4M47A

Structure of human dna polymerase complexed with 8-brg in the template base paired with incoming non-hydrolyzable gtp
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
324
structure length
314
Chain Sequence
NGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for promutagenicity of 8-halogenated Guanine.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
molecule keywords DNA polymerase beta
total genus 104
structure length 314
sequence length 324
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4m47A02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4m47A01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4m47A04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4m47A03
3KHRA 1T3NA 4DS4A 2C28A 2P6RA 1D8LA 3ZDEA 4KLGA 4I2AA 2PFPA 3JPTA 2ALZA 4YFKA 3JPPA 3ISBA 4M9LA 3ZD8A 4TQSA 4M2YA 8ICNA 5KFQA 3M8RA 1D9FA 4BWMA 8ICEA 4I2IA 2DPJA 4WC1A 4NM1A 5DGAA 4Q44A 4B9VA 3MDAA 7ICKA 4ECVA 4E8FA 2M9NA 2UVWA 5HRKA 4I2CA 4RUAA 3UQ0A 5J2EA 5DQGA 3OJUA 4X4UA 4Z6EA 4ECRA 5HREA 8ICPA 2MUTB 7ICGA 4AT9B 2XY6A 1QSYA 2GWSA 5HMMA 2BDPA 1BGXT 5CB1A 7ICIA 1IXRA 3H38A 4AT9A 3UQ2A 4EBJA 1BPXA 2DVIA 3GIMA 4DF4A 1NJYA 5F9LA 3PNCA 3ZD9A 2R8JA 4I28A 4M6WA 3PW7A 2IMWP 2XO7A 7ICQA 2DR7A 4PGQA 1X9SA 3SV4A 4UB5A 3OHAA 2W8LA 2ASLA 1V4AA 3TANA 4KLQA 3SZ2A 7ICSA 4P2HA 2NRWA 4Z6CA 5J0TA 4IQTA 3UPQA 1S97A 1TVAA 1NJZA 2ASJA 4HYKA 2AGOA 5HRBA 4F5NA 4NM2A 4ZH4A 5KFHA 3N97B 2FMSA 2KZZA 2ISPA 4J9NA 1TK5A 5EWEA 2W9MA 4J9RA 3BQTA 1K1QA 2F1JA 1ZQVA 3E2EA 1U9LA 3EWAA 4R63A 1S77D 4BWJA 8ICMA 1NK5A 4UB3A 2JEFA 3KTQA 5DECA 1T4GA 4DQQA 1ZQDA 2I1QA 2MAXA 3RB4A 4UQGA 3C23A 3PX6A 4R65A 4ED0A 2AJQA 4RPXA 3MGIA 3T5HA 1MIWA 2HHTA 4EEYA 3RTVA 5IILA 4KLOA 7ICLA 5J2KA 3V6HA 2ZUCA 5C5JA 4KMUA 4MF2A 1XSNA 8ICYA 1VJ7A 4X4VA 1K1SA 4M9HA 2C2RA 4KLMA 4X0AA 4KLDA 1EXNA 4DOAA 3GIIA 3RB3A 1XC9A 1KLNA 4X5VA 4MFCA 9ICHA 4I2DA 4F2SA 2BCRA 4WC0A 4J9OA 3H4BA 