 1MC8A 8ICYA 5F9NA 4TQSA 4DOAA 4RQ2A 8ICAA 5KFEA 3HIYA 4F5QA 2V4RA 2ZUDA 4ECSA 3RH6A 2A1JB 2B21A 5J2KA 2W9CA 2ZUCA 4QZGA 3HWTA 4O5CA 3PO4A 2W9MA 1QSYA 5DB9A 3FYHA 5J2AA 4QZDA 2VANA 2XGPA 3KHGA 3G6YA 4ED0A 5L1IA 1L5UA 7ICOA 9ICVA 3EPIA 4FO6A 2BR0A 4C8KA 4RQ3A 4ED1A 4B9NA 4LT6A 4RWPA 7ICKA 3WFOA 4NKUA 4R66A 1NJWA 5HRFA 2MUTB 2OWOA 1ZQLA 3GIIA 4KLQA 5J2EA 4UBBA 4GXIA 3LK9A 4F93B 1ZQBA 5DDYA 4PHPA 4I2AA 2HW3A 1MSWD 3M8RA 2XGQA 4QWDA 3MDCA 4F5OA 2R8KA 3THVA 2ZH2A 5DBAA 3RB0A 4DQIA 2HHXA 3UPSA 4B9LA 3Q8KA 2RDJA 1ZQFA 5CJ7A 4UQGA 4F5PA 5KT4A 4I2JA 1JXLA 1ZQRA 4JWNA 3EW9A 3UQ0A 1KEJA 4P4OA 2C2DA 5EWGA 7ICSA 4XQ7A 1BGXT 5KFXA 3M9OB 2FMPA 9ICAA 5J2JA 2ZTCA 3MGIA 4YD1A 2BQRA 4ATBB 5CR0A 4QWBA 5D46A 3ZDEA 8ICIA 5KT3A 4UB2A 2BDPA 4KLDA 1TAQA 5KFNA 4I2CA 3N97B 3V7JA 3EWAA 4KN7A 3T5KA 3BJYA 2WTFA 4DL7A 4KLLA 3B0XA 9ICXA 2DRBA 1T7PA 2AU0A 1QTMA 7ICFA 5CP2A 8ICJA 2M2WA 5HR9A 4TUPA 3HJ4A 2DR9A 4K4GA 4YR2A 1RYRA 2NRXA 1NJZA 2JEFA 4S3NA 1BPEA 3GV8B 3RR8A 1MIYA 3PR4A 1NK5A 3OUYB 1TFYA 4PGXA 4RQ5A 1WCLA 2FPLA 3RJJA 4ELUA 3RRGA 4I2FA 2FLNA 3MR6A 4EBCA 3MDAA 1CUKA 5KT7A 5HP4A 1L3TA 2R8IA 4NLNA 3MBYA 4UAZA 1NJYA 2BPGA 4Q8FA 3OHAA 3N4MB 4K4HA 1BNOA 3WFRE 1R89A 3C1ZA 4M47A 7ICHA 5DB6A 3Q8QB 1MIVA 2FPKA 5HNKA 2W9BA 4I28A 4O5EA 4WC7A 3WFQE 3M9NB 4EBKA 2LYHA 4J9RA 2IHNA 9ICCA 1NZPA 8ICSA 2BQ3A 2M2UA 5DEDA 4RU9A 1X9SA 1NOMA 3LQCB 4UB4A 4RT2A 4KITB 4JWMA 1JN3A 1LV5A 1JAJA 4BXOB 4B9UA 1SZPA 4WC2A 4AT7A 4MFCA 4KLSA 4Z6FA 5IIKA 3PW5A 4RQ0A 3T5LA 1NK7A 1EXNA 4I27A 8ICWA 4E80A 4DQQA 5L9XA 4YMOA 3H39A 3MFIA 2C28A 5KFBA 1U49A 2ZH5A 3V7LA 4RNOA 3RB4A 2BQUA 1ZQSA 9ICRA 1F5AA 4KLJA 4YN4A 4F92B 3C2LA 4DSKA 4QZAA 3Q8MA 1T4GA 2ZJ8A 5KFFA 1NK8A 4F2SA 3RJFA 4X4TA 4MEYA 1BNPA 5J2CA 3G6VA 4KLIA 4DS5A 4X4NA 3MR3A 1UA0A 2UVUA 1U45A 4M9NA 2BKEA 7ICPA 2ZH3A 1R8AA 1L3UA 1WOTA 2DR5A 4KMUA 3LDAA 3PMLA 2M2TA 2IHMA 3TANA 3V6JA 1BVSA 4FH5A 4IG8A 2JZBB 4RPYA 2MAXA 5J0WA 4J9OA 3G6XA 1ZQOA 4I2BA 7ICUA 3C66A 2O5AA 1PZNA 2KZZA 3GDXA 5J0RA 1A77A 4JV1A 4ECWA 2ZJAA 1JX4A 4FHVA 4E8FA 1XSLA 2R8JA 4MF8A 4P2HA 2H5XA 5J2DA 5KFHA 2DFLA 1XSNA 4F4WA 4DFKA 4RZRA 4MF2A 2UVRA 1D9FA 4UB3A 3EPGA 3RRHA 2NRZA 1TK0A 2XC9A 3K75D 2BCVA 3PW7A 4X4RA 4YG2A 3HT3A 3QE9Y 1NK4A 1BPBA 3V7KA 3UQ2A 3ZDBA 4M9GA 4XQ8A 4O5KA 3E2EA 4RQ7A 4J9SA 3AQLA 3PX0A 1KDHA 3H8WA 4IR1A 1ZQYA 3T5HA 2C2EA 1KRPA 8ICGA 2ASDA 2KP7A 5BOMA 4ED3A 4DF4A 4YVZA 3UPQA 4ED7A 9ICHA 1ZQDA 3JPNA 2JEJA 2ISPA 3IHQB 4J9MA 4R8UB 4ECXA 1D9DA 4DSEA 3TAPA 7ICQA 5KFWA 2AGOA 4AT9A 3AQKA 3RB6A 3QEAZ 3GV7B 3H8SA 1ZJNA 1ZQPA 1KSPA 1XU4A 3BQTA 5HMLA 4YP3A 2GWSA 4ECQA 2KN7A 3PW0A 4O3RA 4EZ9A 1C7YA 3OSPA 5J2GA 1SL2A 3PX4A 2ZUBA 4PHDA 3H4BA 4ECTA 1TK5A 1S9FA 7ICRA 8ICLA 5DQGA 2F1IA 1UT5A 4IQUA 3RTVA 2C22A 3GILA 4TUSA 4KLGA 1SKSA 4EBDA 8ICEA 1NKCA 3OVSA 1B43A 4XA5A 4KN4A 5DG8A 3OJSA 4ECYA 4ED8A 1WCNA 3B0YA 2FLPA 1QSLA 4PGYA 3ISCA 5KFCA 3JPTA 3HPOA 1S0NA 1S77D 3JZ0A 4MFFA 1SKWA 4DWIA 2J6UA 7ICNA 9ICEA 5CA7A 2ZH4A 5DLFA 2FLLA 5KG5A 4YFKA 4RT3A 3QZ7A 9ICSA 5DDMA 3RBEA 3H37A 4X4SA 4KLUA 2KZ3A 3TFRA 1BPYA 4RQ4A 4GXJA 1UT8A 9ICBA 2BCUA 4X4OA 4F5NA 1COOA 5IIOA 3GIKA 4FH3A 4QZBA 3GFKB 2VA2A 1XO1A 4YR3A 4ELTA 4RWNA 1DGSA 3PNCA 1DOQA 4M6WB 5IIJA 4J9NA 5IINA 4DOCA 5D49A 4DS4A 4UBCA 4G3IA 3ORYA 4GC7A 5HRBA 3TQ1A 1KNYA 3RAQA 3OJUA 1Z00B 3EZ5A 4QZFA 1S0VA 2ZHAA 2NRWA 4QZEA 2PI4A 8ICCA 9ICPA 3C2MA 4ECUA 4BGDA 5CHGA 8ICZA 4UB1A 2RDIA 2JEIA 4AT8A 4QZ8A 5KG0A 4F2RA 1ZQAA 3TAQA 2BCSA 4M0AA 3GQCA 4DQSA 3M8SA 4PHEA 3RR7A 3JYYA 4DL2A 7ICLA 2FPMA 4UD4A 1Z3EB 4B9VA 3H7IA 1ZJMA 5EWEA 3KTQA 5J0XA 2DR8A 4Q43A 4F5RA 1ZQKA 5KFMA 3H8JA 5J0YA 5IIIA 5DQHA 3JPQA 4DL3A 1X2IA 4JUZA 2HHQA 4NXZA 4DL5A 2A1JA 1S0OA 3V6HA 1JXEA 3HP6A 5J0UA 2Q66A 2BPCA 1DK2A 2DVIA 3MABA 2XCAA 4IRKA 4QZIA 1H38A 4IQVA 2F1HA 8ICHA 9ICWA 4WC6A 1BPDA 2R8HA 5KG1A 4ECZA 2J6TA 3NGDA 2W9CB 4FS2A 3HJ1A 3BQ0A 3PVXA 4O3SA 5BOLA 1IM4A 2NRKA 2RFFA 2MUTA 3RJEA 2BGWA 5KFGA 4DSFA 2NRVA 3AQMA 5HRDA 2ZTDA 4O3QA 2F1JA 3BQ1A 8ICBA 3H38A 5KFIA 4I2EA 2ZTEA 3H4DA 4RWOA 5L1KA 4QW9A 2JEGA 8ICXA 4FBUA 1MQ2A 1D8YA 2ZH6A 2V4QA 5CB1A 1UEUA 3OV7A 5KG3A 1NK9A 1RPLA 2W9AA 2M2VA 1VJ7A 8ICNA 9ICUA 4LVSA 4M2YA 2HHSA 1QSSA 2FMQA 4B9TA 1TAUA 4C8OA 1UEVA 4ED6A 4Q8EA 1ZYQA 2ZH7A 5J2BA 3GIMA 1VFGA 1HUOA 5KG4A 1ZQCA 5KFOA 2HHTA 4ATBA 3C5FA 4DL4A 2AQ4A 1KFSA 1XWLA 8ICFA 5L1LA 4P4PA 4I29A 5F9LA 2IA6A 4DOBA 4EZ6A 3SI8A 5KFVA 3NYBA 4YMNA 3SYZA 4FS1A 2ALZA 3IM1A 5C5JA 4ECRA 4RWQA 1DK3A 4F4KA 9ICTA 1OU5A 4X0BA 4WC3A 1YLQA 3OHBA 3JPPA 4EEYA 3RJGA 4M9HA 4C8NA 4ED2A 4WBZA 3OUYA 2XY5A 1U48A 1ZETA 1B22A 2HVIA 1TFRA 3C23A 3BQ2A 2ZH1A 1NO5A 5HRHA 3JPSA 1UA1A 5KFYA 4I2GA 4KLMA 9ICKA 4WC1A 5DGAA 5KFRA 4EBEA 4YXMA 4BWMA 4QZ9A 3RB3A 4LZGA 1JQRA 1D8LA 3C2KA 2IMWP 1ZQWA 4YR0A 8ICRA 1FA0A 3WFPA 2ZHBA 4ELVA 1Q78A 3AUOA 7ICEA 2W8KA 3EYZA 4FHWA 4C8LA 4RUAA 5KFTA 4MFAA 4JK1A 1X9WA 2ASLA 4DLEA 4B9SA 1K1QA 4DQPA 9ICMA 3UXOA 5IIMA 5HREA 5HRIA 2HHPA 4DSIA 2ZH8A 1T8EA 4QWCA 1HJPA 2XO7A 4F8RA 4M04A 2W9BB 4KLTA 3PX6A 9ICFA 3LWLA 9ICQA 4FHPA 2DPIA 2BCRA 1HUZA 4BXOA 1TFWA 3RH5A 1ZQVA 2BPFA 5DQIA 1TK8A 3BDPA 4NLZA 1BPXA 3KHRA 5L1JA 4F4YA 5KFJA 4KTQA 4KLEA 4NKTA 5KFSA 5J0OA 4DQRA 4RNNA 4GLXA 4QWEA 1NJXA 2BE3A 2I1QA 5J0SA 4UD5A 4I2IA 5KFQA 4AT7B 4WC4A 4BWJA 4DSLA 2KFNA 1R8BA 4X4UA 2AGPA 4NM2A 3MGHA 1N48A 4NM1A 4UB5A 1KFDA 5HHHA 4R64A 3OVBA 3C1YA 4F91B 2PFPA 2XY6A 1S0MA 5KG2A 2R8GA 4F4XA 4XRHA 5DBBA 4FHXA 3SV4A 1LB2B 4IRDA 1BPZA 9ICGA 1R8CA 5J2HA 3K4GA 9ICOA 2AJQA 2UVWA 8ICPA 5KFZA 4IQTA 3KHLA 1U4BA 4RNMA 4FHYA 1K1SA 4QW8A 2P6RA 4DLGA 4B9MA 4KLHA 4WBYA 4YD2A 4M9LA 9ICLA 4Q45A 4O3NA 2XCPA 4QZHA 8ICMA 7ICVA 3ZDAA 2HVHA 2V9WA 5J29A 4Z6EA 2JZBA 2KTQA 1AROP 3RH4A 1V9PA 4MEXA 3ZDCA 5HRGA 4XUSA 3QEBZ 3OVAA 1JIHA 4F50A 8ICOA 4RPZA 3ZD9A 3MFHA 3Q8LA 1ZQUA 7ICJA 5J0PA 2C2RA 4R65A 1ZQXA 4DFPA 3PW4A 1ZQEA 1RXVA 5HMMA 4QZCA 5KFUA 4KLOA 3KHHA 3JPOA 4Q44A 4DL6A 2XY7A 1SL0A 5KFKA 4O3PA 4UAWA 5DECA 4UAYA
chains in the Genus database with same CATH superfamily
2ISOA 4UAVA 5KG6A 5DG9A 3AU6A 3QZ8A 3WK9A 5EOZA 4NWIA 1X9MA 3ZD8A 1ZQMA 3GV5B 1GO3F 5HRLA 3L4PA 1V4AA 1SKRA 4RQ6A 4NLKA 1L7PA 2EDUA 2DRAA 2DL0A 1Q79A 2D8CA 5KFDA 4R8UA 2D3DA 2ZIVA 1VLBA 1Q3VA 1ED1A 4NJ8A 4DFMA 1TAMA 3H40A 5K4LA 5AM3A 1COKA 3NTUA 4R63A 8ICUA 4WQKA 2Y1IA 2DF4B 3T3FA 4J9LA 4X4PA 4U6PA 1L7MA 2HHVA 4JB3A 3WKEA 1IG6A 4LEVA 3MR5A 1XS9D 4CCHA 4OAGA 1VDVA 3SR6A 3NRZA 3PV8A 5AM5A 1MQ3A 4YQWA 1ZQHA 1PUZA 4FO1A 3WFSC 2BCQA 4RQ1A 1NK6A 2VA3A 4PH5A 3LWMA 1ZQJA 4F3OA 1RXWA 4QWAA 4ZH4A 5CWRA 2ATLA 2ID1A 3H3AA 3F2DA 3RJHA 4EBJA 2O1PA 5JRTA 2M9NA 4KLFA 1JRPA 5KL1B 2JR5A 3QUCA 2PI5A 3SV3A 4K4IA 2AGQA 2W8LA 4RQ8A 4PGQA 5KFPA 1ZQNA 3WK5A 3TFSA 3C21A 2G07A 1L6NA 8ICAA 5B5EU 4RQ2A 1SXDA 2EAPA 4F5QA 2ZIXB 2ZUDA 2B21A 2KIWA 4O5CA 1QSYA 3FYHA 3WK7A 4C8KA 2B51A 5HR6A 2VKQA 3WFOA 2DQNB 1NJWA 2Z7JA 3GIIA 4KLQA 3ONNA 1ZQBA 2HW3A 2HN1A 5DDYA 1ZXIA 1ZD5A 4QWDA 1B4FA 2YB1A 2PKEA 3RB0A 4KM5A 2LBOA 1WYGA 2RDJA 4UQGA 4I2JA 4JWNA 1KEJA 3QX7A 1PK1B 3M9OB 1MA7A 2FMPA 3MGIA 5JTIA 3S6JA 5B3PA 4IS7A 3ZDEA 8ICIA 3I76A 4K9AA 3T5KA 4DL7A 4KN7A 3EUB2 5AI5A 2OYYA 4KLLA 9ICXA 3B0XA 2M2WA 4TUPA 5AKEA 3LVWA 3QU2A 3BS7A 3OUYB 4PGXA 4ELUA 2EQYA 3MDAA 4UW9A 4NLCA 4Q8FA 4K4HA 5EE0A 3C1ZA 2EAMA 1NZBA 1MIVA 2KICA 2W9BA 4QNLA 4I28A 2IHOA 4Y2RA 4J9RA 1L7NA 2IHNA 9ICCA 2E8PA 2M2UA 5DEDA 1KN5A 2PMZC 4JWMA 1SZPA 4Y2XA 4MFCA 4Z6FA 3T5LA 4E80A 2KOBA 4UATA 5AM2A 5L9XA 5CHEA 3H39A 1U49A 3OPXA 2LPEA 3FC4A 3V7LA 4CGZA 9ICRA 4YN4A 3C2LA 3H0LB 1LKYB 2E3TA 4X4TA 4MEYA 3G6VA 2KJ9A 4DS5A 3MR3A 1U45A 4M9NA 3TADC 4KMUA 3PMLA 2IHMA 4QIWC 1YZ7A 4RPYA 4K97A 7ICUA 3C66A 2KZZA 1VJ5A 3H0RB 4MF8A 2GO7A 2DFLA 1XSNA 2A19A 4RZRA 3BZCA 2HDOA 1D9FA 3D6JA 3RRHA 4OJOA 3WKDA 2NYVA 3PW7A 4X4RA 5D61A 3HT3A 1NK4A 3ICXA 4Y2YA 2LI6A 1KDHA 2C2EA 2ASDA 4YVZA 4C7YA 5ALEA 4ECXA 4ICAA 3D2NA 2AGOA 1YT3A 3H8SA 1ZQPA 1XU4A 3BQTA 2E8MA 1Q3UA 2I5HA 1C7YA 5J2GA 2ZUBA 4C80A 1ZRMA 2MU2A 5EE1A 8ICLA 1IV8A 1UT5A 2K8CB 3NVYA 4IQUA 3PSTA 1SKSA 1NKCA 4ED8A 4XA5A 2MRLA 3ISCA 3JCFA 2FLLA 3H37A 1CRXA 2EAOA 1UT8A 9ICBA 5AIAA 3GIKA 4FH3A 3GFKB 4GIBA 1XO1A 5FP0A 4RWNA 3PNCA 1DOQA 2ZXIA 4M6WB 5IIJA 5ALJA 3TADA 4FZNA 2HCFA 1TE2A 4ACOA 5ALYA 3ORYA 2IOFA 2ZHAA 4QZEA 1P7DA 3H8MA 3MGVA 4F2RA 3SMVA 3TAQA 4M0AA 4PHEA 1Z3EB 4B9VA 3KTQA 4Q43A 4F5RA 1N2XA 1X2IA 2KSOA 4JUZA 2HHQA 1NI3A 1S0OA 4C4RA 2XCAA 4IRKA 4IQVA 3GZFA 1QH9A 2W9CB 4FS2A 2Y9TA 2KG5A 2OXOA 2MUTA 3RJEA 2BGWA 5KFGA 3AQMA 2WB1C 3M1YA 5KFIA 4I2EA 3H4DA 3K1RB 1J2MA 8ICXA 4FBUA 5AHXA 1NK9A 1PVQA 3VCBA 9ICUA 4LVSA 3SAGA 2YB4A 5ALMA 5J2BA 3GIMA 1L8OA 5KFOA 2W3SA 2HN2A 5F9LA 2IA6A 2WAQF 5CFTA 3SI8A 5AIBA 