1JAJA 1DOQA 4IQUA 5F9NA 1S0NA 4DFPA 5IIIA 1TK8A 5D46A 4JV2A 4X4QA 3Q8MA 1KSPA 4KLJA 4WBZA 1MQ3A 4F4XA 1NK8A 4YCXA 1S76D 1KEJA 1B22A 4I2BA 4RQ1A 1SKRA 4GC7A 3HX0A 1UEVA 4M9JA 4WC4A 3LDAA 4IR1A 4ATBB 1WOTA 3WFPA 4F2RA 9ICWA 2A1JB 4QW8A 2J6UA 3H39A 4CCHA 1TFYA 2P66A 3MGHA 2NRXA 1RYRA 1TK0A 5KFYA 4PHDA 1BPDA 2A1JA 1CUKA 3WFOA 3PVXA 5KFEA 2PI5A 5IINA 4O3OA 1NZPA 3PR5B 1N48A 9ICBA 2NRKA 5KFZA 4YN4A 1KFDA 4RZRA 2ISOA 2VA3A 9ICGA 7ICRA 5J0SA 3RJIA 4PGYA 1D8YA 4JWMA 1JQRA 5HRLA 1UT8A 2F1HA 2BCQA 1QSSA 3UXPA 5L1JA 3RR8A 3T5KA 4QZFA 5KFFA 3V6JA 1R8CA 4WC3A 2O1PA 4UB1A 3JPNA 1UT5A 2W9BA 4MFAA 1U4BA 2XGQA 2Y1IA 4YR0A 4DF8A 2H5XA 1NKEA 4DSKA 2W8KA 1XSLA 1QSLA 3THVA 2V9WA 4LZDA 7ICUA 2AQ4A 1Z3EB 3FDSA 5KFGA 4I2HA 3V7KA 5EOZA 8ICRA 5DG9A 1PZNA 2DPIA 3GIKA 4GXJA 4EBCA 4GXKA 3PX4A 5HC9A 4JK1A 3RJFA 4RPZA 3QZ8A 5J0RA 2M2UA 4M9GA 7ICHA 2UVUA 2PFQA 9ICUA 2ZH2A 5DBAA 2NRZA 5J2CA 1KFSA 4J9QA 3H7IA 4F50A 3K4GA 4RT3A 8ICGA 5KG2A 9ICXA 1S0MA 1H38A 1TFWA 1UA1A 4EBDA 3TFSA 3LK9A 2DRAA 5IIJA 5KFMA 5DKWA 4UBBA 4PHPA 5J2DA 1OU5A 2C2EA 5BOLA 4MF8A 1U45A 2R8HA 3JPOA 4RU9A 9ICEA 4P4PA 2M2WA 4RQ7A 4I2FA 3ZDCA 4YR3A 4JV1A 4X4NA 2BR0A 4DOCA 3EZ5A 4MEXA 2I9GA 2KFZA 4WC5A 5KFXA 1ZQZA 1NOMA 4QZCA 5HR9A 3BQ1A 4DSFA 4ELTA 2IHNA 4E7XA 4YP3A 3UXNA 4F8RA 3H8JA 3ISDA 1Y88A 1U48A 2P6UA 3LQCB 4XQ7A 3PR4A 4Q8FA 4F3OA 4XRHA 8ICCA 3GFKB 1ZQBA 3TAQA 5KFSA 3OSNA 3Q8QB 4EYIB 1U47A 1NKCA 5KFVA 2WTFA 2PFOA 3IM1A 9ICKA 3KHGA 1ZQGA 2ZTCA 5KFNA 3GV8B 2C2DA 3MR5A 4KLHA 4RNNA 3EYZA 3H3AA 4IQVA 5KT6A 2HW3A 1JX4A 1BPEA 3EW9A 4DL7A 1NK6A 4DSJA 4KLLA 2DR9A 4WCWA 4RQ5A 4O0IA 1SZPA 4Q45A 1RPLA 4PH5A 4ECUA 9ICOA 5BPCA 5DLGA 4NXZA 9ICFA 4ED7A 4UB2A 1D9DA 4LVSA 4KITB 3OVAA 4QWBA 1T7PA 4K4IA 3RAXA 2BQ3A 4RWNA 3C5GA 1S0VA 3Q8PB 8ICVA 4AT8B 2JEJA 3KHLA 1XU4A 4XQ8A 5HHIA 2C22A 1COOA 1KRPA 4RQ6A 2VA8A 1ZQFA 4RNOA 4Z6DA 3MFIA 3Q8LA 4F5RA 3BJYA 4EBEA 8ICKA 1Z00A 4UAZA 4RUCA 3MR6A 1L3VA 1ZQKA 4NLKA 1R8BA 1Q79A 2ZH4A 5J2GA 2BHNA 8ICZA 2VANA 4QZAA 3NYBA 3H37A 4M04A 9ICMA 4Z6FA 3HP6A 5KFIA 4YG2A 3IHQB 5KFRA 5DBBA 5J2BA 3ZDAA 4UD4A 3AQLA 5HRIA 4IRKA 4J9PA 5KFDA 3HJ4A 4ECWA 3RR7A 4Q43A 5KG7A 4FO6A 4X4SA 4X4RA 4P4OA 4RWQA 1SL1A 4KLEA 1R89A 2Q0ZX 5DG7A 2FMPA 2HVIA 5HRFA 1Q78A 4FH3A 1KNYA 4X4OA 2ZH8A 4FBTA 4BDPA 2Q66A 2BQRA 4TUPA 1WCLA 1XO1A 4F91B 3OSPA 1KTQA 8ICWA 9ICQA 4IR9A 4ATBA 4IG8A 1ZQTA 1KFTA 1BPYA 1Z00B 3ORYA 4FHXA 4B9NA 2ZH1A 4F4YA 2UVRA 4B9MA 4YMOA 2HHPA 1ZQEA 3Q8RB 4QWCA 4ED8A 1RXVA 2ID1A 2JZBB 4DFKA 1UA0A 1MQ2A 8ICBA 3Q8KA 3OJSA 3PW5A 4DL5A 5DB8A 4J9LA 4YXMA 5CJ7A 3RH6A 4TQRA 2JZBA 1NK9A 2BQUA 3PO4A 8ICHA 9ICIA 4FH5A 5J0QA 5L9XA 5DB7A 5KFAA 2RDJA 1ZQXA 5DQIA 1ZETA 4J9MA 1BPZA 4JV0A 4R8UA 9ICPA 3JZ0A 8ICOA 7ICPA 4C8OA 4O5EA 5J2IA 2FPLA 1U49A 4O3SA 4JUZA 3PMLA 3T5JA 4NY8A 3H8WA 4O3NA 3G6XA 4YVZA 2W9BB 3LWMA 4QWAA 3HPOA 2XCAA 3TAPA 2ASDA 2AU0A 2KP7A 5KT4A 4M5DA 4F4ZA 1JXEA 5CWRA 3V7JA 3B0XA 3PW2A 4ED6A 1NK7A 1L5UA 8ICSA 3FYHA 4QZHA 4UBCA 3OHBA 3ETLA 5JUMA 1L3TA 2IBKA 8ICQA 3AQMA 2ZHAA 5IIOA 4UAWA 2ZJ5A 4YD2A 5J0UA 4P4MA 4RQ0A 1L3UA 3H40A 4F4KA 4NLGA 1MC8A 1NO5A 4AT8A 3TARA 2HHUA 4WC7A 2M2VA 7ICEA 3C2MA 4EZ6A 1QLNA 3PV8A 3H8SA 4GC6A 5DGBA 5HP4A 1NK0A 5CP2A 2FLPA 3PO5A 5D4BA 4KLUA 9ICAA 1C7YA 4NLZA 4KN4A 3AQNA 1JXLA 1NJXA 3GILA 1ZQJA 3V72A 4X0BA 4C8NA 2XC9A 3L9DA 5KG1A 4R8UB 1KDHA 4QZBA 3C1YA 3MABA 1XS9D 4G3IA 4WBYA 2W9CB 2R8IA 5KG0A 4QZDA 4GLXA 8ICFA 4XUSA 1ZQPA 8ICUA 3JYYA 1SKSA 4I2JA 2ZUDA 9ICTA 2ZH5A 4ECSA 8ICXA 3HW8A 3T3FA 2JEIA 2IHMA 2J6TA 3BQ2A 4QZIA 5CA7A 1ZQLA 2RDIA 2IA6A 2PFNA 3RJEA 4RQ3A 1ZJNA 4F93B 4FHVA 4RT2A 3C1ZA 3RJJA 3QEBZ 5KFTA 3NGDA 1SKWA 3C2LA 3M9NB 4YD1A 4FS2A 2NRTA 2BGWA 1HUOA 1CEZA 2PI4A 4DOBA 5HRGA 1FA0A 4DSIA 4AT7A 4GXIA 4DL6A 4DL3A 4R64A 2NRVA 4RNMA 1S9FA 4JWNA 4RPYA 4EYHB 2KFNA 1DGSA 4IRCA 2O5AA 1TAUA 1TV9A 3JPRA 4AT7B 3OUYA 5KFKA 1LV5A 2XY5A 1ZQHA 4BGDA 3K75D 4EP7A 4KN7A 4UD5A 