3ZI4A 3NYBA 4YMNA 3SYZA 2ALZA 5C5JA 1OU5A 4X0BA 5AK3A 4EEYA 4WBZA 2E8OA 2HVIA 1NO5A 1QQ7A 3HKZC 3NVOA 5KFYA 4KLMA 2W3RA 1DRGA 3AQFA 5KFRA 1ZQWA 4YR0A 3WFPA 4ELVA 3EYZA 2I6XA 2BBHA 4JK1A 4B9SA 3QU4A 1T8EA 4OAIZ 5ALTA 4KLTA 9ICFA 4FHPA 3RH5A 2GOLA 5DQIA 4FZMA 1BPXA 3KHRA 5L1JA 5KFJA 4KLEA 3PHZA 3QU5A 4DQRA 4RNNA 2YX8A 4WH5A 2BE3A 1R8BA 5HHHA 3OVBA 5G5HA 3IN5A 3SQIA 5DBBA 1RQLA 2MA1A 3SV4A 4Y2SA 4EV6A 1U4BA 4RNMA 3R9KA 4FHYA 1FEZA 4YD2A 4M9LA 2YMMA 8ICMA 3ZDAA 2KTQA 1V9PA 4F50A 2W7PA 2W11A 5GTHU 2K4EA 5KFUA 5KNIA 4DL6A 3D2QA 5KFKA 1UHUA 2ODGA 3F53A 3UXPA 2PFNA 4BDPA 3F5EA 3RJIA 2LMRA 5DKWA 1OUQA 2DUYA 3IP4B 1D8BA 1ZD2P 3C18A 1ZQZA 1Y88A 2EZYA 1NK0A 3CK6A 3PO5A 4DF8A 1Z1BA 1U47A 5J0TA 2FMSA 5DGBA 2PXIA 4N7RA 3HX0A 1T3NA 4O0IA 2KK0A 4IRCA 4AT9B 1UQVA 3SZ2A 8ICTA 4EELA 3ALRA 3NRWA 1KL9A 4J9QA 4O9MA 5JUMA 4UAUA 4K9BA 3ZDDA 2RRDA 2BHNA 3M9MB 2PMZF 1N61A 4DSJA 4JV0A 4AYBC 1L3VA 7ICGA 2F2AB 4XJEA 3E58A 5HHIA 3IDWA 1ZQGA 4DEZA 2NRTA 4M9JA 3Q8PB 1RYSA 2AQ0A 4JV2A 5GTIU 1KTQA 5J2FA 1XSPA 5KFAA 5KFLA 3WKAA 1HIWA 2KIVA 1TV9A 1Z00A 1CEZA 2OHFA 9ICJA 2P6UA 5ALXA 4EYHB 4E0DA 4QIWF 5KT6A 1RZTA 1QQ5A 4IR9A 2L5YA 1TKDA 1XC9A 2ZH9A 1SB3C 2HHWA 4AT8B 1FFVA 2KJ8A 4E7XA 3ISBA 3PMNA 1MIWA 1UETA 1S76D 3GU3A 3ISDA 1SL1A 1MC8A 2H3VA 3HIYA 5AM0A 2DBYA 4I0UA 5AKLA 2A1JB 4QZGA 5ALNA 2KKPA 3G6YA 2XGPA 2HOIA 4ED0A 2A1AA 2K8AA 4RQ3A 2WF6A 2Y9UA 5CFUA 2OWOA 5CRXA 1OXJA 4PHPA 3M8RA 2XGQA 1Z4OA 2R8KA 2ZH2A 5ALGA 1ZQRA 4P4OA 5EWGA 3NS1A 1BGXT 5KFXA 3U26A 9ICAA 2ZTCA 1WWUA 5CR0A 4QWBA 4FE3A 4B6JA 3CW2C 3HRDD 2HOFA 2BDPA 4KLDA 3ER8C 1TAQA 3EWAA 2W43A 3BJYA 7ICFA 5EE3A 4CE6A 2DR9A 3L3FX 1A0PA 4S3NA 1BPEA 2KJ5A 1MIYA 3PR4A 2W55A 4P0QB 2FPLA 5D62A 3RRGA 2FLNA 5HP4A 5KT7A 4UAZA 1NJYA 1SGGA 5JU5A 4BJQA 5AI8A 4A8EA 5DB6A 2FPKA 5HNKA 2LYHA 8ICSA 1N5XA 1X9SA 1NOMA 4RQNA 4RT2A 4KITB 4UB4A 1LV5A 5AICA 1JAJA 2HBKA 4AT7A 4KLSA 2E5SA 4RQ0A 3KD3A 1EXNA 4DQQA 4LJXA 2WAQC 3O0FA 4US8A 4RNOA 3RB4A 3SEIA 2BQUA 2JH1A 2WF9A 1KKXA 1YZ6A 5KFFA 4KMOB 3RJFA 1BNPA 4LEWA 1Z19A 5ALZA 1UA0A 2UVUA 2WB1F 2ZH3A 1WOTA 4PL2A 1L3UA 4OO1J 3TANA 3V6JA 4IG8A 2JZBB 3FAHA 5JTGA 4I2BA 1FIQA 5J0RA 1JX4A 2R8JA 4P2HA 5KFHA 4F4WA 4DFKA 2JGAA 4UB3A 2NRZA 3K75D 2YMPA 3QUQA 3QE9Y 3E2EA 4XQ8A 4J9SA 3AQLA 3PX0A 1ZQYA 5D63A 8ICGA 5BOMA 9ICHA 3UPQA 2WF8A 4O6AA 3JPNA 2ISPA 3NUQA 3HKZF 3IHQB 5F3XB 4LEZA 7ICQA 1KSPA 4O3RA 4YP3A 4ECQA 5AK6A 3OSPA 1SL2A 3PX4A 4J03A 3OWGA 1AQ6A 3AMZA 4OAHA 5DQGA 3TACB 4U7CA 3RTVA 4TUSA 2E1EA 4EBDA 3OVSA 4ECYA 8ICYA 3B0YA 2YMQA 4PGYA 1SZHA 1QSLA 4MFFA 1SKWA 9ICEA 5AKXA 5AI6A 4O3MA 5KG5A 4RT3A 9ICSA 2F8LA 5DDMA 3RBEA 4X4SA 5J8YC 2KZ3A 1BPYA 4RQ4A 4F5NA 5IIOA 4IC9A 2H3FA 4YR3A 1DGSA 5IINA 4PJ0U 4DOCA 5ALFA 3TQ1A 1S8OA 2F8KA 2K4PA 2OM6A 4ECUA 4QZ8A 5KG0A 4Y2QA 1ZQAA 3GQCA 4DQSA 4DL2A 7ICLA 1DXSA 2HBJA 2DR8A 2FE9A 3ERCC 5KFMA 2ZIXA 1ZRNA 3KBBA 2YN4A 3V6HA 3HP6A 2Q66A 3MABA 4WC6A 8ICHA 9ICWA 1BPDA 2R8HA 4ECZA 3HJ1A 3PVXA 2NRKA 1JUDA 5ALVA 4DSFA 2NRVA 5HRDA 5KAIU 3H38A 4FFDA 2ZTEA 2LM1A 2VJ4A 1MQ2A 2A3VA 3OV7A 3ED5A 5KG3A 2M2VA 2XICA 8ICNA 4M2YA 1TAUA 4C8OA 2QARB 1PK1A 4Q8EA 1ZYQA 1ZQCA 2HHTA 4Y2PA 4CDGA 2AQ4A 8ICFA 4I29A 5KFVA 4AYBF 5AM4A 3IM1A 5AI0A 4ECRA 3EF2A 2IOFK 2OH2A 2K60A 5J8YA 3OHBA 3JPPA 3RJGA 2H3QA 1JI7A 3OUYA 3QUBA 1U48A 1TFRA 3C23A 4WC1A 1X42A 4EBEA 3JYYA 4BWMA 3RB3A 8ICRA 4OJ5A 1SIJA 2Y0SC 3BQ7A 5ALRA 2W8KA 4FHWA 5KFTA 1X9WA 5HRIA 9ICMA 5IIMA 5HREA 2ZH8A 2HHPA 3SD7A 4CNQA 2XO7A 3PX6A 9ICQA 1TFWA 3UMBA 2CPRA 1TK8A 3BDPA 4EENA 4KTQA 1ZD4A 3IG5A 4QWEA 1NJXA 4WC4A 4DSLA 2F77X 3IRUA 1KFDA 4R64A 2PFPA 1KBUA 1LKYA 2R8GA 1BPZA 1R8CA 9ICOA 2AJQA 2UVWA 8ICPA 3QYPA 3LYSA 4DLGA 4B9MA 4KLHA 2HVHA 2V9WA 1SV0C 3ZDCA 5HRGA 4XUSA 8ICOA 4DFPA 3AEVA 1RXVA 1L7OA 3KHHA 4WQLA 1SL0A 4O3PA 4TURA 5ALLA 1F0MA 2W03A 2CXYA 3KKAC 5KTQA 1J97A 4OJPA 1JMSA 3A0BU 3TARA 2R18A 3PSFA 2J6SA 4J9PA 3AQNA 5J2IA 8ICQA 4F71A 1ZQQA 2HBLA 2YMLA 4TUQA 2VA8A 1X66A 4EEKA 1S97A 4PPXA 4YXJA 1ZQ1C 2CN1A 1HEKA 3OGUA 1NKBA 4P4MA 1X40A 2RQ5A 5ALPA 4JMUA 5J0QA 1ZQIA 3RFAA 1UCVA 3Q8SB 4YCXA 4O3OA 4YMMA 4DFJA 4O68A 2UVVA 1ZQTA 4PHAA 4RUCA 5DB7A 1N62A 7ICIA 2ZG6A 3PW2A 2EZXA 9ICIA 3MC1A 4I2DA 5TZVA 1Z4NA 4RPXA 4DCCA 4HYKA 1O03A 1WUDA 2ASJA 4TQRA 4IQWA 4X0AA 2N1RA 3HJEA 3L9DA 3AL0B 4PZOA 5KT5A 3RAXA 4BX9C 4WOYA 4NY8A 4X4QA 3VC8A 1N63A 4M6WA 3T79A 3A0HU 4DO9A 3TI0A 1SV0A 2ZJ5A 5DG7A 2QB0B 2VJ5A 4RQMA 2PFOA 4WCWA 7ICTA 4Z6CA 7ICMA 2I9GA 1ZOLA 8ICKA 2DR7A 5DLGA 4X5VA 2IUBA 4F4ZA 5HC9A 1M6YA 2PFQA 4KX3A 3KKAA 2D6FC 3MR2A 2Q0ZX 4WC0A 4ECVA 3OTQA 3QNMA 2AXTU 1KLNA 3GIJA 2IBKA 5B3QA 5F9NA 4TQSA 4DOAA 5KFEA 2V4RA 2AH5A 2W9CA 5DB9A 1Z1VA 5J2AA 3KHGA 1L5UA 2VANA 4G3IA 2BDUA 7ICOA 5L1IA 2LHTA 2BR0A 4B9NA 4LT6A 4RWPA 3KOOA 1WG8A 3LK9A 4F93B 4I2AA 2G0AA 3MDCA 2YY6A 3THVA 3BS5B 2P35A 4B9LA 1ZQFA 5CJ7A 4F5PA 5KT4A 1JXLA 2C2DA 7ICSA 4XQ7A 1SWWA 3QUTA 5J2JA 2BQRA 4ATBB 1QCKA 3DDHA 5KT3A 4UB2A 5KFNA 4I2CA 2WTFA 3B9JA 2ZIUB 8ICJA 2GLEA 2FDRA 5CP2A 5AK4A 3PSPA 1RYRA 1NJZA 2JEFA 1FO4A 2FI1A 3RR8A 2B6GA 1WCLA 2AHOB 3SAFA 3RJJA 5AKIA 1CUKA 5G5GA 4NLNA 3MBYA 4MHVA 3N4MB 3WFRE 2WHEA 1R89A 4M47A 2XVTA 3WFQE 2ZIWB 3M9NB 1RG6A 1NZPA 2BQ3A 3LQCB 3WU2U 4BXOB 4B9UA 1SXEA 5IIKA 4I27A 1NK7A 2FCLA 1KW4A 4O67A 1V38A 3M7DA 4F72A 2JMGA 3UMCA 2KKVA 1ZQSA 2O6KA 1F5AA 4P0PB 4F92B 1T4GA 5CFSA 5AI9A 2K89A 5J2CA 5ALKA 3NVVA 7ICPA 2DR5A 3K7DA 2M2TA 1BVSA 1URJA 3N7RC 4J9OA 3G6XA 3WK6A 1A77A 4JV1A 4FHVA 2JXJA 2H5XA 5J2DA 4EX7A 2KNJA 4KB6A 1N60A 2B56A 4YG2A 2HOQA 1BPBA 3V7KA 3ZDBA 4M9GA 4IR1A 3H8WA 3F5AA 3T5HA 1KRPA 2KP7A 1XNSA 4ED3A 4ED7A 1ZQDA 5KL8B 4R8UB 2NO5A 4DSEA 2ZIVB 3TAPA 2JV3A 4AT9A 3RB6A 3GV7B 1ZJNA 1XO0A 2GWSA 5HMLA 4NXTA 2Y0SF 3IG8A 4ECTA 1S9FA 1JROA 2ESEA 7ICRA 2F1IA 4KLGA 3QXGA 8ICEA 1V97A 2FLPA 1S77D 1S0NA 4DWIA 2ZH4A 5CA7A 4FZLA 4YFKA 4NL9C 3SENA 3M6KA 2BCUA 1COOA 2VA2A 4EEDA 3ETRA 5D49A 4DS4A 5HRBA 1KNYA 1A6SA 3RAQA 3OJUA 4QZFA 3KZIU 2NRWA 4Y2VA 4BGDA 2RDIA 3FM9A 2JEIA 4AT8A 2BCSA 3RR7A 1LVHA 3F2CA 2K4HA 3H7IA 5EWEA 5AK5A 5J0XA 5J0YA 2YTUA 5DQHA 4DL3A 4CF5A 3IV6A 4NXZA 4JLXA 2A1JA 1JXEA 2DKZA 1H38A 5KG1A 2J6TA 3NGDA 1Q8KA 4C4TA 5L1MA 3BQ0A 2RFFA 1IM4A 2RHFA 3K1ZA 2ZTDA 4O3QA 3BQ1A 2F44A 2JEGA 1D8YA 2W9AA 4O69A 2HHSA 1QSSA 2FMQA 1UEVA 1HUOA 4C4SA 4DL4A 2NV3A 1X6JA 2HSZA 1PK3A 3NWIA 4OAFA 4RWQA 1DK3A 2HI0A 4NL9A 4F4KA 4USAA 9ICTA 4M9HA 3BZKA 3NVWA 4C8NA 4ED2A 2XY5A 1ZETA 3SAHA 3C28A 4P0QA 2ZH1A 2WF5A 3BQ2A 5H2FU 5HRHA 3JPSA 4G9BA 4C0ZA 9ICKA 5DGAA 3UMGA 4LZGA 1JQRA 2G08A 1D8LA 1Q78A 2HMXA 3AUOA 7ICEA 4C8LA 5ALUA 4DQPA 3UXOA 4DSIA 2JRZA 4M04A 2W9BB 1SWVA 1PVRA 1HUZA 2BPFA 2RLTA 5HR7A 4F4YA 4NKTA 3LVVA 5KFSA 5AKJA 2I1QA 2LYAA 5J0SA 1X9XA 4I2IA 4BWJA 2KFNA 4X4UA 2KMDA 4NM2A 2EANA 1N48A 4F91B 2XY6A 1S0MA 5KG2A 2KD1A 4XRHA 4FHXA 2F3NA 1LB2B 3N28A 3K4GA 4IQTA 3KHLA 1K1SA 2P6RA 2W04A 9ICLA 2WF7A 4Q45A 4O3NA 4QZHA 1L8LA 5J29A 4Z6EA 2JZBA 1AROP 4MEXA 3OVAA 3ZD9A 5J0PA 5AKHA 1ZQEA 2LM4A 5HMMA 4KLOA 4UAWA 1QTMA 4UAYA 3NVZA 5KG7A 1RYUA 2EZZA 4J9KA 4X4VA 2B4VA 2M0NA 5HRKA 3E0FA 4EGWA 5DB8A 5IILA 2KFZA 4EYIB 5EWFA 3AU2A 4LZDA 1QLNA 3T5JA 1S10A 4C8MA 4MKPA 1T3QA 4CF4A 1V85A 5A0LA 2WFAA 9ICNA 3HW8A 4K8VA 5EE9A 3I1YA 2DKXA 4K99A 3V6KA 5BPCA 3RJKA 1FFUA 2H3IA 5B66U 5D4BA 2RP5A 4FBTA 2PBEA 5F2VO 2GH1A 2IOHA 2G5HB 1KFTA 4GFJA 2DPJA 3UXNA 3PR5B 1DGJA 4WC5A 5DBCA 2KEYA 4Y2TA 4NLGA 2KV2A 4UB6U 3C5GA 3RBDA 4M5DA 1U9LA 3Q8RB 1KQQA 3PY8A 3N7PD 4EP7A 8ICVA 4EX6A 2KZMA 4GXKA 1A76A 1TVAA 5ALHA 2FJ6A 2P66A 2W7OA 3JPRA 4I2HA 1SV4A 5KT2A 1IXRA 3ETLA 4Y2UA 5AM1A 3F2BA 1L3SA 1NKEA 4K98A 2Y1JA 2G06A 2G09A 1N56A 3DV9A 1PX5A 2QLTA 5ALWA 3OSNA 2K8BB 4GC6A 2HHUA 3FDSA 1J2NA 3V72A 4Z6DA 4K96A 4NXWA 2KSOB 3TKAA 4ECSA 3RH6A 5J2KA 2ZUCA 3HWTA 3PO4A 2W9MA 4QZDA 9ICVA 4PZNA 3EPIA 4FO6A 2EH9A 4ED1A 7ICKA 4NKUA 4R66A 4EEBA 5HRFA 2MUTB 1ZQLA 2VIXA 5J2EA 2ZXHA 4UBBA 4GXIA 1MSWD 4OD0A 4CF3A 4F5OA 2QARA 2KVCA 1PVPA 5DBAA 4DQIA 2HHXA 3UPSA 3Q8KA 2W54A 3EW9A 3UQ0A 1F44A 3CP8A 4UASA 3QU7A 4YD1A 5D46A 5ALDA 3ER9B 1JALA 5C0YA 3HILA 3N97B 3V7JA 1B0XA 2DRBA 2JHDA 2AU0A 1T7PA 5HR9A 3HJ4A 4K4GA 4YR2A 2NRXA 3NASA 2NO4A 3GV8B 1N5WA 1NK5A 1TFYA 4RQ5A 4I2FA 3MR6A 4EBCA 2LKYA 3CYMA 1L3TA 2R8IA 5AKKA 2BPGA 4OCZA 3OHAA 1ECWA 1BNOA 2E8NA 7ICHA 3Q8QB 4O5EA 3WK8A 4WC7A 4EBKA 4RU9A 3PSIA 2XI9A 1JN3A 3I28A 4C7ZA 4WC2A 1Q46A 3PW5A 8ICWA 3WKBA 4YMOA 3MFIA 2C28A 5KFBA 4UB8U 5ALSA 2ZH5A 2KHQA 4KLJA 4DSKA 4QZAA 3Q8MA 1NK8A 2ZJ8A 4F2SA 4HAIA 1OW5A 4KLIA 4X4NA 2BKEA 1R8AA 3LDAA 3PZPA 4FH5A 4QJFB 2QB1A 3D2SA 2MAXA 5J0WA 1ZQOA 2O5AA 1PZNA 3L5KA 3GDXA 5CEHA 1K5OA 4ECWA 2ZJAA 4E8FA 2DGZA 3M6ZA 4MF2A 2UVRA 2XIDA 3EPGA 1TK0A 2XC9A 2BCVA 