2KZ3A 2AQ0A 3OUYB 3RH4A 4QZ9A 9ICCA 2DFLA 1MIYA 1JIHA 3PMNA 4M9NA 2W9CA 1V9PA 2XY7A 4DLGA 2BCUA 4DSLA 4ELUA 4F5QA 4IRDA 3OV7A 2FPMA 4TUSA 4ECYA 3HIYA 3SYZA 1QTMA 4LT6A 2ZH6A 4KLIA 2Y1JA 1N56A 5KG6A 4YR2A 4MFFA 9ICNA 3WFRE 5KG3A 1HJPA 3C2KA 1ZYQA 5J29A 4FHPA 1HUZA 4YMNA 1MSWD 4DQIA 1F5AA 2DR5A 4DEZA 2ZHBA 5KFWA 3RJHA 4XA5A 4Q8EA 4DFMA 5L1LA 5HNKA 4M47A 2ZJAA 4QWEA 4ECXA 4KLTA 3EPGA 2HHSA 4I2EA 5KFLA 5KT5A 3MDCA 3GIJA 4KTQA 5DEDA 5IIKA 3T5LA 4DL4A 5KT7A 2AGPA 3B0YA 4F4WA 1T8EA 4DLEA 4DWIA 4NKTA 2KN7A 2JEGA 5DBCA 4DQPA 1A77A 3GV7B 5DB6A 4E0DA 3ISCA 2FLNA 9ICRA 1ZQSA 7ICNA 1ZJMA 2XGPA 1NJWA 1IM4A 3SV3A 4J9SA 4B9LA 4B9SA 5L1IA 2ZJ8A 4F5PA 9ICJA 4M0AA 3GV5B 1X2IA 2OWOA 3GQCA 5EWGA 4PHEA 3QEAZ 3M9OB 4FS1A 1A76A 2FLLA 4C8MA 5HMLA 3HWTA 3SI8A 5KTQA 5J2FA 5KFOA 2FPKA 3C5FA 9ICVA 2BE3A 4M6WB 3Q8SB 4IQWA 1JMSA 5DB9A 3QE9Y 3RJGA 2VA2A 7ICMA 4NKUA 3WFSC 1L3SA 3RRGA 4BXOB 3HT3A 2HHXA 4QZGA 4LZGA 4QW9A 3MBYA 4DSEA 2KZMA 4YQWA 1ZQMA 4PPXA 1R8AA 5HHHA 4O5CA 5KG5A 1LB2B 2R8GA 3UXOA 1DK2A 4FHWA 2BCSA 2B21A 1ZQRA 2BPCA 2DR8A 3M9MB 3RBDA 3G6VA 1PX5A 3V6KA 3C66A 3G6YA 5IIMA 3RB6A 2AGQA 2ZTEA 5DDYA 3PX0A 7ICVA 4EBKA 2UVVA 4X4PA 1ZQOA 5DLFA 4MEYA 1BPBA 3N4MB 3UPSA 5KFPA 2HHWA 3OVSA 2BPGA 3MR2A 4QZ8A 4RQ8A 4TURA 4DL2A 5TZVA 1X9MA 2R8KA 2HHQA 9ICLA 2FMQA 7ICFA 1RZTA 3MR3A 2ZH9A 1ZQWA 4R66A 1S10A 8ICAA 4O9MA 4J9KA 2J6SA 5EWFA 8ICIA 4RWOA 3OVBA 2XCPA 3AU6A 4ED1A 2V4RA 3RBEA 7ICTA 3HJ1A 4K4HA 5BOMA 1S0OA 3RJKA 7ICOA 4FHYA 3PW4A 4YXJA 3EPIA 5L1KA 4ECQA 3RAQA 2W9AA 5J2HA 2V4QA 4DFJA 1UEUA 1XWLA 4I27A 3GDXA 5CR0A 1B43A 5D49A 5KFBA 5F2VO 5KFUA 5J0YA 2MUTA 3QZ7A 4ED2A 2ATLA 3LWLA 1DK3A 3AU2A 4ECTA 3C18A 5HRDA 1TKDA 4KLSA 4E80A 2BCVA 1SL0A 2LYHA 2F1IA 1XSPA 2BPFA 1VFGA 4WC2A 4ECZA 4QZEA 4O3QA 8ICTA 4B9UA 1NK4A 4DS5A 4QWDA 3ZDBA 9ICSA 4X4TA 4I2GA 4FBUA 4KLFA 2ZH7A 4O3PA 5KG4A 1TFRA 3TQ1A 3RB0A 1SL2A 1ZQAA 2PBEA 4C8KA 3NTUA 2RFFA 3BQ0A 5DG8A 1ZQNA 