2K4IA 2CRXA 2LYBA 3RF9A 2E1FA 3UQ2A 4RQ7A 1T94A 4CRXA 4NXXA 4DF4A 3J81j 3AM9A 4NXUA 2JEJA 4J9MA 1D9DA 4NV0A 4NLBA 5KFWA 3KZXA 3AQKA 3QEAZ 2ES6A 3PW0A 2KN7A 4EZ9A 5AKYA 4ZOHC 4PHDA 3H4BA 3AN1A 1TK5A 3H0MB 4NXVA 2C22A 3GILA 2OEHA 4JLZA 1B43A 5DG8A 4KN4A 3OJSA 4O5KA 1WCNA 2JH7A 5KFCA 5ALOA 3JPTA 3HPOA 3JZ0A 2J6UA 7ICNA 5DLFA 4Y2JA 3QZ7A 5AKGA 2HBMA 3KFUF 3QU9A 3TFRA 4KLUA 4X4OA 4GXJA 2BBJA 2G5IB 4QZBA 2KVSA 2QB0A 4ELTA 4DFDA 4J9NA 3C29A 5T14A 4HX0A 4UBCA 4GC7A 2B0CA 1MN8A 1RM6C 1Z00B 3EZ5A 1S0VA 2PI4A 9ICPA 8ICCA 3C2MA 5CHGA 8ICZA 4UB1A 4BUGA 3NKUA 4AP9A 3M8SA 3AQEA 2FPMA 4UD4A 1NNLA 1ZJMA 1RQNA 1ZQKA 3H8JA 5IIIA 1CI4A 3JPQA 4OJLA 4DL5A 2KHVA 5TISU 5J0UA 2BPCA 1DK2A 2DVIA 3CNHA 4QZIA 2F1HA 2Q4TA 1ZD3A 5BOLA 4O3SA 3WK4A 2DWQA 1UPHA 1X6IA 2F76X 2F1JA 8ICBA 4IL6U 4RWOA 5L1KA 4QW9A 2ZH6A 2H3ZA 2V4QA 3BS5A 5CB1A 5AKZA 1UEUA 1VJ7A 1RPLA 4B9TA 1C20A 1F5SA 5ALIA 4ED6A 2ZH7A 1IIPA 1VFGA 5KG4A 4ATBA 3C5FA 1KFSA 1XWLA 5L1LA 3MCRA 4P4PA 4DOBA 4US9A 4EZ6A 2ZIUA 2OCEA 2KE7A 4FS1A 3DEEA 4WC3A 1YLQA 2MSNA 1B22A 1UA1A 4I2GA 4LEYA 4YXMA 4QZ9A 3C2KA 2ZHBA 2IMWP 1FA0A 5AI4A 3UM9A 2EWRA 4KX5A 4RUAA 4MFAA 2ZIWA 1GPJA 2ASLA 4DLEA 1K1QA 4QWCA 1HJPA 4F8RA 2GA9D 3LWLA 4PL1A 3N7SC 5KAFU 2DPIA 2BCRA 4BXOA 1ZQVA 4NLZA 3WKCA 5J0OA 4WJ3B 4GLXA 1WWVA 4UD5A 1RDFA 5KFQA 4AT7B 2YQEA 2AGPA 3MGHA 4NM1A 4P0PA 2QKQA 4UB5A 1S5LU 3C1YA 2GAFD 4F4XA 4IRDA 9ICGA 5J2HA 5KFZA 4QW8A 1QQ6A 4WBYA 5E79U 2XCPA 5ALQA 3CRXA 7ICVA 4UARA 3RH4A 3QEBZ 1JIHA 4RPZA 3MFHA 3Q8LA 1ZQUA 7ICJA 2C2RA 4R65A 1ZQXA 3PW4A 4QZCA 1O08A 3JPOA 4Q44A 2XY7A 4OJ6A 5DECA 1XSLA 2BZFA
chains in the Genus database with same CATH topology
2ISOA 5KTQA 3UXPA 5KG6A 2PFNA 4BDPA 5DG9A 3AU6A 1JMSA 3QZ8A 3TARA 5KG7A 3RJIA 5EOZA 2J6SA 4J9PA 3AQNA 4J9KA 5J2IA 8ICQA 1ZQQA 5DKWA 1X9MA 3ZD8A 1ZQMA 4TUQA 4X4VA 2VA8A 3GV5B 5HRLA 1S97A 1V4AA 4PPXA 4YXJA 1SKRA 4RQ6A 4NLKA 5HRKA 5DB8A 5IILA 2DRAA 2KFZA 4EYIB 3C18A 3OGUA 5EWFA 1Q79A 5KFDA 4R8UA 1NKBA 1ZQZA 3AU2A 1Y88A 4LZDA 1QLNA 3T5JA 1S10A 4C8MA 4P4MA 1NK0A 4DFMA 5J0QA 1ZQIA 3PO5A 4DF8A 9ICNA 1U47A 3HW8A 5J0TA 3Q8SB 4YCXA 5DGBA 3H40A 2PXIA 2FMSA 3HX0A 1T3NA 3NTUA 4O0IA 4R63A 4O3OA 4IRCA 8ICUA 4AT9B 4YMMA 3SZ2A 8ICTA 3V6KA 4DFJA 2Y1IA 2UVVA 3T3FA 1ZQTA 4PHAA 5BPCA 3RJKA 4J9QA 4RUCA 5DB7A 4J9LA 5JUMA 4O9MA 4X4PA 7ICIA 3PW2A 9ICIA 5D4BA 5F2VO 4FBTA 2PBEA 4I2DA 5TZVA 3ZDDA 2HHVA 2BHNA 3M9MB 4RPXA 1KFTA 2DPJA 3UXNA 4HYKA 4JV0A 3PR5B 2ASJA 4DSJA 1L3VA 4WC5A 4TQRA 4IQWA 3MR5A 7ICGA 4X0AA 5DBCA 3L9DA 1XS9D 4CCHA 4NLGA 5HHIA 5KT5A 1ZQGA 4DEZA 3C5GA 3PV8A 3RAXA 2NRTA 1MQ3A 4M9JA 4NY8A 4YQWA 3Q8PB 3RBDA 1RYSA 1ZQHA 2AQ0A 4M5DA 4X4QA 1U9LA 3Q8RB 3PY8A 4JV2A 4EP7A 4M6WA 3WFSC 1KTQA 2BCQA 5J2FA 4RQ1A 1NK6A 4PH5A 2VA3A 1XSPA 5KFAA 3LWMA 4DO9A 1ZQJA 4F3OA 8ICVA 5KFLA 1RXWA 4QWAA 4ZH4A 5CWRA 2ATLA 2ID1A 3H3AA 3TI0A 2KZMA 2ZJ5A 5DG7A 1TV9A 4GXKA 1A76A 2PFOA 1Z00A 3RJHA 2O1PA 4WCWA 4EBJA 7ICTA 1CEZA 1TVAA 4Z6CA 9ICJA 2P66A 4TURA 4I2HA 2P6UA 3JPRA 4EYHB 5KT2A 4E0DA 7ICMA 2I9GA 2M9NA 1IXRA 5KT6A 1RZTA 4IR9A 3ETLA 8ICKA 4KLFA 1TKDA 1L3SA 2DR7A 5DLGA 4X5VA 1XC9A 1NKEA 2ZH9A 4F4ZA 5HC9A 2PFQA 2Y1JA 2PI5A 3MR2A 2HHWA 4AT8B 1N56A 2Q0ZX 3SV3A 4K4IA 2AGQA 4WC0A 4ECVA 2W8LA 4RQ8A 4PGQA 5KFPA 1PX5A 4E7XA 3ISBA 3PMNA 1MIWA 3OSNA 1UETA 1S76D 4GC6A 1ZQNA 2HHUA 3ISDA 3FDSA 3TFSA 3C21A 3GIJA 1SL1A 1KLNA 2IBKA 3V72A 4Z6DA 1MC8A 8ICYA 5F9NA 4TQSA 4DOAA 4RQ2A 8ICAA 5KFEA 3HIYA 4F5QA 2V4RA 2ZUDA 4ECSA 3RH6A 2A1JB 2B21A 5J2KA 2W9CA 2ZUCA 4QZGA 3HWTA 4O5CA 3PO4A 2W9MA 1QSYA 5DB9A 3FYHA 5J2AA 4QZDA 2VANA 2XGPA 3KHGA 3G6YA 4ED0A 5L1IA 1L5UA 7ICOA 9ICVA 3EPIA 4FO6A 2BR0A 4C8KA 4RQ3A 4ED1A 4B9NA 4LT6A 4RWPA 7ICKA 3WFOA 4NKUA 4R66A 1NJWA 5HRFA 2MUTB 2OWOA 1ZQLA 3GIIA 4KLQA 5J2EA 4UBBA 4GXIA 3LK9A 4F93B 1ZQBA 5DDYA 4PHPA 4I2AA 2HW3A 1MSWD 3M8RA 2XGQA 4QWDA 3MDCA 4F5OA 2R8KA 3THVA 2ZH2A 5DBAA 3RB0A 4DQIA 2HHXA 3UPSA 4B9LA 3Q8KA 2RDJA 1ZQFA 5CJ7A 4UQGA 4F5PA 5KT4A 4I2JA 1JXLA 1ZQRA 4JWNA 3EW9A 3UQ0A 1KEJA 4P4OA 2C2DA 5EWGA 7ICSA 4XQ7A 1BGXT 5KFXA 3M9OB 2FMPA 9ICAA 5J2JA 2ZTCA 3MGIA 4YD1A 2BQRA 4ATBB 5CR0A 4QWBA 5D46A 3ZDEA 8ICIA 5KT3A 4UB2A 2BDPA 4KLDA 1TAQA 5KFNA 4I2CA 3N97B 3V7JA 3EWAA 4KN7A 3T5KA 3BJYA 2WTFA 4DL7A 4KLLA 3B0XA 9ICXA 2DRBA 1T7PA 2AU0A 1QTMA 7ICFA 5CP2A 8ICJA 2M2WA 5HR9A 4TUPA 3HJ4A 2DR9A 4K4GA 4YR2A 1RYRA 2NRXA 1NJZA 2JEFA 4S3NA 1BPEA 3GV8B 3RR8A 1MIYA 3PR4A 1NK5A 3OUYB 1TFYA 4PGXA 4RQ5A 1WCLA 2FPLA 3RJJA 4ELUA 3RRGA 4I2FA 2FLNA 3MR6A 4EBCA 3MDAA 1CUKA 5KT7A 5HP4A 1L3TA 2R8IA 4NLNA 3MBYA 4UAZA 1NJYA 2BPGA 4Q8FA 3OHAA 3N4MB 4K4HA 1BNOA 3WFRE 1R89A 3C1ZA 4M47A 7ICHA 5DB6A 3Q8QB 1MIVA 2FPKA 5HNKA 2W9BA 4I28A 4O5EA 4WC7A 3WFQE 3M9NB 4EBKA 2LYHA 4J9RA 2IHNA 9ICCA 1NZPA 8ICSA 2BQ3A 2M2UA 5DEDA 4RU9A 1X9SA 1NOMA 3LQCB 4UB4A 4RT2A 4KITB 4JWMA 1JN3A 1LV5A 1JAJA 4BXOB 4B9UA 1SZPA 4WC2A 4AT7A 4MFCA 4KLSA 4Z6FA 5IIKA 3PW5A 4RQ0A 3T5LA 1NK7A 1EXNA 4I27A 8ICWA 4E80A 4DQQA 5L9XA 4YMOA 3H39A 3MFIA 2C28A 5KFBA 1U49A 2ZH5A 3V7LA 4RNOA 3RB4A 2BQUA 1ZQSA 9ICRA 1F5AA 4KLJA 4YN4A 4F92B 3C2LA 4DSKA 4QZAA 3Q8MA 1T4GA 2ZJ8A 5KFFA 1NK8A 4F2SA 3RJFA 4X4TA 4MEYA 1BNPA 5J2CA 3G6VA 4KLIA 4DS5A 4X4NA 3MR3A 1UA0A 2UVUA 1U45A 4M9NA 2BKEA 7ICPA 2ZH3A 1R8AA 1L3UA 1WOTA 2DR5A 4KMUA 3LDAA 3PMLA 2M2TA 2IHMA 3TANA 3V6JA 1BVSA 4FH5A 4IG8A 2JZBB 4RPYA 2MAXA 5J0WA 4J9OA 3G6XA 1ZQOA 4I2BA 7ICUA 3C66A 2O5AA 1PZNA 2KZZA 3GDXA 5J0RA 1A77A 4JV1A 4ECWA 2ZJAA 1JX4A 4FHVA 4E8FA 1XSLA 2R8JA 4MF8A 4P2HA 2H5XA 5J2DA 5KFHA 2DFLA 1XSNA 4F4WA 4DFKA 4RZRA 4MF2A 2UVRA 1D9FA 4UB3A 3EPGA 3RRHA 2NRZA 1TK0A 2XC9A 3K75D 2BCVA 3PW7A 4X4RA 4YG2A 3HT3A 3QE9Y 1NK4A 1BPBA 3V7KA 3UQ2A 3ZDBA 4M9GA 4XQ8A 4O5KA 3E2EA 4RQ7A 4J9SA 3AQLA 3PX0A 1KDHA 3H8WA 4IR1A 1ZQYA 3T5HA 2C2EA 1KRPA 8ICGA 2ASDA 2KP7A 5BOMA 4ED3A 4DF4A 4YVZA 3UPQA 4ED7A 9ICHA 1ZQDA 3JPNA 2JEJA 2ISPA 3IHQB 4J9MA 4R8UB 4ECXA 1D9DA 4DSEA 3TAPA 7ICQA 5KFWA 2AGOA 4AT9A 3AQKA 3RB6A 3QEAZ 3GV7B 3H8SA 1ZJNA 1ZQPA 1KSPA 1XU4A 3BQTA 5HMLA 4YP3A 2GWSA 4ECQA 2KN7A 3PW0A 4O3RA 4EZ9A 1C7YA 3OSPA 5J2GA 1SL2A 3PX4A 2ZUBA 4PHDA 3H4BA 4ECTA 1TK5A 1S9FA 7ICRA 8ICLA 5DQGA 2F1IA 1UT5A 4IQUA 3RTVA 2C22A 3GILA 4TUSA 4KLGA 1SKSA 4EBDA 8ICEA 1NKCA 3OVSA 1B43A 4XA5A 4KN4A 5DG8A 3OJSA 4ECYA 4ED8A 1WCNA 3B0YA 2FLPA 1QSLA 4PGYA 3ISCA 5KFCA 3JPTA 3HPOA 1S0NA 1S77D 3JZ0A 4MFFA 1SKWA 4DWIA 2J6UA 7ICNA 9ICEA 5CA7A 2ZH4A 5DLFA 2FLLA 5KG5A 4YFKA 4RT3A 3QZ7A 9ICSA 5DDMA 3RBEA 3H37A 4X4SA 4KLUA 2KZ3A 3TFRA 1BPYA 4RQ4A 4GXJA 1UT8A 9ICBA 2BCUA 4X4OA 4F5NA 1COOA 5IIOA 3GIKA 4FH3A 4QZBA 3GFKB 2VA2A 1XO1A 4YR3A 4ELTA 4RWNA 1DGSA 3PNCA 1DOQA 4M6WB 5IIJA 4J9NA 5IINA 4DOCA 5D49A 4DS4A 4UBCA 4G3IA 3ORYA 4GC7A 5HRBA 3TQ1A 1KNYA 3RAQA 3OJUA 1Z00B 3EZ5A 4QZFA 1S0VA 2ZHAA 2NRWA 4QZEA 2PI4A 8ICCA 9ICPA 3C2MA 4ECUA 4BGDA 5CHGA 8ICZA 4UB1A 2RDIA 2JEIA 4AT8A 4QZ8A 5KG0A 4F2RA 1ZQAA 3TAQA 2BCSA 4M0AA 3GQCA 4DQSA 3M8SA 4PHEA 3RR7A 3JYYA 4DL2A 7ICLA 2FPMA 4UD4A 1Z3EB 4B9VA 3H7IA 1ZJMA 5EWEA 3KTQA 5J0XA 2DR8A 4Q43A 4F5RA 1ZQKA 5KFMA 3H8JA 5J0YA 5IIIA 5DQHA 3JPQA 4DL3A 1X2IA 4JUZA 2HHQA 4NXZA 4DL5A 2A1JA 1S0OA 3V6HA 1JXEA 3HP6A 5J0UA 2Q66A 2BPCA 1DK2A 2DVIA 3MABA 2XCAA 4IRKA 4QZIA 1H38A 4IQVA 2F1HA 8ICHA 9ICWA 4WC6A 1BPDA 2R8HA 5KG1A 4ECZA 2J6TA 3NGDA 2W9CB 4FS2A 3HJ1A 3BQ0A 3PVXA 4O3SA 5BOLA 1IM4A 2NRKA 2RFFA 2MUTA 3RJEA 2BGWA 5KFGA 4DSFA 2NRVA 3AQMA 5HRDA 2ZTDA 4O3QA 2F1JA 3BQ1A 8ICBA 3H38A 5KFIA 4I2EA 2ZTEA 3H4DA 4RWOA 5L1KA 4QW9A 2JEGA 8ICXA 4FBUA 1MQ2A 1D8YA 2ZH6A 2V4QA 5CB1A 1UEUA 3OV7A 5KG3A 1NK9A 1RPLA 2W9AA 2M2VA 1VJ7A 8ICNA 9ICUA 4LVSA 4M2YA 2HHSA 1QSSA 2FMQA 4B9TA 1TAUA 4C8OA 1UEVA 4ED6A 4Q8EA 1ZYQA 2ZH7A 5J2BA 3GIMA 1VFGA 1HUOA 5KG4A 1ZQCA 5KFOA 2HHTA 4ATBA 3C5FA 4DL4A 2AQ4A 1KFSA 1XWLA 8ICFA 5L1LA 4P4PA 4I29A 5F9LA 2IA6A 4DOBA 4EZ6A 3SI8A 5KFVA 3NYBA 4YMNA 3SYZA 4FS1A 2ALZA 3IM1A 5C5JA 4ECRA 4RWQA 1DK3A 4F4KA 9ICTA 1OU5A 4X0BA 4WC3A 1YLQA 3OHBA 3JPPA 4EEYA 3RJGA 4M9HA 4C8NA 4ED2A 4WBZA 3OUYA 2XY5A 1U48A 1ZETA 1B22A 2HVIA 1TFRA 3C23A 3BQ2A 2ZH1A 1NO5A 5HRHA 3JPSA 1UA1A 5KFYA 4I2GA 4KLMA 9ICKA 4WC1A 5DGAA 5KFRA 4EBEA 4YXMA 4BWMA 4QZ9A 3RB3A 4LZGA 1JQRA 1D8LA 3C2KA 2IMWP 1ZQWA 4YR0A 8ICRA 1FA0A 3WFPA 2ZHBA 4ELVA 1Q78A 3AUOA 7ICEA 2W8KA 3EYZA 4FHWA 4C8LA 4RUAA 5KFTA 4MFAA 4JK1A 1X9WA 2ASLA 4DLEA 4B9SA 1K1QA 4DQPA 9ICMA 3UXOA 5IIMA 5HREA 5HRIA 2HHPA 4DSIA 2ZH8A 1T8EA 4QWCA 1HJPA 2XO7A 4F8RA 4M04A 2W9BB 4KLTA 3PX6A 9ICFA 3LWLA 9ICQA 4FHPA 2DPIA 2BCRA 1HUZA 4BXOA 1TFWA 3RH5A 1ZQVA 2BPFA 5DQIA 1TK8A 3BDPA 4NLZA 1BPXA 3KHRA 5L1JA 4F4YA 5KFJA 4KTQA 4KLEA 4NKTA 5KFSA 5J0OA 4DQRA 4RNNA 4GLXA 4QWEA 1NJXA 2BE3A 2I1QA 5J0SA 4UD5A 4I2IA 5KFQA 4AT7B 4WC4A 4BWJA 4DSLA 2KFNA 1R8BA 4X4UA 2AGPA 4NM2A 3MGHA 1N48A 4NM1A 4UB5A 1KFDA 5HHHA 4R64A 3OVBA 3C1YA 4F91B 2PFPA 2XY6A 1S0MA 5KG2A 2R8GA 4F4XA 4XRHA 5DBBA 4FHXA 3SV4A 1LB2B 4IRDA 1BPZA 9ICGA 1R8CA 5J2HA 3K4GA 9ICOA 2AJQA 2UVWA 8ICPA 5KFZA 4IQTA 3KHLA 1U4BA 4RNMA 4FHYA 1K1SA 4QW8A 2P6RA 4DLGA 4B9MA 4KLHA 4WBYA 4YD2A 4M9LA 9ICLA 4Q45A 4O3NA 2XCPA 4QZHA 8ICMA 7ICVA 3ZDAA 2HVHA 2V9WA 5J29A 4Z6EA 2JZBA 2KTQA 1AROP 3RH4A 1V9PA 4MEXA 3ZDCA 5HRGA 4XUSA 3QEBZ 3OVAA 1JIHA 4F50A 8ICOA 4RPZA 3ZD9A 3MFHA 3Q8LA 1ZQUA 7ICJA 5J0PA 2C2RA 4R65A 1ZQXA 4DFPA 3PW4A 1ZQEA 1RXVA 5HMMA 4QZCA 5KFUA 4KLOA 3KHHA 3JPOA 4Q44A 4DL6A 2XY7A 1SL0A 5KFKA 4O3PA 4UAWA 5DECA 4UAYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ISO A;  5KTQ A;  3UXP A;  5KG6 A;  2PFN A;  4BDP A;  5DG9 A;  3AU6 A;  1JMS A;  3QZ8 A;  3TAR A;  5KG7 A;  3RJI A;  5EOZ A;  2J6S A;  4J9P A;  3AQN A;  4J9K A;  5J2I A;  8ICQ A;  1ZQQ A;  5DKW A;  1X9M A;  3ZD8 A;  1ZQM A;  4TUQ A;  4X4V A;  2VA8 A;  3GV5 B;  5HRL A;  1S97 A;  1V4A A;  4PPX A;  4YXJ A;  1SKR A;  4RQ6 A;  4NLK A;  5HRK A;  5DB8 A;  5IIL A;  2DRA A;  2KFZ A;  4EYI B;  3C18 A;  3OGU A;  5EWF A;  1Q79 A;  5KFD A;  4R8U A;  1NKB A;  1ZQZ A;  3AU2 A;  1Y88 A;  4LZD A;  1QLN A;  3T5J A;  1S10 A;  4C8M A;  4P4M A;  1NK0 A;  4DFM A;  5J0Q A;  1ZQI A;  3PO5 A;  4DF8 A;  9ICN A;  1U47 A;  3HW8 A;  5J0T A;  3Q8S B;  4YCX A;  5DGB A;  3H40 A;  2PXI A;  2FMS A;  3HX0 A;  1T3N A;  3NTU A;  4O0I A;  4R63 A;  4O3O A;  4IRC A;  8ICU A;  4AT9 B;  4YMM A;  3SZ2 A;  8ICT A;  3V6K A;  4DFJ A;  2Y1I A;  2UVV A;  3T3F A;  1ZQT A;  4PHA A;  5BPC A;  3RJK A;  4J9Q A;  4RUC A;  5DB7 A;  4J9L A;  5JUM A;  4O9M A;  4X4P A;  7ICI A;  3PW2 A;  9ICI A;  5D4B A;  5F2V O;  4FBT A;  2PBE A;  4I2D A;  5TZV A;  3ZDD A;  2HHV A;  2BHN A;  3M9M B;  4RPX A;  1KFT A;  2DPJ A;  3UXN A;  4HYK A;  4JV0 A;  3PR5 B;  2ASJ A;  4DSJ A;  1L3V A;  4WC5 A;  4TQR A;  4IQW A;  3MR5 A;  7ICG A;  4X0A A;  5DBC A;  3L9D A;  1XS9 D;  4CCH A;  4NLG A;  5HHI A;  5KT5 A;  1ZQG A;  4DEZ A;  3C5G A;  3PV8 A;  3RAX A;  2NRT A;  1MQ3 A;  4M9J A;  4NY8 A;  4YQW A;  3Q8P B;  3RBD A;  1RYS A;  1ZQH A;  2AQ0 A;  4M5D A;  4X4Q A;  1U9L A;  3Q8R B;  3PY8 A;  4JV2 A;  4EP7 A;  4M6W A;  3WFS C;  1KTQ A;  2BCQ A;  5J2F A;  4RQ1 A;  1NK6 A;  4PH5 A;  2VA3 A;  1XSP A;  5KFA A;  3LWM A;  4DO9 A;  1ZQJ A;  4F3O A;  8ICV A;  5KFL A;  1RXW A;  4QWA A;  4ZH4 A;  5CWR A;  2ATL A;  2ID1 A;  3H3A A;  3TI0 A;  2KZM A;  2ZJ5 A;  5DG7 A;  1TV9 A;  4GXK A;  1A76 A;  2PFO A;  1Z00 A;  3RJH A;  2O1P A;  4WCW A;  4EBJ A;  7ICT A;  1CEZ A;  1TVA A;  4Z6C A;  9ICJ A;  2P66 A;  4TUR A;  4I2H A;  2P6U A;  3JPR A;  4EYH B;  5KT2 A;  4E0D A;  7ICM A;  2I9G A;  2M9N A;  1IXR A;  5KT6 A;  1RZT A;  4IR9 A;  3ETL A;  8ICK A;  4KLF A;  1TKD A;  1L3S A;  2DR7 A;  5DLG A;  4X5V A;  1XC9 A;  1NKE A;  2ZH9 A;  4F4Z A;  5HC9 A;  2PFQ A;  2Y1J A;  2PI5 A;  3MR2 A;  2HHW A;  4AT8 B;  1N56 A;  2Q0Z X;  3SV3 A;  4K4I A;  2AGQ A;  4WC0 A;  4ECV A;  2W8L A;  4RQ8 A;  4PGQ A;  5KFP A;  1PX5 A;  4E7X A;  3ISB A;  3PMN A;  1MIW A;  3OSN A;  1UET A;  1S76 D;  4GC6 A;  1ZQN A;  2HHU A;  3ISD A;  3FDS A;  3TFS A;  3C21 A;  3GIJ A;  1SL1 A;  1KLN A;  2IBK A;  3V72 A;  4Z6D A;  1MC8 A;  8ICY A;  5F9N A;  4TQS A;  4DOA A;  4RQ2 A;  8ICA A;  5KFE A;  3HIY A;  4F5Q A;  2V4R A;  2ZUD A;  4ECS A;  3RH6 A;  2A1J B;  2B21 A;  5J2K A;  2W9C A;  2ZUC A;  4QZG A;  3HWT A;  4O5C A;  3PO4 A;  2W9M A;  1QSY A;  5DB9 A;  3FYH A;  5J2A A;  4QZD A;  2VAN A;  2XGP A;  3KHG A;  3G6Y A;  4ED0 A;  5L1I A;  1L5U A;  7ICO A;  9ICV A;  3EPI A;  4FO6 A;  2BR0 A;  4C8K A;  4RQ3 A;  4ED1 A;  4B9N A;  4LT6 A;  4RWP A;  7ICK A;  3WFO A;  4NKU A;  4R66 A;  1NJW A;  5HRF A;  2MUT B;  2OWO A;  1ZQL A;  3GII A;  4KLQ A;  5J2E A;  4UBB A;  4GXI A;  3LK9 A;  4F93 B;  1ZQB A;  5DDY A;  4PHP A;  4I2A A;  2HW3 A;  1MSW D;  3M8R A;  2XGQ A;  4QWD A;  3MDC A;  4F5O A;  2R8K A;  3THV A;  2ZH2 A;  5DBA A;  3RB0 A;  4DQI A;  2HHX A;  3UPS A;  4B9L A;  3Q8K A;  2RDJ A;  1ZQF A;  5CJ7 A;  4UQG A;  4F5P A;  5KT4 A;  4I2J A;  1JXL A;  1ZQR A;  4JWN A;  3EW9 A;  3UQ0 A;  1KEJ A;  4P4O A;  2C2D A;  5EWG A;  7ICS A;  4XQ7 A;  1BGX T;  5KFX A;  3M9O B;  2FMP A;  9ICA A;  5J2J A;  2ZTC A;  3MGI A;  4YD1 A;  2BQR A;  4ATB B;  5CR0 A;  4QWB A;  5D46 A;  3ZDE A;  8ICI A;  5KT3 A;  4UB2 A;  2BDP A;  4KLD A;  1TAQ A;  5KFN A;  4I2C A;  3N97 B;  3V7J A;  3EWA A;  4KN7 A;  3T5K A;  3BJY A;  2WTF A;  4DL7 A;  4KLL A;  3B0X A;  9ICX A;  2DRB A;  1T7P A;  2AU0 A;  1QTM A;  7ICF A;  5CP2 A;  8ICJ A;  2M2W A;  5HR9 A;  4TUP A;  3HJ4 A;  2DR9 A;  4K4G A;  4YR2 A;  1RYR A;  2NRX A;  1NJZ A;  2JEF A;  4S3N A;  1BPE A;  3GV8 B;  3RR8 A;  1MIY A;  3PR4 A;  1NK5 A;  3OUY B;  1TFY A;  4PGX A;  4RQ5 A;  1WCL A;  2FPL A;  3RJJ A;  4ELU A;  3RRG A;  4I2F A;  2FLN A;  3MR6 A;  4EBC A;  3MDA A;  1CUK A;  5KT7 A;  5HP4 A;  1L3T A;  2R8I A;  4NLN A;  3MBY A;  4UAZ A;  1NJY A;  2BPG A;  4Q8F A;  3OHA A;  3N4M B;  4K4H A;  1BNO A;  3WFR E;  1R89 A;  3C1Z A;  4M47 A;  7ICH A;  5DB6 A;  3Q8Q B;  1MIV A;  2FPK A;  5HNK A;  2W9B A;  4I28 A;  4O5E A;  4WC7 A;  3WFQ E;  3M9N B;  4EBK A;  2LYH A;  4J9R A;  2IHN A;  9ICC A;  1NZP A;  8ICS A;  2BQ3 A;  2M2U A;  5DED A;  4RU9 A;  1X9S A;  1NOM A;  3LQC B;  4UB4 A;  4RT2 A;  4KIT B;  4JWM A;  1JN3 A;  1LV5 A;  1JAJ A;  4BXO B;  4B9U A;  1SZP A;  4WC2 A;  4AT7 A;  4MFC A;  4KLS A;  4Z6F A;  5IIK A;  3PW5 A;  4RQ0 A;  3T5L A;  1NK7 A;  1EXN A;  4I27 A;  8ICW A;  4E80 A;  4DQQ A;  5L9X A;  4YMO A;  3H39 A;  3MFI A;  2C28 A;  5KFB A;  1U49 A;  2ZH5 A;  3V7L A;  4RNO A;  3RB4 A;  2BQU A;  1ZQS A;  9ICR A;  1F5A A;  4KLJ A;  4YN4 A;  4F92 B;  3C2L A;  4DSK A;  4QZA A;  3Q8M A;  1T4G A;  2ZJ8 A;  5KFF A;  1NK8 A;  4F2S A;  3RJF A;  4X4T A;  4MEY A;  1BNP A;  5J2C A;  3G6V A;  4KLI A;  4DS5 A;  4X4N A;  3MR3 A;  1UA0 A;  2UVU A;  1U45 A;  4M9N A;  2BKE A;  7ICP A;  2ZH3 A;  1R8A A;  1L3U A;  1WOT A;  2DR5 A;  4KMU A;  3LDA A;  3PML A;  2M2T A;  2IHM A;  3TAN A;  3V6J A;  1BVS A;  4FH5 A;  4IG8 A;  2JZB B;  4RPY A;  2MAX A;  5J0W A;  4J9O A;  3G6X A;  1ZQO A;  4I2B A;  7ICU A;  3C66 A;  2O5A A;  1PZN A;  2KZZ A;  3GDX A;  5J0R A;  1A77 A;  4JV1 A;  4ECW A;  2ZJA A;  1JX4 A;  4FHV A;  4E8F A;  1XSL A;  2R8J A;  4MF8 A;  4P2H A;  2H5X A;  5J2D A;  5KFH A;  2DFL A;  1XSN A;  4F4W A;  4DFK A;  4RZR A;  4MF2 A;  2UVR A;  1D9F A;  4UB3 A;  3EPG A;  3RRH A;  2NRZ A;  1TK0 A;  2XC9 A;  3K75 D;  2BCV A;  3PW7 A;  4X4R A;  4YG2 A;  3HT3 A;  3QE9 Y;  1NK4 A;  1BPB A;  3V7K A;  3UQ2 A;  3ZDB A;  4M9G A;  4XQ8 A;  4O5K A;  3E2E A;  4RQ7 A;  4J9S A;  3AQL A;  3PX0 A;  1KDH A;  3H8W A;  4IR1 A;  1ZQY A;  3T5H A;  2C2E A;  1KRP A;  8ICG A;  2ASD A;  2KP7 A;  5BOM A;  4ED3 A;  4DF4 A;  4YVZ A;  3UPQ A;  4ED7 A;  9ICH A;  1ZQD A;  3JPN A;  2JEJ A;  2ISP A;  3IHQ B;  4J9M A;  4R8U B;  4ECX A;  1D9D A;  4DSE A;  3TAP A;  7ICQ A;  5KFW A;  2AGO A;  4AT9 A;  3AQK A;  3RB6 A;  3QEA Z;  3GV7 B;  3H8S A;  1ZJN A;  1ZQP A;  1KSP A;  1XU4 A;  3BQT A;  5HML A;  4YP3 A;  2GWS A;  4ECQ A;  2KN7 A;  3PW0 A;  4O3R A;  4EZ9 A;  1C7Y A;  3OSP A;  5J2G A;  1SL2 A;  3PX4 A;  2ZUB A;  4PHD A;  3H4B A;  4ECT A;  1TK5 A;  1S9F A;  7ICR A;  8ICL A;  5DQG A;  2F1I A;  1UT5 A;  4IQU A;  3RTV A;  2C22 A;  3GIL A;  4TUS A;  4KLG A;  1SKS A;  4EBD A;  8ICE A;  1NKC A;  3OVS A;  1B43 A;  4XA5 A;  4KN4 A;  5DG8 A;  3OJS A;  4ECY A;  4ED8 A;  1WCN A;  3B0Y A;  2FLP A;  1QSL A;  4PGY A;  3ISC A;  5KFC A;  3JPT A;  3HPO A;  1S0N A;  1S77 D;  3JZ0 A;  4MFF A;  1SKW A;  4DWI A;  2J6U A;  7ICN A;  9ICE A;  5CA7 A;  2ZH4 A;  5DLF A;  2FLL A;  5KG5 A;  4YFK A;  4RT3 A;  3QZ7 A;  9ICS A;  5DDM A;  3RBE A;  3H37 A;  4X4S A;  4KLU A;  2KZ3 A;  3TFR A;  1BPY A;  4RQ4 A;  4GXJ A;  1UT8 A;  9ICB A;  2BCU A;  4X4O A;  4F5N A;  1COO A;  5IIO A;  3GIK A;  4FH3 A;  4QZB A;  3GFK B;  2VA2 A;  1XO1 A;  4YR3 A;  4ELT A;  4RWN A;  1DGS A;  3PNC A;  1DOQ A;  4M6W B;  5IIJ A;  4J9N A;  5IIN A;  4DOC A;  5D49 A;  4DS4 A;  4UBC A;  4G3I A;  3ORY A;  4GC7 A;  5HRB A;  3TQ1 A;  1KNY A;  3RAQ A;  3OJU A;  1Z00 B;  3EZ5 A;  4QZF A;  1S0V A;  2ZHA A;  2NRW A;  4QZE A;  2PI4 A;  8ICC A;  9ICP A;  3C2M A;  4ECU A;  4BGD A;  5CHG A;  8ICZ A;  4UB1 A;  2RDI A;  2JEI A;  4AT8 A;  4QZ8 A;  5KG0 A;  4F2R A;  1ZQA A;  3TAQ A;  2BCS A;  4M0A A;  3GQC A;  4DQS A;  3M8S A;  4PHE A;  3RR7 A;  3JYY A;  4DL2 A;  7ICL A;  2FPM A;  4UD4 A;  1Z3E B;  4B9V A;  3H7I A;  