3V7LA 3OGUA 1ZQCA 1JN3A 7ICJA 4PHAA 5KT3A 2HVHA 2ZUBA 5KFCA 5J0OA 4B9TA 4O5KA 4RQ2A 3RH5A 8ICLA 2DRBA 3TI0A 3WFQE 3JPQA 3AUOA 1WCNA 1ZQUA 3M8SA 1ZQQA 1BVSA 4C8LA 2PXIA 1ZQIA 4ELVA 4BXOA 5CHGA 5J0WA 3PY8A 1MIVA 3AQKA 4DQRA 3BDPA 5DDMA 3RRHA 3TFRA 3C21A 1RXWA 1RYSA 3PW0A 4NLNA 1YLQA 3JPSA 4I29A 4UB4A 4YMMA 3MFHA 4UAYA 4F5OA 4DQSA 2M2TA 2ZH3A 5KFJA 4F92B 4DO9A 2BKEA 4O3RA 5J0PA 2KTQA 5HRHA 4RWPA 4WC6A 3KHHA 4K4GA 8ICJA 1ZQYA 4TUQA 5J2JA 1BNPA 4S3NA 1AROP 4RQ4A 1UETA 5KT2A 1NKBA 3H4DA 2HHVA 5J0XA 1X9WA 4ED3A 5J2AA 1BNOA 4PGXA 2ZTDA 5DQHA 1TAQA 3ZDDA 4EZ9A
chains in the Genus database with same CATH superfamily
4NXXA 2PFPA 2WF5A 4TQSA 2IHOA 2F8LA 2VJ5A 3M8RA 4BWMA 4WC1A 2DPJA 5DGAA 4Q44A 4ECVA 2M9NA 3NRWA 2JMGA 3UQ0A 4X4UA 4Z6EA 4ECRA 5HREA 2MUTB 1QSYA 2BDPA 1VLBA 5CB1A 7ICIA 3UQ2A 2DUYA 2BZFA 1BPXA 2DVIA 3GIMA 1NJYA 2GA9D 2IMWP 3QU2A 2XO7A 2F76X 1XO0A 4PGQA 4UB5A 2K89A 4FZMA 3OHAA 2W8LA 4KLQA 3SZ2A 1S97A 5ALUA 4I0UA 2F77X 4ZH4A 5EWEA 3E2EA 8ICMA 1S77D 4BWJA 4US9A 1WUDA 3KTQA 4OJ6A 4CRXA 2MAXA 3SMVA 5CHEA 3C23A 4RPXA 7ICLA 2ZUCA 5C5JA 3ER9B 2JH7A 1XSNA 2OM6A 3I76A 1KLNA 1XC9A 1QQ5A 2K8CB 4F2SA 4J9OA 1JAJA 1DOQA 1Z1VA 4X4QA 4MHVA 1ZD2P 1MQ3A 1YT3A 4CF3A 1SKRA 4GC7A 1UEVA 4IR1A 3SQIA 2LMRA 2ESEA 4U7CA 4F2RA 2A1JB 3K1RB 2P66A 1XNSA 1CUKA 5ALNA 3KKAA 1N48A 5KFZA 1KFDA 1X6JA 2W03A 4LJXA 3F2DA 2F1HA 2W55A 5K4LA 1R8CA 4QZFA 5KFFA 4EZ9A 2W9BA 2XICA 3NS1A 4PZNA 1U4BA 4YR0A 4DSKA 3E0FA 2W8KA 3I1YA 3THVA 1Q46A 7ICUA 2AQ4A 1L8OA 5EOZA 8ICRA 5DG9A 1PZNA 2DPIA 2QB0B 5AIBA 9ICUA 4NXWA 2XI9A 1KFSA 4F50A 4UARA 3K4GA 4RT3A 1H38A 3TFSA 2H3VA 3LK9A 2DRAA 5AM2A 1SWWA 3M6ZA 3N28A 3CYMA 1U45A 3DDHA 1IV8A 3HRDD 3EZ5A 1RG6A 3H8JA 2P6UA 3LQCB 4XQ7A 3EUB2 4P0PB 5AK5A 2PFOA 5KFVA 1VDVA 2KSOB 4JLZA 3GV8B 4K96A 2RP5A 1BPEA 2HCFA 3EW9A 9ICOA 1RPLA 3DEEA 3OVAA 1T7PA 4K4IA 1S0VA 5T14A 2JEJA 2P35A 2C22A 1ZQFA 4RNOA 4Z6DA 3Q8LA 4EBEA 1Z00A 3MR6A 4RQMA 