1ZJM A;  5EWE A;  3KTQ A;  5J0X A;  2DR8 A;  4Q43 A;  4F5R A;  1ZQK A;  5KFM A;  3H8J A;  5J0Y A;  5III A;  5DQH A;  3JPQ A;  4DL3 A;  1X2I A;  4JUZ A;  2HHQ A;  4NXZ A;  4DL5 A;  2A1J A;  1S0O A;  3V6H A;  1JXE A;  3HP6 A;  5J0U A;  2Q66 A;  2BPC A;  1DK2 A;  2DVI A;  3MAB A;  2XCA A;  4IRK A;  4QZI A;  1H38 A;  4IQV A;  2F1H A;  8ICH A;  9ICW A;  4WC6 A;  1BPD A;  2R8H A;  5KG1 A;  4ECZ A;  2J6T A;  3NGD A;  2W9C B;  4FS2 A;  3HJ1 A;  3BQ0 A;  3PVX A;  4O3S A;  5BOL A;  1IM4 A;  2NRK A;  2RFF A;  2MUT A;  3RJE A;  2BGW A;  5KFG A;  4DSF A;  2NRV A;  3AQM A;  5HRD A;  2ZTD A;  4O3Q A;  2F1J A;  3BQ1 A;  8ICB A;  3H38 A;  5KFI A;  4I2E A;  2ZTE A;  3H4D A;  4RWO A;  5L1K A;  4QW9 A;  2JEG A;  8ICX A;  4FBU A;  1MQ2 A;  1D8Y A;  2ZH6 A;  2V4Q A;  5CB1 A;  1UEU A;  3OV7 A;  5KG3 A;  1NK9 A;  1RPL A;  2W9A A;  2M2V A;  1VJ7 A;  8ICN A;  9ICU A;  4LVS A;  4M2Y A;  2HHS A;  1QSS A;  2FMQ A;  4B9T A;  1TAU A;  4C8O A;  1UEV A;  4ED6 A;  4Q8E A;  1ZYQ A;  2ZH7 A;  5J2B A;  3GIM A;  1VFG A;  1HUO A;  5KG4 A;  1ZQC A;  5KFO A;  2HHT A;  4ATB A;  3C5F A;  4DL4 A;  2AQ4 A;  1KFS A;  1XWL A;  8ICF A;  5L1L A;  4P4P A;  4I29 A;  5F9L A;  2IA6 A;  4DOB A;  4EZ6 A;  3SI8 A;  5KFV A;  3NYB A;  4YMN A;  3SYZ A;  4FS1 A;  2ALZ A;  3IM1 A;  5C5J A;  4ECR A;  4RWQ A;  1DK3 A;  4F4K A;  9ICT A;  1OU5 A;  4X0B A;  4WC3 A;  1YLQ A;  3OHB A;  3JPP A;  4EEY A;  3RJG A;  4M9H A;  4C8N A;  4ED2 A;  4WBZ A;  3OUY A;  2XY5 A;  1U48 A;  1ZET A;  1B22 A;  2HVI A;  1TFR A;  3C23 A;  3BQ2 A;  2ZH1 A;  1NO5 A;  5HRH A;  3JPS A;  1UA1 A;  5KFY A;  4I2G A;  4KLM A;  9ICK A;  4WC1 A;  5DGA A;  5KFR A;  4EBE A;  4YXM A;  4BWM A;  4QZ9 A;  3RB3 A;  4LZG A;  1JQR A;  1D8L A;  3C2K A;  2IMW P;  1ZQW A;  4YR0 A;  8ICR A;  1FA0 A;  3WFP A;  2ZHB A;  4ELV A;  1Q78 A;  3AUO A;  7ICE A;  2W8K A;  3EYZ A;  4FHW A;  4C8L A;  4RUA A;  5KFT A;  4MFA A;  4JK1 A;  1X9W A;  2ASL A;  4DLE A;  4B9S A;  1K1Q A;  4DQP A;  9ICM A;  3UXO A;  5IIM A;  5HRE A;  5HRI A;  2HHP A;  4DSI A;  2ZH8 A;  1T8E A;  4QWC A;  1HJP A;  2XO7 A;  4F8R A;  4M04 A;  2W9B B;  4KLT A;  3PX6 A;  9ICF A;  3LWL A;  9ICQ A;  4FHP A;  2DPI A;  2BCR A;  1HUZ A;  4BXO A;  1TFW A;  3RH5 A;  1ZQV A;  2BPF A;  5DQI A;  1TK8 A;  3BDP A;  4NLZ A;  1BPX A;  3KHR A;  5L1J A;  4F4Y A;  5KFJ A;  4KTQ A;  4KLE A;  4NKT A;  5KFS A;  5J0O A;  4DQR A;  4RNN A;  4GLX A;  4QWE A;  1NJX A;  2BE3 A;  2I1Q A;  5J0S A;  4UD5 A;  4I2I A;  5KFQ A;  4AT7 B;  4WC4 A;  4BWJ A;  4DSL A;  2KFN A;  1R8B A;  4X4U A;  2AGP A;  4NM2 A;  3MGH A;  1N48 A;  4NM1 A;  4UB5 A;  1KFD A;  5HHH A;  4R64 A;  3OVB A;  3C1Y A;  4F91 B;  2PFP A;  2XY6 A;  1S0M A;  5KG2 A;  2R8G A;  4F4X A;  4XRH A;  5DBB A;  4FHX A;  3SV4 A;  1LB2 B;  4IRD A;  1BPZ A;  9ICG A;  1R8C A;  5J2H A;  3K4G A;  9ICO A;  2AJQ A;  2UVW A;  8ICP A;  5KFZ A;  4IQT A;  3KHL A;  1U4B A;  4RNM A;  4FHY A;  1K1S A;  4QW8 A;  2P6R A;  4DLG A;  4B9M A;  4KLH A;  4WBY A;  4YD2 A;  4M9L A;  9ICL A;  4Q45 A;  4O3N A;  2XCP A;  4QZH A;  8ICM A;  7ICV A;  3ZDA A;  2HVH A;  2V9W A;  5J29 A;  4Z6E A;  2JZB A;  2KTQ A;  1ARO P;  3RH4 A;  1V9P A;  4MEX A;  3ZDC A;  5HRG A;  4XUS A;  3QEB Z;  3OVA A;  1JIH A;  4F50 A;  8ICO A;  4RPZ A;  3ZD9 A;  3MFH A;  3Q8L A;  1ZQU A;  7ICJ A;  5J0P A;  2C2R A;  4R65 A;  1ZQX A;  4DFP A;  3PW4 A;  1ZQE A;  1RXV A;  5HMM A;  4QZC A;  5KFU A;  4KLO A;  3KHH A;  3JPO A;  4Q44 A;  4DL6 A;  2XY7 A;  1SL0 A;  5KFK A;  4O3P A;  4UAW A;  5DEC A;  4UAY A; 
#chains in the Genus database with same CATH topology
 2ISO A;  4UAV A;  5KG6 A;  5DG9 A;  3AU6 A;  3QZ8 A;  3WK9 A;  5EOZ A;  4NWI A;  1X9M A;  3ZD8 A;  1ZQM A;  3GV5 B;  1GO3 F;  5HRL A;  3L4P A;  1V4A A;  1SKR A;  4RQ6 A;  4NLK A;  1L7P A;  2EDU A;  2DRA A;  2DL0 A;  1Q79 A;  2D8C A;  5KFD A;  4R8U A;  2D3D A;  2ZIV A;  1VLB A;  1Q3V A;  1ED1 A;  4NJ8 A;  4DFM A;  1TAM A;  3H40 A;  5K4L A;  5AM3 A;  1COK A;  3NTU A;  4R63 A;  8ICU A;  4WQK A;  2Y1I A;  2DF4 B;  3T3F A;  4J9L A;  4X4P A;  4U6P A;  1L7M A;  2HHV A;  4JB3 A;  3WKE A;  1IG6 A;  4LEV A;  3MR5 A;  1XS9 D;  4CCH A;  4OAG A;  1VDV A;  3SR6 A;  3NRZ A;  3PV8 A;  5AM5 A;  1MQ3 A;  4YQW A;  1ZQH A;  1PUZ A;  4FO1 A;  3WFS C;  2BCQ A;  4RQ1 A;  1NK6 A;  2VA3 A;  4PH5 A;  3LWM A;  1ZQJ A;  4F3O A;  1RXW A;  4QWA A;  4ZH4 A;  5CWR A;  2ATL A;  2ID1 A;  3H3A A;  3F2D A;  3RJH A;  4EBJ A;  2O1P A;  5JRT A;  2M9N A;  4KLF A;  1JRP A;  5KL1 B;  2JR5 A;  3QUC A;  2PI5 A;  3SV3 A;  4K4I A;  2AGQ A;  2W8L A;  4RQ8 A;  4PGQ A;  5KFP A;  1ZQN A;  3WK5 A;  3TFS A;  3C21 A;  2G07 A;  1L6N A;  8ICA A;  5B5E U;  4RQ2 A;  1SXD A;  2EAP A;  4F5Q A;  2ZIX B;  2ZUD A;  2B21 A;  2KIW A;  4O5C A;  1QSY A;  3FYH A;  3WK7 A;  4C8K A;  2B51 A;  5HR6 A;  2VKQ A;  3WFO A;  2DQN B;  1NJW A;  2Z7J A;  3GII A;  4KLQ A;  3ONN A;  1ZQB A;  2HW3 A;  2HN1 A;  5DDY A;  1ZXI A;  1ZD5 A;  4QWD A;  1B4F A;  2YB1 A;  2PKE A;  3RB0 A;  4KM5 A;  2LBO A;  1WYG A;  2RDJ A;  4UQG A;  4I2J A;  4JWN A;  1KEJ A;  3QX7 A;  1PK1 B;  3M9O B;  1MA7 A;  2FMP A;  3MGI A;  5JTI A;  3S6J A;  5B3P A;  4IS7 A;  3ZDE A;  8ICI A;  3I76 A;  4K9A A;  3T5K A;  4DL7 A;  4KN7 A;  3EUB 2;  5AI5 A;  2OYY A;  4KLL A;  9ICX A;  3B0X A;  2M2W A;  4TUP A;  5AKE A;  3LVW A;  3QU2 A;  3BS7 A;  3OUY B;  4PGX A;  4ELU A;  2EQY A;  3MDA A;  4UW9 A;  4NLC A;  4Q8F A;  4K4H A;  5EE0 A;  3C1Z A;  2EAM A;  1NZB A;  1MIV A;  2KIC A;  2W9B A;  4QNL A;  4I28 A;  2IHO A;  4Y2R A;  4J9R A;  1L7N A;  2IHN A;  9ICC A;  2E8P A;  2M2U A;  5DED A;  1KN5 A;  2PMZ C;  4JWM A;  1SZP A;  4Y2X A;  4MFC A;  4Z6F A;  3T5L A;  4E80 A;  2KOB A;  4UAT A;  5AM2 A;  5L9X A;  5CHE A;  3H39 A;  1U49 A;  3OPX A;  2LPE A;  3FC4 A;  3V7L A;  4CGZ A;  9ICR A;  4YN4 A;  3C2L A;  3H0L B;  1LKY B;  2E3T A;  4X4T A;  4MEY A;  3G6V A;  2KJ9 A;  4DS5 A;  3MR3 A;  1U45 A;  4M9N A;  3TAD C;  4KMU A;  3PML A;  2IHM A;  4QIW C;  1YZ7 A;  4RPY A;  4K97 A;  7ICU A;  3C66 A;  2KZZ A;  1VJ5 A;  3H0R B;  4MF8 A;  2GO7 A;  2DFL A;  1XSN A;  2A19 A;  4RZR A;  3BZC A;  2HDO A;  1D9F A;  3D6J A;  3RRH A;  4OJO A;  3WKD A;  2NYV A;  3PW7 A;  4X4R A;  5D61 A;  3HT3 A;  1NK4 A;  3ICX A;  4Y2Y A;  2LI6 A;  1KDH A;  2C2E A;  2ASD A;  4YVZ A;  4C7Y A;  5ALE A;  4ECX A;  4ICA A;  3D2N A;  2AGO A;  1YT3 A;  3H8S A;  1ZQP A;  1XU4 A;  3BQT A;  2E8M A;  1Q3U A;  2I5H A;  1C7Y A;  5J2G A;  2ZUB A;  4C80 A;  1ZRM A;  2MU2 A;  5EE1 A;  8ICL A;  1IV8 A;  1UT5 A;  2K8C B;  3NVY A;  4IQU A;  3PST A;  1SKS A;  1NKC A;  4ED8 A;  4XA5 A;  2MRL A;  3ISC A;  3JCF A;  2FLL A;  3H37 A;  1CRX A;  2EAO A;  1UT8 A;  9ICB A;  5AIA A;  3GIK A;  4FH3 A;  3GFK B;  4GIB A;  1XO1 A;  5FP0 A;  4RWN A;  3PNC A;  1DOQ A;  2ZXI A;  4M6W B;  5IIJ A;  5ALJ A;  3TAD A;  4FZN A;  2HCF A;  1TE2 A;  4ACO A;  5ALY A;  3ORY A;  2IOF A;  2ZHA A;  4QZE A;  1P7D A;  3H8M A;  3MGV A;  4F2R A;  3SMV A;  3TAQ A;  4M0A A;  4PHE A;  1Z3E B;  4B9V A;  3KTQ A;  4Q43 A;  4F5R A;  1N2X A;  1X2I A;  2KSO A;  4JUZ A;  2HHQ A;  1NI3 A;  1S0O A;  4C4R A;  2XCA A;  4IRK A;  4IQV A;  3GZF A;  1QH9 A;  2W9C B;  4FS2 A;  2Y9T A;  2KG5 A;  2OXO A;  2MUT A;  3RJE A;  2BGW A;  5KFG A;  3AQM A;  2WB1 C;  3M1Y A;  5KFI A;  4I2E A;  3H4D A;  3K1R B;  1J2M A;  8ICX A;  4FBU A;  5AHX A;  1NK9 A;  1PVQ A;  3VCB A;  9ICU A;  4LVS A;  3SAG A;  2YB4 A;  5ALM A;  5J2B A;  3GIM A;  1L8O A;  5KFO A;  2W3S A;  2HN2 A;  5F9L A;  2IA6 A;  2WAQ F;  5CFT A;  3SI8 A;  5AIB A;  3ZI4 A;  3NYB A;  4YMN A;  3SYZ A;  2ALZ A;  5C5J A;  1OU5 A;  4X0B A;  5AK3 A;  4EEY A;  4WBZ A;  2E8O A;  2HVI A;  1NO5 A;  1QQ7 A;  3HKZ C;  3NVO A;  5KFY A;  4KLM A;  2W3R A;  1DRG A;  3AQF A;  5KFR A;  1ZQW A;  4YR0 A;  3WFP A;  4ELV A;  3EYZ A;  2I6X A;  2BBH A;  4JK1 A;  4B9S A;  3QU4 A;  1T8E A;  4OAI Z;  5ALT A;  4KLT A;  9ICF A;  4FHP A;  3RH5 A;  2GOL A;  5DQI A;  4FZM A;  1BPX A;  3KHR A;  5L1J A;  5KFJ A;  4KLE A;  3PHZ A;  3QU5 A;  4DQR A;  4RNN A;  2YX8 A;  4WH5 A;  2BE3 A;  1R8B A;  5HHH A;  3OVB A;  5G5H A;  3IN5 A;  3SQI A;  5DBB A;  1RQL A;  2MA1 A;  3SV4 A;  4Y2S A;  4EV6 A;  1U4B A;  4RNM A;  3R9K A;  4FHY A;  1FEZ A;  4YD2 A;  4M9L A;  2YMM A;  8ICM A;  3ZDA A;  2KTQ A;  1V9P A;  4F50 A;  2W7P A;  2W11 A;  5GTH U;  2K4E A;  5KFU A;  5KNI A;  4DL6 A;  3D2Q A;  5KFK A;  1UHU A;  2ODG A;  3F53 A;  3UXP A;  2PFN A;  4BDP A;  3F5E A;  3RJI A;  2LMR A;  5DKW A;  1OUQ A;  2DUY A;  3IP4 B;  1D8B A;  1ZD2 P;  3C18 A;  1ZQZ A;  1Y88 A;  2EZY A;  1NK0 A;  3CK6 A;  3PO5 A;  4DF8 A;  1Z1B A;  1U47 A;  5J0T A;  2FMS A;  5DGB A;  2PXI A;  4N7R A;  3HX0 A;  1T3N A;  4O0I A;  2KK0 A;  4IRC A;  4AT9 B;  1UQV A;  3SZ2 A;  8ICT A;  4EEL A;  3ALR A;  3NRW A;  1KL9 A;  4J9Q A;  4O9M A;  5JUM A;  4UAU A;  4K9B A;  3ZDD A;  2RRD A;  2BHN A;  3M9M B;  2PMZ F;  1N61 A;  4DSJ A;  4JV0 A;  4AYB C;  1L3V A;  7ICG A;  2F2A B;  4XJE A;  3E58 A;  5HHI A;  3IDW A;  1ZQG A;  4DEZ A;  2NRT A;  4M9J A;  3Q8P B;  1RYS A;  2AQ0 A;  4JV2 A;  5GTI U;  1KTQ A;  5J2F A;  1XSP A;  5KFA A;  5KFL A;  3WKA A;  1HIW A;  2KIV A;  1TV9 A;  1Z00 A;  1CEZ A;  2OHF A;  9ICJ A;  2P6U A;  5ALX A;  4EYH B;  4E0D A;  4QIW F;  5KT6 A;  1RZT A;  1QQ5 A;  4IR9 A;  2L5Y A;  1TKD A;  1XC9 A;  2ZH9 A;  1SB3 C;  2HHW A;  4AT8 B;  1FFV A;  2KJ8 A;  4E7X A;  3ISB A;  3PMN A;  1MIW A;  1UET A;  1S76 D;  3GU3 A;  3ISD A;  1SL1 A;  1MC8 A;  2H3V A;  3HIY A;  5AM0 A;  2DBY A;  4I0U A;  5AKL A;  2A1J B;  4QZG A;  5ALN A;  2KKP A;  3G6Y A;  2XGP A;  2HOI A;  4ED0 A;  2A1A A;  2K8A A;  4RQ3 A;  2WF6 A;  2Y9U A;  5CFU A;  2OWO A;  5CRX A;  1OXJ A;  4PHP A;  3M8R A;  2XGQ A;  1Z4O A;  2R8K A;  2ZH2 A;  5ALG A;  1ZQR A;  4P4O A;  5EWG A;  3NS1 A;  1BGX T;  5KFX A;  3U26 A;  9ICA A;  2ZTC A;  1WWU A;  5CR0 A;  4QWB A;  4FE3 A;  4B6J A;  3CW2 C;  3HRD D;  2HOF A;  2BDP A;  4KLD A;  3ER8 C;  1TAQ A;  3EWA A;  2W43 A;  3BJY A;  7ICF A;  5EE3 A;  4CE6 A;  2DR9 A;  3L3F X;  1A0P A;  4S3N A;  1BPE A;  2KJ5 A;  1MIY A;  3PR4 A;  2W55 A;  4P0Q B;  2FPL A;  5D62 A;  3RRG A;  2FLN A;  5HP4 A;  5KT7 A;  4UAZ A;  1NJY A;  1SGG A;  5JU5 A;  4BJQ A;  5AI8 A;  4A8E A;  5DB6 A;  2FPK A;  5HNK A;  2LYH A;  8ICS A;  1N5X A;  1X9S A;  1NOM A;  4RQN A;  4RT2 A;  4KIT B;  4UB4 A;  1LV5 A;  5AIC A;  1JAJ A;  2HBK A;  4AT7 A;  4KLS A;  2E5S A;  4RQ0 A;  3KD3 A;  1EXN A;  4DQQ A;  4LJX A;  2WAQ C;  3O0F A;  4US8 A;  4RNO A;  3RB4 A;  3SEI A;  2BQU A;  2JH1 A;  2WF9 A;  1KKX A;  1YZ6 A;  5KFF A;  4KMO B;  3RJF A;  1BNP A;  4LEW A;  1Z19 A;  5ALZ A;  1UA0 A;  2UVU A;  2WB1 F;  2ZH3 A;  1WOT A;  4PL2 A;  1L3U A;  4OO1 J;  3TAN A;  3V6J A;  4IG8 A;  2JZB B;  3FAH A;  5JTG A;  4I2B A;  1FIQ A;  5J0R A;  1JX4 A;  2R8J A;  4P2H A;  5KFH A;  4F4W A;  4DFK A;  2JGA A;  4UB3 A;  2NRZ A;  3K75 D;  2YMP A;  3QUQ A;  3QE9 Y;  3E2E A;  4XQ8 A;  4J9S A;  3AQL A;  3PX0 A;  1ZQY A;  5D63 A;  8ICG A;  5BOM A;  9ICH A;  3UPQ A;  2WF8 A;  4O6A A;  3JPN A;  2ISP A;  3NUQ A;  3HKZ F;  3IHQ B;  5F3X B;  4LEZ A;  7ICQ A;  1KSP A;  4O3R A;  4YP3 A;  4ECQ A;  5AK6 A;  3OSP A;  1SL2 A;  3PX4 A;  4J03 A;  3OWG A;  1AQ6 A;  3AMZ A;  4OAH A;  5DQG A;  3TAC B;  4U7C A;  3RTV A;  4TUS A;  2E1E A;  4EBD A;  3OVS A;  4ECY A;  8ICY A;  3B0Y A;  2YMQ A;  4PGY A;  1SZH A;  1QSL A;  4MFF A;  1SKW A;  9ICE A;  5AKX A;  5AI6 A;  4O3M A;  5KG5 A;  4RT3 A;  9ICS A;  2F8L A;  5DDM A;  3RBE A;  4X4S A;  5J8Y C;  2KZ3 A;  1BPY A;  4RQ4 A;  4F5N A;  5IIO A;  4IC9 A;  2H3F A;  4YR3 A;  1DGS A;  5IIN A;  4PJ0 U;  4DOC A;  5ALF A;  3TQ1 A;  1S8O A;  2F8K A;  2K4P A;  2OM6 A;  4ECU A;  4QZ8 A;  5KG0 A;  4Y2Q A;  1ZQA A;  3GQC A;  4DQS A;  4DL2 A;  7ICL A;  1DXS A;  2HBJ A;  2DR8 A;  2FE9 A;  3ERC C;  5KFM A;  2ZIX A;  1ZRN A;  3KBB A;  2YN4 A;  3V6H A;  3HP6 A;  2Q66 A;  3MAB A;  4WC6 A;  8ICH A;  9ICW A;  1BPD A;  2R8H A;  4ECZ A;  3HJ1 A;  3PVX A;  2NRK A;  1JUD A;  5ALV A;  4DSF A;  2NRV A;  5HRD A;  5KAI U;  3H38 A;  4FFD A;  2ZTE A;  2LM1 A;  2VJ4 A;  1MQ2 A;  2A3V A;  3OV7 A;  3ED5 A;  5KG3 A;  2M2V A;  2XIC A;  8ICN A;  4M2Y A;  1TAU A;  4C8O A;  2QAR B;  1PK1 A;  4Q8E A;  1ZYQ A;  1ZQC A;  2HHT A;  4Y2P A;  4CDG A;  2AQ4 A;  8ICF A;  4I29 A;  5KFV A;  4AYB F;  5AM4 A;  3IM1 A;  5AI0 A;  4ECR A;  3EF2 A;  2IOF K;  2OH2 A;  2K60 A;  5J8Y A;  3OHB A;  3JPP A;  3RJG A;  2H3Q A;  1JI7 A;  3OUY A;  3QUB A;  1U48 A;  1TFR A;  3C23 A;  4WC1 A;  1X42 A;  4EBE A;  3JYY A;  4BWM A;  3RB3 A;  8ICR A;  4OJ5 A;  1SIJ A;  2Y0S C;  3BQ7 A;  5ALR A;  2W8K A;  4FHW A;  5KFT A;  1X9W A;  5HRI A;  9ICM A;  5IIM A;  5HRE A;  2ZH8 A;  2HHP A;  3SD7 A;  4CNQ A;  2XO7 A;  3PX6 A;  9ICQ A;  1TFW A;  3UMB A;  2CPR A;  1TK8 A;  3BDP A;  4EEN A;  4KTQ A;  1ZD4 A;  3IG5 A;  4QWE A;  1NJX A;  4WC4 A;  4DSL A;  2F77 X;  3IRU A;  1KFD A;  4R64 A;  2PFP A;  1KBU A;  1LKY A;  2R8G A;  1BPZ A;  1R8C A;  9ICO A;  2AJQ A;  2UVW A;  8ICP A;  3QYP A;  3LYS A;  4DLG A;  4B9M A;  4KLH A;  2HVH A;  2V9W A;  1SV0 C;  3ZDC A;  5HRG A;  4XUS A;  8ICO A;  4DFP A;  3AEV A;  1RXV A;  1L7O A;  3KHH A;  4WQL A;  1SL0 A;  4O3P A;  4TUR A;  5ALL A;  1F0M A;  2W03 A;  2CXY A;  3KKA C;  5KTQ A;  1J97 A;  4OJP A;  1JMS A;  3A0B U;  3TAR A;  2R18 A;  3PSF A;  2J6S A;  4J9P A;  3AQN A;  5J2I A;  8ICQ A;  4F71 A;  1ZQQ A;  2HBL A;  2YML A;  4TUQ A;  2VA8 A;  1X66 A;  4EEK A;  1S97 A;  4PPX A;  4YXJ A;  1ZQ1 C;  2CN1 A;  1HEK A;  3OGU A;  1NKB A;  4P4M A;  1X40 A;  2RQ5 A;  5ALP A;  4JMU A;  5J0Q A;  1ZQI A;  3RFA A;  1UCV A;  3Q8S B;  4YCX A;  4O3O A;  4YMM A;  4DFJ A;  4O68 A;  2UVV A;  1ZQT A;  4PHA A;  4RUC A;  5DB7 A;  1N62 A;  7ICI A;  2ZG6 A;  3PW2 A;  2EZX A;  9ICI A;  3MC1 A;  4I2D A;  5TZV A;  1Z4N A;  4RPX A;  4DCC A;  4HYK A;  1O03 A;  1WUD A;  2ASJ A;  4TQR A;  4IQW A;  4X0A A;  2N1R A;  3HJE A;  3L9D A;  3AL0 B;  4PZO A;  5KT5 A;  3RAX A;  4BX9 C;  4WOY A;  4NY8 A;  4X4Q A;  3VC8 A;  1N63 A;  4M6W A;  3T79 A;  3A0H U;  4DO9 A;  3TI0 A;  1SV0 A;  2ZJ5 A;  5DG7 A;  2QB0 B;  2VJ5 A;  4RQM A;  2PFO A;  4WCW A;  7ICT A;  4Z6C A;  7ICM A;  2I9G A;  1ZOL A;  8ICK A;  2DR7 A;  5DLG A;  4X5V A;  2IUB A;  4F4Z A;  5HC9 A;  1M6Y A;  2PFQ A;  4KX3 A;  3KKA A;  2D6F C;  3MR2 A;  2Q0Z X;  4WC0 A;  4ECV A;  3OTQ A;  3QNM A;  2AXT U;  1KLN A;  3GIJ A;  2IBK A;  5B3Q A;  5F9N A;  4TQS A;  4DOA A;  5KFE A;  2V4R A;  2AH5 A;  2W9C A;  5DB9 A;  1Z1V A;  5J2A A;  3KHG A;  1L5U A;  2VAN A;  4G3I A;  2BDU A;  7ICO A;  5L1I A;  2LHT A;  2BR0 A;  4B9N A;  4LT6 A;  4RWP A;  3KOO A;  1WG8 A;  3LK9 A;  4F93 B;  4I2A A;  2G0A A;  3MDC A;  2YY6 A;  3THV A;  3BS5 B;  2P35 A;  4B9L A;  1ZQF A;  5CJ7 A;  4F5P A;  5KT4 A;  1JXL A;  2C2D A;  7ICS A;  4XQ7 A;  1SWW A;  3QUT A;  5J2J A;  2BQR A;  4ATB B;  1QCK A;  3DDH A;  5KT3 A;  4UB2 A;  5KFN A;  4I2C A;  2WTF A;  3B9J A;  2ZIU B;  8ICJ A;  2GLE A;  2FDR A;  5CP2 A;  5AK4 A;  3PSP A;  1RYR A;  1NJZ A;  2JEF A;  1FO4 A;  2FI1 A;  3RR8 A;  2B6G A;  1WCL A;  2AHO B;  3SAF A;  3RJJ A;  5AKI A;  1CUK A;  5G5G A;  4NLN A;  3MBY A;  4MHV A;  3N4M B;  3WFR E;  2WHE A;  1R89 A;  4M47 A;  2XVT A;  3WFQ E;  2ZIW B;  3M9N B;  1RG6 A;  1NZP A;  2BQ3 A;  3LQC B;  3WU2 U;  4BXO B;  4B9U A;  1SXE A;  5IIK A;  4I27 A;  1NK7 A;  2FCL A;  1KW4 A;  4O67 A;  1V38 A;  3M7D A;  4F72 A;  2JMG A;  3UMC A;  2KKV A;  1ZQS A;  2O6K A;  1F5A A;  4P0P B;  4F92 B;  1T4G A;  5CFS A;  5AI9 A;  2K89 A;  5J2C A;  5ALK A;  3NVV A;  7ICP A;  2DR5 A;  3K7D A;  2M2T A;  1BVS A;  1URJ A;  3N7R C;  4J9O A;  3G6X A;  3WK6 A;  1A77 A;  4JV1 A;  4FHV A;  2JXJ A;  2H5X A;  5J2D A;  4EX7 A;  2KNJ A;  4KB6 A;  1N60 A;  2B56 A;  4YG2 A;  2HOQ A;  1BPB A;  3V7K A;  3ZDB A;  4M9G A;  4IR1 A;  3H8W A;  3F5A A;  3T5H A;  1KRP A;  2KP7 A;  1XNS A;  4ED3 A;  4ED7 A;  1ZQD A;  5KL8 B;  4R8U B;  2NO5 A;  4DSE A;  2ZIV B;  3TAP A;  2JV3 A;  4AT9 A;  3RB6 A;  3GV7 B;  1ZJN A;  1XO0 A;  2GWS A;  5HML A;  4NXT A;  2Y0S F;  3IG8 A;  4ECT A;  1S9F A;  1JRO A;  2ESE A;  7ICR A;  2F1I A;  4KLG A;  3QXG A;  8ICE A;  1V97 A;  2FLP A;  1S77 D;  1S0N A;  4DWI A;  2ZH4 A;  5CA7 A;  4FZL A;  4YFK A;  4NL9 C;  3SEN A;  3M6K A;  2BCU A;  1COO A;  2VA2 A;  4EED A;  3ETR A;  5D49 A;  4DS4 A;  5HRB A;  1KNY A;  1A6S A;  3RAQ A;  3OJU A;  4QZF A;  3KZI U;  2NRW A;  4Y2V A;  4BGD A;  2RDI A;  3FM9 A;  2JEI A;  4AT8 A;  2BCS A;  3RR7 A;  1LVH A;  3F2C A;  2K4H A;  3H7I A;  5EWE A;  5AK5 A;  5J0X A;  5J0Y A;  2YTU A;  5DQH A;  4DL3 A;  4CF5 A;  3IV6 A;  4NXZ A;  4JLX A;  2A1J A;  1JXE A;  2DKZ A;  1H38 A;  5KG1 A;  2J6T A;  3NGD A;  1Q8K A;  4C4T A;  5L1M A;  3BQ0 A;  2RFF A;  1IM4 A;  2RHF A;  3K1Z A;  2ZTD A;  4O3Q A;  3BQ1 A;  2F44 A;  2JEG A;  1D8Y A;  2W9A A;  4O69 A;  2HHS A;  1QSS A;  2FMQ A;  1UEV A;  1HUO A;  4C4S A;  4DL4 A;  2NV3 A;  1X6J A;  2HSZ A;  1PK3 A;  3NWI A;  4OAF A;  4RWQ A;  1DK3 A;  2HI0 A;  4NL9 A;  4F4K A;  4USA A;  9ICT A;  4M9H A;  3BZK A;  3NVW A;  4C8N A;  4ED2 A;  2XY5 A;  1ZET A;  3SAH A;  3C28 A;  4P0Q A;  2ZH1 A;  2WF5 A;  3BQ2 A;  5H2F U;  5HRH A;  3JPS A;  4G9B A;  4C0Z A;  