2VANA 4QZAA 2LPEA 3HP6A 3IHQB 5KFDA 4FZNA 3RR7A 4FO6A 5L1MA 1N2XA 5J8YA 1R89A 2HVIA 4FH3A 1KNYA 1PVPA 2KV2A 1WCLA 2KKVA 4F91B 4IR9A 4ATBA 1L7MA 2HBKA 2W43A 1Z00B 4B9NA 3S6JA 2HHPA 1UQVA 4QWCA 4GIBA 2JZBB 1UA0A 1MQ2A 3NVVA 2QARB 4DL5A 2KFZA 4J9LA 5CJ7A 3PO4A 3CNHA 2RDJA 1ZQDA 4J9MA 1BPZA 3JZ0A 2BBHA 2IOFK 3PMLA 4NY8A 2KICA 5C0YA 3TAPA 4YVZA 2W7PA 4QWAA 3HPOA 2ASDA 2AU0A 5KT4A 1L7OA 5ALMA 1JUDA 1L5UA 2OCEA 3HJEA 1COKA 2H3FA 5IIOA 5AIAA 1L3UA 2ZHBA 5B3QA 4WC7A 1SXDA 3TARA 7ICEA 3C2MA 1QLNA 3PV8A 4KLUA 5D4BA 4NLZA 4KN4A 3AQNA 1JXLA 2XC9A 2K8BB 1PK1B 3WU2U 4QZBA 2W54A 3MABA 5KG0A 4I2JA 9ICTA 4NXVA 2MRLA 2IA6A 4FHVA 1NZBA 4N7RA 1FO4A 3C2LA 4YD1A 2NRTA 2K60A 5KNIA 4DOBA 4Y2YA 4AT7A 4GXIA 3WK5A 4RNMA 4R64A 2KFNA 2KJ9A 2O5AA 1TV9A 2XY5A 3K75D 4EP7A 3OUYB 1RQLA 3HKZC 4M9NA 4IRDA 4DLGA 3OV7A 3KBBA 2H3ZA 2ZH6A 2PKEA 3BS5A 5KG3A 4FHPA 1HUZA 4PL2A 2DR5A 1SV0C 3LVVA 4Q8EA 2HHSA 2F8KA 1ZXIA 4HAIA 4KTQA 1SZHA 5DEDA 5IIKA 4DL4A 5KT7A 3B0YA 4NKTA 4NJ8A 5DBCA 1A77A 1ZQSA 7ICNA 1ZJMA 2IUBA 4B6JA 3SV3A 5ALHA 2XIDA 2ZJ8A 4F5PA 1YZ6A 1HEKA 4PHEA 1X6IA 5EE1A 2RQ5A 4C8MA 3GU3A 1MN8A 2BE3A 3Q8SB 3RJGA 2VA2A 1L3SA 3ONNA 5ALZA 2L5YA 2ZXIA 2HHXA 5AI0A 1ZQMA 4ZOHC 5KG5A 2R8GA 3M9MB 2KSOA 3RBDA 3V6KA 4CGZA 5DDYA 4IC9A 3PX0A 2UVVA 3OVSA 2AH5A 2HHWA 2BPGA 1OXJA 3MC1A 3CW2C 2B51A 1RZTA 3NRZA 2DBYA 1ZQWA 4R66A 1PVQA 8ICAA 2Y0SF 5EE9A 4J9KA 4O9MA 3OVBA 2XCPA 3AU6A 2FDRA 3J81j 3HJ1A 2CXYA 3EPIA 2R18A 2W9AA 4DFJA 1UEUA 3GDXA 1A0PA 5D49A 5KFUA 5J0YA 2MUTA 4ED2A 1F0MA 3C18A 2FE9A 4ECTA 1WG8A 5HRDA 3U26A 2E1EA 1NNLA 2LYHA 2F1IA 1XSPA 4EELA 3B9JA 2LYBA 9ICSA 4KLFA 5AM0A 2HBMA 3IP4B 4O3PA 4F71A 1ECWA 2PBEA 3ZI4A 3ER8C 1ZQNA 4Y2RA 2EWRA 4PHAA 5KT3A 8ICLA 3WFQE 3AM9A 5CHGA 5J0WA 3PY8A 1MIVA 3AQKA 3BDPA 1YLQA 2YQEA 1JRPA 4F5OA 1X42A 5A0LA 4DQSA 8ICJA 3QNMA 1NKBA 5J0XA 1T3QA 3NVOA 3F2BA 4GXJA 3ZDDA 4EX7A 1O08A 1T3NA 2P6RA 2C28A 3I28A 2DGZA 4GFJA 3JPTA 3ISBA 5AKKA 