9ICK A;  5DGA A;  3UMG A;  4LZG A;  1JQR A;  2G08 A;  1D8L A;  1Q78 A;  2HMX A;  3AUO A;  7ICE A;  4C8L A;  5ALU A;  4DQP A;  3UXO A;  4DSI A;  2JRZ A;  4M04 A;  2W9B B;  1SWV A;  1PVR A;  1HUZ A;  2BPF A;  2RLT A;  5HR7 A;  4F4Y A;  4NKT A;  3LVV A;  5KFS A;  5AKJ A;  2I1Q A;  2LYA A;  5J0S A;  1X9X A;  4I2I A;  4BWJ A;  2KFN A;  4X4U A;  2KMD A;  4NM2 A;  2EAN A;  1N48 A;  4F91 B;  2XY6 A;  1S0M A;  5KG2 A;  2KD1 A;  4XRH A;  4FHX A;  2F3N A;  1LB2 B;  3N28 A;  3K4G A;  4IQT A;  3KHL A;  1K1S A;  2P6R A;  2W04 A;  9ICL A;  2WF7 A;  4Q45 A;  4O3N A;  4QZH A;  1L8L A;  5J29 A;  4Z6E A;  2JZB A;  1ARO P;  4MEX A;  3OVA A;  3ZD9 A;  5J0P A;  5AKH A;  1ZQE A;  2LM4 A;  5HMM A;  4KLO A;  4UAW A;  1QTM A;  4UAY A;  3NVZ A;  5KG7 A;  1RYU A;  2EZZ A;  4J9K A;  4X4V A;  2B4V A;  2M0N A;  5HRK A;  3E0F A;  4EGW A;  5DB8 A;  5IIL A;  2KFZ A;  4EYI B;  5EWF A;  3AU2 A;  4LZD A;  1QLN A;  3T5J A;  1S10 A;  4C8M A;  4MKP A;  1T3Q A;  4CF4 A;  1V85 A;  5A0L A;  2WFA A;  9ICN A;  3HW8 A;  4K8V A;  5EE9 A;  3I1Y A;  2DKX A;  4K99 A;  3V6K A;  5BPC A;  3RJK A;  1FFU A;  2H3I A;  5B66 U;  5D4B A;  2RP5 A;  4FBT A;  2PBE A;  5F2V O;  2GH1 A;  2IOH A;  2G5H B;  1KFT A;  4GFJ A;  2DPJ A;  3UXN A;  3PR5 B;  1DGJ A;  4WC5 A;  5DBC A;  2KEY A;  4Y2T A;  4NLG A;  2KV2 A;  4UB6 U;  3C5G A;  3RBD A;  4M5D A;  1U9L A;  3Q8R B;  1KQQ A;  3PY8 A;  3N7P D;  4EP7 A;  8ICV A;  4EX6 A;  2KZM A;  4GXK A;  1A76 A;  1TVA A;  5ALH A;  2FJ6 A;  2P66 A;  2W7O A;  3JPR A;  4I2H A;  1SV4 A;  5KT2 A;  1IXR A;  3ETL A;  4Y2U A;  5AM1 A;  3F2B A;  1L3S A;  1NKE A;  4K98 A;  2Y1J A;  2G06 A;  2G09 A;  1N56 A;  3DV9 A;  1PX5 A;  2QLT A;  5ALW A;  3OSN A;  2K8B B;  4GC6 A;  2HHU A;  3FDS A;  1J2N A;  3V72 A;  4Z6D A;  4K96 A;  4NXW A;  2KSO B;  3TKA A;  4ECS A;  3RH6 A;  5J2K A;  2ZUC A;  3HWT A;  3PO4 A;  2W9M A;  4QZD A;  9ICV A;  4PZN A;  3EPI A;  4FO6 A;  2EH9 A;  4ED1 A;  7ICK A;  4NKU A;  4R66 A;  4EEB A;  5HRF A;  2MUT B;  1ZQL A;  2VIX A;  5J2E A;  2ZXH A;  4UBB A;  4GXI A;  1MSW D;  4OD0 A;  4CF3 A;  4F5O A;  2QAR A;  2KVC A;  1PVP A;  5DBA A;  4DQI A;  2HHX A;  3UPS A;  3Q8K A;  2W54 A;  3EW9 A;  3UQ0 A;  1F44 A;  3CP8 A;  4UAS A;  3QU7 A;  4YD1 A;  5D46 A;  5ALD A;  3ER9 B;  1JAL A;  5C0Y A;  3HIL A;  3N97 B;  3V7J A;  1B0X A;  2DRB A;  2JHD A;  2AU0 A;  1T7P A;  5HR9 A;  3HJ4 A;  4K4G A;  4YR2 A;  2NRX A;  3NAS A;  2NO4 A;  3GV8 B;  1N5W A;  1NK5 A;  1TFY A;  4RQ5 A;  4I2F A;  3MR6 A;  4EBC A;  2LKY A;  3CYM A;  1L3T A;  2R8I A;  5AKK A;  2BPG A;  4OCZ A;  3OHA A;  1ECW A;  1BNO A;  2E8N A;  7ICH A;  3Q8Q B;  4O5E A;  3WK8 A;  4WC7 A;  4EBK A;  4RU9 A;  3PSI A;  2XI9 A;  1JN3 A;  3I28 A;  4C7Z A;  4WC2 A;  1Q46 A;  3PW5 A;  8ICW A;  3WKB A;  4YMO A;  3MFI A;  2C28 A;  5KFB A;  4UB8 U;  5ALS A;  2ZH5 A;  2KHQ A;  4KLJ A;  4DSK A;  4QZA A;  3Q8M A;  1NK8 A;  2ZJ8 A;  4F2S A;  4HAI A;  1OW5 A;  4KLI A;  4X4N A;  2BKE A;  1R8A A;  3LDA A;  3PZP A;  4FH5 A;  4QJF B;  2QB1 A;  3D2S A;  2MAX A;  5J0W A;  1ZQO A;  2O5A A;  1PZN A;  3L5K A;  3GDX A;  5CEH A;  1K5O A;  4ECW A;  2ZJA A;  4E8F A;  2DGZ A;  3M6Z A;  4MF2 A;  2UVR A;  2XID A;  3EPG A;  1TK0 A;  2XC9 A;  2BCV A;  2K4I A;  2CRX A;  2LYB A;  3RF9 A;  2E1F A;  3UQ2 A;  4RQ7 A;  1T94 A;  4CRX A;  4NXX A;  4DF4 A;  3J81 j;  3AM9 A;  4NXU A;  2JEJ A;  4J9M A;  1D9D A;  4NV0 A;  4NLB A;  5KFW A;  3KZX A;  3AQK A;  3QEA Z;  2ES6 A;  3PW0 A;  2KN7 A;  4EZ9 A;  5AKY A;  4ZOH C;  4PHD A;  3H4B A;  3AN1 A;  1TK5 A;  3H0M B;  4NXV A;  2C22 A;  3GIL A;  2OEH A;  4JLZ A;  1B43 A;  5DG8 A;  4KN4 A;  3OJS A;  4O5K A;  1WCN A;  2JH7 A;  5KFC A;  5ALO A;  3JPT A;  3HPO A;  3JZ0 A;  2J6U A;  7ICN A;  5DLF A;  4Y2J A;  3QZ7 A;  5AKG A;  2HBM A;  3KFU F;  3QU9 A;  3TFR A;  4KLU A;  4X4O A;  4GXJ A;  2BBJ A;  2G5I B;  4QZB A;  2KVS A;  2QB0 A;  4ELT A;  4DFD A;  4J9N A;  3C29 A;  5T14 A;  4HX0 A;  4UBC A;  4GC7 A;  2B0C A;  1MN8 A;  1RM6 C;  1Z00 B;  3EZ5 A;  1S0V A;  2PI4 A;  9ICP A;  8ICC A;  3C2M A;  5CHG A;  8ICZ A;  4UB1 A;  4BUG A;  3NKU A;  4AP9 A;  3M8S A;  3AQE A;  2FPM A;  4UD4 A;  1NNL A;  1ZJM A;  1RQN A;  1ZQK A;  3H8J A;  5III A;  1CI4 A;  3JPQ A;  4OJL A;  4DL5 A;  2KHV A;  5TIS U;  5J0U A;  2BPC A;  1DK2 A;  2DVI A;  3CNH A;  4QZI A;  2F1H A;  2Q4T A;  1ZD3 A;  5BOL A;  4O3S A;  3WK4 A;  2DWQ A;  1UPH A;  1X6I A;  2F76 X;  2F1J A;  8ICB A;  4IL6 U;  4RWO A;  5L1K A;  4QW9 A;  2ZH6 A;  2H3Z A;  2V4Q A;  3BS5 A;  5CB1 A;  5AKZ A;  1UEU A;  1VJ7 A;  1RPL A;  4B9T A;  1C20 A;  1F5S A;  5ALI A;  4ED6 A;  2ZH7 A;  1IIP A;  1VFG A;  5KG4 A;  4ATB A;  3C5F A;  1KFS A;  1XWL A;  5L1L A;  3MCR A;  4P4P A;  4DOB A;  4US9 A;  4EZ6 A;  2ZIU A;  2OCE A;  2KE7 A;  4FS1 A;  3DEE A;  4WC3 A;  1YLQ A;  2MSN A;  1B22 A;  1UA1 A;  4I2G A;  4LEY A;  4YXM A;  4QZ9 A;  3C2K A;  2ZHB A;  2IMW P;  1FA0 A;  5AI4 A;  3UM9 A;  2EWR A;  4KX5 A;  4RUA A;  4MFA A;  2ZIW A;  1GPJ A;  2ASL A;  4DLE A;  1K1Q A;  4QWC A;  1HJP A;  4F8R A;  2GA9 D;  3LWL A;  4PL1 A;  3N7S C;  5KAF U;  2DPI A;  2BCR A;  4BXO A;  1ZQV A;  4NLZ A;  3WKC A;  5J0O A;  4WJ3 B;  4GLX A;  1WWV A;  4UD5 A;  1RDF A;  5KFQ A;  4AT7 B;  2YQE A;  2AGP A;  3MGH A;  4NM1 A;  4P0P A;  2QKQ A;  4UB5 A;  1S5L U;  3C1Y A;  2GAF D;  4F4X A;  4IRD A;  9ICG A;  5J2H A;  5KFZ A;  4QW8 A;  1QQ6 A;  4WBY A;  5E79 U;  2XCP A;  5ALQ A;  3CRX A;  7ICV A;  4UAR A;  3RH4 A;  3QEB Z;  1JIH A;  4RPZ A;  3MFH A;  3Q8L A;  1ZQU A;  7ICJ A;  2C2R A;  4R65 A;  1ZQX A;  3PW4 A;  4QZC A;  1O08 A;  3JPO A;  4Q44 A;  2XY7 A;  4OJ6 A;  5DEC A;  1XSL A;  2BZF A; 
#chains in the Genus database with same CATH homology
 2ISO A;  5KTQ A;  3UXP A;  5KG6 A;  2PFN A;  4BDP A;  5DG9 A;  3AU6 A;  1JMS A;  3QZ8 A;  3TAR A;  5KG7 A;  3RJI A;  5EOZ A;  2J6S A;  4J9P A;  3AQN A;  4J9K A;  5J2I A;  8ICQ A;  1ZQQ A;  5DKW A;  1X9M A;  3ZD8 A;  1ZQM A;  4TUQ A;  4X4V A;  2VA8 A;  3GV5 B;  5HRL A;  1S97 A;  1V4A A;  4PPX A;  4YXJ A;  1SKR A;  4RQ6 A;  4NLK A;  5HRK A;  5DB8 A;  5IIL A;  2DRA A;  2KFZ A;  4EYI B;  3C18 A;  3OGU A;  5EWF A;  1Q79 A;  5KFD A;  4R8U A;  1NKB A;  1ZQZ A;  3AU2 A;  1Y88 A;  4LZD A;  1QLN A;  3T5J A;  1S10 A;  4C8M A;  4P4M A;  1NK0 A;  4DFM A;  5J0Q A;  1ZQI A;  3PO5 A;  4DF8 A;  9ICN A;  1U47 A;  3HW8 A;  5J0T A;  3Q8S B;  4YCX A;  5DGB A;  3H40 A;  2PXI A;  2FMS A;  3HX0 A;  1T3N A;  3NTU A;  4O0I A;  4R63 A;  4O3O A;  4IRC A;  8ICU A;  4AT9 B;  4YMM A;  3SZ2 A;  8ICT A;  3V6K A;  4DFJ A;  2Y1I A;  2UVV A;  3T3F A;  1ZQT A;  4PHA A;  5BPC A;  3RJK A;  4J9Q A;  4RUC A;  5DB7 A;  4J9L A;  5JUM A;  4O9M A;  4X4P A;  7ICI A;  3PW2 A;  9ICI A;  5D4B A;  5F2V O;  4FBT A;  2PBE A;  4I2D A;  5TZV A;  3ZDD A;  2HHV A;  2BHN A;  3M9M B;  4RPX A;  1KFT A;  2DPJ A;  3UXN A;  4HYK A;  4JV0 A;  3PR5 B;  2ASJ A;  4DSJ A;  1L3V A;  4WC5 A;  4TQR A;  4IQW A;  3MR5 A;  7ICG A;  4X0A A;  5DBC A;  3L9D A;  1XS9 D;  4CCH A;  4NLG A;  5HHI A;  5KT5 A;  1ZQG A;  4DEZ A;  3C5G A;  3PV8 A;  3RAX A;  2NRT A;  1MQ3 A;  4M9J A;  4NY8 A;  4YQW A;  3Q8P B;  3RBD A;  1RYS A;  1ZQH A;  2AQ0 A;  4M5D A;  4X4Q A;  1U9L A;  3Q8R B;  3PY8 A;  4JV2 A;  4EP7 A;  4M6W A;  3WFS C;  1KTQ A;  2BCQ A;  5J2F A;  4RQ1 A;  1NK6 A;  4PH5 A;  2VA3 A;  1XSP A;  5KFA A;  3LWM A;  4DO9 A;  1ZQJ A;  4F3O A;  8ICV A;  5KFL A;  1RXW A;  4QWA A;  4ZH4 A;  5CWR A;  2ATL A;  2ID1 A;  3H3A A;  3TI0 A;  2KZM A;  2ZJ5 A;  5DG7 A;  1TV9 A;  4GXK A;  1A76 A;  2PFO A;  1Z00 A;  3RJH A;  2O1P A;  4WCW A;  4EBJ A;  7ICT A;  1CEZ A;  1TVA A;  4Z6C A;  9ICJ A;  2P66 A;  4TUR A;  4I2H A;  2P6U A;  3JPR A;  4EYH B;  5KT2 A;  4E0D A;  7ICM A;  2I9G A;  2M9N A;  1IXR A;  5KT6 A;  1RZT A;  4IR9 A;  3ETL A;  8ICK A;  4KLF A;  1TKD A;  1L3S A;  2DR7 A;  5DLG A;  4X5V A;  1XC9 A;  1NKE A;  2ZH9 A;  4F4Z A;  5HC9 A;  2PFQ A;  2Y1J A;  2PI5 A;  3MR2 A;  2HHW A;  4AT8 B;  1N56 A;  2Q0Z X;  3SV3 A;  4K4I A;  2AGQ A;  4WC0 A;  4ECV A;  2W8L A;  4RQ8 A;  4PGQ A;  5KFP A;  1PX5 A;  4E7X A;  3ISB A;  3PMN A;  1MIW A;  3OSN A;  1UET A;  1S76 D;  4GC6 A;  1ZQN A;  2HHU A;  3ISD A;  3FDS A;  3TFS A;  3C21 A;  3GIJ A;  1SL1 A;  1KLN A;  2IBK A;  3V72 A;  4Z6D A;  1MC8 A;  8ICY A;  5F9N A;  4TQS A;  4DOA A;  4RQ2 A;  8ICA A;  5KFE A;  3HIY A;  4F5Q A;  2V4R A;  2ZUD A;  4ECS A;  3RH6 A;  2A1J B;  2B21 A;  5J2K A;  2W9C A;  2ZUC A;  4QZG A;  3HWT A;  4O5C A;  3PO4 A;  2W9M A;  1QSY A;  5DB9 A;  3FYH A;  5J2A A;  4QZD A;  2VAN A;  2XGP A;  3KHG A;  3G6Y A;  4ED0 A;  