4I2IA 5ALEA 3MDAA 4E8FA 5HRKA 5DQGA 4AT9B 2XY6A 2GWSA 5HMMA 1L8LA 4P0PA 4DF4A 4P0QB 3IRUA 3PNCA 2R8JA 2WHEA 7ICQA 4HX0A 1KW4A 1V4AA 2VKQA 4P2HA 7ICSA 2VJ4A 5J0TA 2EZZA 3UPQA 1TVAA 4HYKA 3N97B 5AKIA 5AM5A 4J9NA 2ISPA 2KZZA 4J9RA 1K1QA 5JRTA 1U9LA 4R63A 1NK5A 2I1QA 2Z7JA 3TKAA 1WWVA 2HHTA 3RTVA 5IILA 2E3TA 3V6HA 2FI1A 4MF2A 1VJ7A 1ZRNA 4KLDA 1EXNA 3GIIA 9ICHA 2BDUA 2EH9A 3HILA 4K99A 4IQUA 1L7PA 1LVHA 4WH5A 4KLJA 1KSPA 4F4XA 1B22A 4I2BA 4RQ1A 3HX0A 4EENA 2FCLA 3H0RB 4ATBB 3PZPA 9ICWA 2J6UA 3H39A 2NRXA 1TK0A 5KFYA 4PHDA 4JB3A 4UB8U 5ALKA 2G5IB 5IINA 1NZPA 3QUQA 3PR5B 2EAPA 4YN4A 2A19A 2ISOA 1Q8KA 4BUGA 7ICRA 2HBLA 1D8YA 1UT8A 3H8MA 3SAHA 2BCQA 1QSSA 3RR8A 5L1JA 4WC3A 5ALXA 4IL6U 2LKYA 1FEZA 2D3DA 5CFTA 4EEKA 4DF8A 2G0AA 1XSLA 2V9WA 4UAUA 4I2HA 3V7KA 4WQKA 4K9BA 3CRXA 2GLEA 3RJFA 3WK8A 4RPZA 4M9GA 7ICHA 5AKEA 1KL9A 1JI7A 3H7IA 9ICXA 1UA1A 5IIJA 4LEYA 2B6GA 2KG5A 4ACOA 1OU5A 5ALGA 2C2EA 5D61A 2KJ8A 2A3VA 3JPOA 4RQ7A 3ZDCA 1V97A 2I9GA 1ZQZA 1NOMA 4G9BA 2IHNA 4YP3A 3UMBA 4XRHA 5KFSA 3OSNA 4EYIB 9ICKA 1ZQGA 2C2DA 4KLHA 2HSZA 3NUQA 4Y2TA 3EYZA 4IQVA 5J8YC 2HW3A 4DL7A 1NK6A 4WCWA 4Q45A 4PH5A 5BPCA 3M6KA 4Y2UA 9ICFA 2KD1A 2BQ3A 8ICVA 3Q8PB 2AXTU 4UW9A 3KHLA 2KOBA 3PSPA 1KRPA 4RQ6A 2ZG6A 3MFIA 8ICKA 2KKPA 4RUCA 1L3VA 4NLKA 1URJA 5J2GA 2BHNA 8ICZA 3NYBA 3SAGA 4F72A 3H37A 4RQNA 5KFIA 5KFRA 3F5AA 5HRIA 4IRKA 2E8NA 4ECWA 1VJ5A 4Q43A 4P4OA 4KLEA 4Y2QA 5DG7A 4FFDA 5HRFA 4X4OA 2OYYA 4BDPA 2Q66A 4TUPA 1ZQTA 5AKYA 3ORYA 2ZH1A 4B9MA 4YMOA 4OD0A 3ICXA 3WKCA 2OXOA 4ED8A 2Y9UA 3N7PD 3OTQA 8ICBA 5GTHU 3Q8KA 2K4HA 3PW5A 4YXMA 9ICIA 4TQRA 2BQUA 1ZQXA 5DQIA 3BS5B 3DV9A 1ZETA 1UPHA 8ICOA 4C8OA 4JUZA 2B56A 4JLXA 4Y2JA 1N63A 3H8WA 4O3NA 3G6XA 4IS7A 3B0XA 1DXSA 4OAHA 5AM1A 3E58A 3FYHA 4QZHA 3AQMA 2ZHAA 2F44A 4UAWA 4YD2A 4NLGA 3H40A 2A1AA 4AT8A 4EZ6A 3H8SA 5DGBA 5CP2A 3QYPA 2PMZC 1ZRMA 1NI3A 3OPXA 5KG1A 4AYBC 4KMOB 3UMGA 2W9CB 2R8IA 8ICUA 4GLXA 