5L1I A;  1L5U A;  7ICO A;  9ICV A;  3EPI A;  4FO6 A;  2BR0 A;  4C8K A;  4RQ3 A;  4ED1 A;  4B9N A;  4LT6 A;  4RWP A;  7ICK A;  3WFO A;  4NKU A;  4R66 A;  1NJW A;  5HRF A;  2MUT B;  2OWO A;  1ZQL A;  3GII A;  4KLQ A;  5J2E A;  4UBB A;  4GXI A;  3LK9 A;  4F93 B;  1ZQB A;  5DDY A;  4PHP A;  4I2A A;  2HW3 A;  1MSW D;  3M8R A;  2XGQ A;  4QWD A;  3MDC A;  4F5O A;  2R8K A;  3THV A;  2ZH2 A;  5DBA A;  3RB0 A;  4DQI A;  2HHX A;  3UPS A;  4B9L A;  3Q8K A;  2RDJ A;  1ZQF A;  5CJ7 A;  4UQG A;  4F5P A;  5KT4 A;  4I2J A;  1JXL A;  1ZQR A;  4JWN A;  3EW9 A;  3UQ0 A;  1KEJ A;  4P4O A;  2C2D A;  5EWG A;  7ICS A;  4XQ7 A;  1BGX T;  5KFX A;  3M9O B;  2FMP A;  9ICA A;  5J2J A;  2ZTC A;  3MGI A;  4YD1 A;  2BQR A;  4ATB B;  5CR0 A;  4QWB A;  5D46 A;  3ZDE A;  8ICI A;  5KT3 A;  4UB2 A;  2BDP A;  4KLD A;  1TAQ A;  5KFN A;  4I2C A;  3N97 B;  3V7J A;  3EWA A;  4KN7 A;  3T5K A;  3BJY A;  2WTF A;  4DL7 A;  4KLL A;  3B0X A;  9ICX A;  2DRB A;  1T7P A;  2AU0 A;  1QTM A;  7ICF A;  5CP2 A;  8ICJ A;  2M2W A;  5HR9 A;  4TUP A;  3HJ4 A;  2DR9 A;  4K4G A;  4YR2 A;  1RYR A;  2NRX A;  1NJZ A;  2JEF A;  4S3N A;  1BPE A;  3GV8 B;  3RR8 A;  1MIY A;  3PR4 A;  1NK5 A;  3OUY B;  1TFY A;  4PGX A;  4RQ5 A;  1WCL A;  2FPL A;  3RJJ A;  4ELU A;  3RRG A;  4I2F A;  2FLN A;  3MR6 A;  4EBC A;  3MDA A;  1CUK A;  5KT7 A;  5HP4 A;  1L3T A;  2R8I A;  4NLN A;  3MBY A;  4UAZ A;  1NJY A;  2BPG A;  4Q8F A;  3OHA A;  3N4M B;  4K4H A;  1BNO A;  3WFR E;  1R89 A;  3C1Z A;  4M47 A;  7ICH A;  5DB6 A;  3Q8Q B;  1MIV A;  2FPK A;  5HNK A;  2W9B A;  4I28 A;  4O5E A;  4WC7 A;  3WFQ E;  3M9N B;  4EBK A;  2LYH A;  4J9R A;  2IHN A;  9ICC A;  1NZP A;  8ICS A;  2BQ3 A;  2M2U A;  5DED A;  4RU9 A;  1X9S A;  1NOM A;  3LQC B;  4UB4 A;  4RT2 A;  4KIT B;  4JWM A;  1JN3 A;  1LV5 A;  1JAJ A;  4BXO B;  4B9U A;  1SZP A;  4WC2 A;  4AT7 A;  4MFC A;  4KLS A;  4Z6F A;  5IIK A;  3PW5 A;  4RQ0 A;  3T5L A;  1NK7 A;  1EXN A;  4I27 A;  8ICW A;  4E80 A;  4DQQ A;  5L9X A;  4YMO A;  3H39 A;  3MFI A;  2C28 A;  5KFB A;  1U49 A;  2ZH5 A;  3V7L A;  4RNO A;  3RB4 A;  2BQU A;  1ZQS A;  9ICR A;  1F5A A;  4KLJ A;  4YN4 A;  4F92 B;  3C2L A;  4DSK A;  4QZA A;  3Q8M A;  1T4G A;  2ZJ8 A;  5KFF A;  1NK8 A;  4F2S A;  3RJF A;  4X4T A;  4MEY A;  1BNP A;  5J2C A;  3G6V A;  4KLI A;  4DS5 A;  4X4N A;  3MR3 A;  1UA0 A;  2UVU A;  1U45 A;  4M9N A;  2BKE A;  7ICP A;  2ZH3 A;  1R8A A;  1L3U A;  1WOT A;  2DR5 A;  4KMU A;  3LDA A;  3PML A;  2M2T A;  2IHM A;  3TAN A;  3V6J A;  1BVS A;  4FH5 A;  4IG8 A;  2JZB B;  4RPY A;  2MAX A;  5J0W A;  4J9O A;  3G6X A;  1ZQO A;  4I2B A;  7ICU A;  3C66 A;  2O5A A;  1PZN A;  2KZZ A;  3GDX A;  5J0R A;  1A77 A;  4JV1 A;  4ECW A;  2ZJA A;  1JX4 A;  4FHV A;  4E8F A;  1XSL A;  2R8J A;  4MF8 A;  4P2H A;  2H5X A;  5J2D A;  5KFH A;  2DFL A;  1XSN A;  4F4W A;  4DFK A;  4RZR A;  4MF2 A;  2UVR A;  1D9F A;  4UB3 A;  3EPG A;  3RRH A;  2NRZ A;  1TK0 A;  2XC9 A;  3K75 D;  2BCV A;  3PW7 A;  4X4R A;  4YG2 A;  3HT3 A;  3QE9 Y;  1NK4 A;  1BPB A;  3V7K A;  3UQ2 A;  3ZDB A;  4M9G A;  4XQ8 A;  4O5K A;  3E2E A;  4RQ7 A;  4J9S A;  3AQL A;  3PX0 A;  1KDH A;  3H8W A;  4IR1 A;  1ZQY A;  3T5H A;  2C2E A;  1KRP A;  8ICG A;  2ASD A;  2KP7 A;  5BOM A;  4ED3 A;  4DF4 A;  4YVZ A;  3UPQ A;  4ED7 A;  9ICH A;  1ZQD A;  3JPN A;  2JEJ A;  2ISP A;  3IHQ B;  4J9M A;  4R8U B;  4ECX A;  1D9D A;  4DSE A;  3TAP A;  7ICQ A;  5KFW A;  2AGO A;  4AT9 A;  3AQK A;  3RB6 A;  3QEA Z;  3GV7 B;  3H8S A;  1ZJN A;  1ZQP A;  1KSP A;  1XU4 A;  3BQT A;  5HML A;  4YP3 A;  2GWS A;  4ECQ A;  2KN7 A;  3PW0 A;  4O3R A;  4EZ9 A;  1C7Y A;  3OSP A;  5J2G A;  1SL2 A;  3PX4 A;  2ZUB A;  4PHD A;  3H4B A;  4ECT A;  1TK5 A;  1S9F A;  7ICR A;  8ICL A;  5DQG A;  2F1I A;  1UT5 A;  4IQU A;  3RTV A;  2C22 A;  3GIL A;  4TUS A;  4KLG A;  1SKS A;  4EBD A;  8ICE A;  1NKC A;  3OVS A;  1B43 A;  4XA5 A;  4KN4 A;  5DG8 A;  3OJS A;  4ECY A;  4ED8 A;  1WCN A;  3B0Y A;  2FLP A;  1QSL A;  4PGY A;  3ISC A;  5KFC A;  3JPT A;  3HPO A;  1S0N A;  1S77 D;  3JZ0 A;  4MFF A;  1SKW A;  4DWI A;  2J6U A;  7ICN A;  9ICE A;  5CA7 A;  2ZH4 A;  5DLF A;  2FLL A;  5KG5 A;  4YFK A;  4RT3 A;  3QZ7 A;  9ICS A;  5DDM A;  3RBE A;  3H37 A;  4X4S A;  4KLU A;  2KZ3 A;  3TFR A;  1BPY A;  4RQ4 A;  4GXJ A;  1UT8 A;  9ICB A;  2BCU A;  4X4O A;  4F5N A;  1COO A;  5IIO A;  3GIK A;  4FH3 A;  4QZB A;  3GFK B;  2VA2 A;  1XO1 A;  4YR3 A;  4ELT A;  4RWN A;  1DGS A;  3PNC A;  1DOQ A;  4M6W B;  5IIJ A;  4J9N A;  5IIN A;  4DOC A;  5D49 A;  4DS4 A;  4UBC A;  4G3I A;  3ORY A;  4GC7 A;  5HRB A;  3TQ1 A;  1KNY A;  3RAQ A;  3OJU A;  1Z00 B;  3EZ5 A;  4QZF A;  1S0V A;  2ZHA A;  2NRW A;  4QZE A;  2PI4 A;  8ICC A;  9ICP A;  3C2M A;  4ECU A;  4BGD A;  5CHG A;  8ICZ A;  4UB1 A;  2RDI A;  2JEI A;  4AT8 A;  4QZ8 A;  5KG0 A;  4F2R A;  1ZQA A;  3TAQ A;  2BCS A;  4M0A A;  3GQC A;  4DQS A;  3M8S A;  4PHE A;  3RR7 A;  3JYY A;  4DL2 A;  7ICL A;  2FPM A;  4UD4 A;  1Z3E B;  4B9V A;  3H7I A;  1ZJM A;  5EWE A;  3KTQ A;  5J0X A;  2DR8 A;  4Q43 A;  4F5R A;  1ZQK A;  5KFM A;  3H8J A;  5J0Y A;  5III A;  5DQH A;  3JPQ A;  4DL3 A;  1X2I A;  4JUZ A;  2HHQ A;  4NXZ A;  4DL5 A;  2A1J A;  1S0O A;  3V6H A;  1JXE A;  3HP6 A;  5J0U A;  2Q66 A;  2BPC A;  1DK2 A;  2DVI A;  3MAB A;  2XCA A;  4IRK A;  4QZI A;  1H38 A;  4IQV A;  2F1H A;  8ICH A;  9ICW A;  4WC6 A;  1BPD A;  2R8H A;  5KG1 A;  4ECZ A;  2J6T A;  3NGD A;  2W9C B;  4FS2 A;  3HJ1 A;  3BQ0 A;  3PVX A;  4O3S A;  5BOL A;  1IM4 A;  2NRK A;  2RFF A;  2MUT A;  3RJE A;  2BGW A;  5KFG A;  4DSF A;  2NRV A;  3AQM A;  5HRD A;  2ZTD A;  4O3Q A;  2F1J A;  3BQ1 A;  8ICB A;  3H38 A;  5KFI A;  4I2E A;  2ZTE A;  3H4D A;  4RWO A;  5L1K A;  4QW9 A;  2JEG A;  8ICX A;  4FBU A;  1MQ2 A;  1D8Y A;  2ZH6 A;  2V4Q A;  5CB1 A;  1UEU A;  3OV7 A;  5KG3 A;  1NK9 A;  1RPL A;  2W9A A;  2M2V A;  1VJ7 A;  8ICN A;  9ICU A;  4LVS A;  4M2Y A;  2HHS A;  1QSS A;  2FMQ A;  4B9T A;  1TAU A;  4C8O A;  1UEV A;  4ED6 A;  4Q8E A;  1ZYQ A;  2ZH7 A;  5J2B A;  3GIM A;  1VFG A;  1HUO A;  5KG4 A;  1ZQC A;  5KFO A;  2HHT A;  4ATB A;  3C5F A;  4DL4 A;  2AQ4 A;  1KFS A;  1XWL A;  8ICF A;  5L1L A;  4P4P A;  4I29 A;  5F9L A;  2IA6 A;  4DOB A;  4EZ6 A;  3SI8 A;  5KFV A;  3NYB A;  4YMN A;  3SYZ A;  4FS1 A;  2ALZ A;  3IM1 A;  5C5J A;  4ECR A;  4RWQ A;  1DK3 A;  4F4K A;  9ICT A;  1OU5 A;  4X0B A;  4WC3 A;  1YLQ A;  3OHB A;  3JPP A;  4EEY A;  3RJG A;  4M9H A;  4C8N A;  4ED2 A;  4WBZ A;  3OUY A;  2XY5 A;  1U48 A;  1ZET A;  1B22 A;  2HVI A;  1TFR A;  3C23 A;  3BQ2 A;  2ZH1 A;  1NO5 A;  5HRH A;  3JPS A;  1UA1 A;  5KFY A;  4I2G A;  4KLM A;  9ICK A;  4WC1 A;  5DGA A;  5KFR A;  4EBE A;  4YXM A;  4BWM A;  4QZ9 A;  3RB3 A;  4LZG A;  1JQR A;  1D8L A;  3C2K A;  2IMW P;  1ZQW A;  4YR0 A;  8ICR A;  1FA0 A;  3WFP A;  2ZHB A;  4ELV A;  1Q78 A;  3AUO A;  7ICE A;  2W8K A;  3EYZ A;  4FHW A;  4C8L A;  4RUA A;  5KFT A;  4MFA A;  4JK1 A;  1X9W A;  2ASL A;  4DLE A;  4B9S A;  1K1Q A;  4DQP A;  9ICM A;  3UXO A;  5IIM A;  5HRE A;  5HRI A;  2HHP A;  4DSI A;  2ZH8 A;  1T8E A;  4QWC A;  1HJP A;  2XO7 A;  4F8R A;  4M04 A;  2W9B B;  4KLT A;  3PX6 A;  9ICF A;  3LWL A;  9ICQ A;  4FHP A;  2DPI A;  2BCR A;  1HUZ A;  4BXO A;  1TFW A;  3RH5 A;  1ZQV A;  2BPF A;  5DQI A;  1TK8 A;  3BDP A;  4NLZ A;  1BPX A;  3KHR A;  5L1J A;  4F4Y A;  5KFJ A;  4KTQ A;  4KLE A;  4NKT A;  5KFS A;  5J0O A;  4DQR A;  4RNN A;  4GLX A;  4QWE A;  1NJX A;  2BE3 A;  2I1Q A;  5J0S A;  4UD5 A;  4I2I A;  5KFQ A;  4AT7 B;  4WC4 A;  4BWJ A;  4DSL A;  2KFN A;  1R8B A;  4X4U A;  2AGP A;  4NM2 A;  3MGH A;  1N48 A;  4NM1 A;  4UB5 A;  1KFD A;  5HHH A;  4R64 A;  3OVB A;  3C1Y A;  4F91 B;  2PFP A;  2XY6 A;  1S0M A;  5KG2 A;  2R8G A;  4F4X A;  4XRH A;  5DBB A;  4FHX A;  3SV4 A;  1LB2 B;  4IRD A;  1BPZ A;  9ICG A;  1R8C A;  5J2H A;  3K4G A;  9ICO A;  2AJQ A;  2UVW A;  8ICP A;  5KFZ A;  4IQT A;  3KHL A;  1U4B A;  4RNM A;  4FHY A;  1K1S A;  4QW8 A;  2P6R A;  4DLG A;  4B9M A;  4KLH A;  4WBY A;  4YD2 A;  4M9L A;  9ICL A;  4Q45 A;  4O3N A;  2XCP A;  4QZH A;  8ICM A;  7ICV A;  3ZDA A;  2HVH A;  2V9W A;  5J29 A;  4Z6E A;  2JZB A;  2KTQ A;  1ARO P;  3RH4 A;  1V9P A;  4MEX A;  3ZDC A;  5HRG A;  4XUS A;  3QEB Z;  3OVA A;  1JIH A;  4F50 A;  8ICO A;  4RPZ A;  3ZD9 A;  3MFH A;  3Q8L A;  1ZQU A;  7ICJ A;  5J0P A;  2C2R A;  4R65 A;  1ZQX A;  4DFP A;  3PW4 A;  1ZQE A;  1RXV A;  5HMM A;  4QZC A;  5KFU A;  4KLO A;  3KHH A;  3JPO A;  4Q44 A;  4DL6 A;  2XY7 A;  1SL0 A;  5KFK A;  4O3P A;  4UAW A;  5DEC A;  4UAY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...