8ICFA 4XUSA 3MCRA 4QIWC 2ZUDA 2ZH5A 3HW8A 3T3FA 2MU2A 1TE2A 2RDIA 2PFNA 2G07A 1N62A 2HBJA 5AKJA 4RT2A 3RJJA 3JYYA 3M9NB 1SB3C 1TAMA 4FS2A 3C29A 4DSIA 3AL0B 5AKHA 1S9FA 1KKXA 3JPRA 1ZQHA 1IG6A 2KZ3A 3RH4A 4QZ9A 9ICCA 1MIYA 2W9CA 2BCUA 4ELUA 2FPMA 3QU7A 4TUSA 2K8AA 4LT6A 5F3XB 4KLIA 5KG6A 3IG8A 1Q3UA 4YR2A 9ICNA 1ZYQA 1HJPA 3C2KA 5J29A 1C20A 2ODGA 3LVWA 1F5AA 4DEZA 3PSIA 3BZCA 4XA5A 4OCZA 4ECXA 4KLTA 3MDCA 3LYSA 1L7NA 2AHOB 2WAQC 3QX7A 5KL8B 3AQFA 2JEGA 4DQPA 5DB6A 1D8BA 3F53A 3GV5B 2KNJA 3QEAZ 2FLLA 1WYGA 9ICVA 3NASA 4CF5A 1JMSA 3QE9Y 4J03A 3RRGA 3MBYA 4O6AA 1V38A 5HHHA 3K7DA 3UXOA 2BCSA 2DR8A 2BPCA 1PX5A 4FO1A 3C66A 3UM9A 3G6YA 1FIQA 5IIMA 1CI4A 4NV0A 2ZTEA 1ZQOA 5DLFA 3UPSA 5KFPA 3MR2A 5ALLA 3KFUF 4U6PA 2ZH9A 3IN5A 2EZYA 2WB1F 1S10A 4A8EA 3QU9A 5EWFA 2JGAA 8ICIA 5AKGA 7ICTA 3PW4A 3RAQA 5B66U 2YMLA 5KFBA 2ATLA 2NYVA 1DK3A 1TKDA 4E80A 2KHVA 2WF6A 3RF9A 1VFGA 8ICTA 4QWDA 1RDFA 1TFRA 2JR5A 3TQ1A 5ALOA 3L3FX 3NTUA 3FC4A 5G5HA 3BQ0A 4OJOA 2NO4A 3V7LA 7ICJA 2WF8A 2ZUBA 4B9TA 4O5KA 2DRBA 3AEVA 2JXJA 4NLBA 1ZQQA 4UB6U 1BVSA 4C8LA 1X9XA 1ZQIA 4BXOA 4DQRA 3C21A 1RYSA 3PW0A 2F3NA 4F92B 4O3RA 2KTQA 5HRHA 2KMDA 3KHHA 4K4GA 4S3NA 1AROP 1UHUA 5ALYA 4LEWA 1BNOA 3QXGA 2ZTDA 5DQHA 5GTIU 3KHRA 4DS4A 3C28A 2M0NA 3ZDEA 4WJ3B 4YFKA 3ZD8A 4DFDA 8ICNA 1PUZA 1UCVA 3BZKA 8ICEA 4NXUA 4I2CA 3KD3A 5ALTA 2E5SA 7ICGA 2RRDA 1BGXT 2CN1A 2W3SA 5ALRA 1Q3VA 4EBJA 3QUTA 4CE6A 3PW7A 1J2MA 3BS7A 2DR7A 1X9SA 3SV4A 2ASLA 1DRGA 4IQTA 2B0CA 1SIJA 5KFHA 2FMSA 2IOHA 1TK5A 5KAIU 2F1JA 3EWAA 2OH2A 5D62A 4OO1J 2JEFA 5DECA 4DQQA 3RB4A 1MIWA 3PX6A 4R65A 4ED0A 2AJQA 3MGIA 3T5HA 3OWGA 4EEYA 4KLOA 4CF4A 5J2KA 2KE7A 1OUQA 1K1SA 4P0QA 4M9HA 4KLMA 4DOAA 4I2DA 2BCRA 4WC0A 4DFPA 5IIIA 1TK8A 5D46A 4JV2A 2HMXA 4YCXA 1KEJA 1KBUA 1F5SA 1WOTA 4Y2SA 2ZIUA 1TFYA 2EAOA 3ERCC 1YZ7A 1SWVA 1BPDA 2A1JA 4O3MA 5KFEA 3WKEA 5ALDA 2NRKA 3WK7A 2VA3A 2GH1A 5J0SA 3RJIA 5HRLA 2DKXA 3VCBA 3V6JA 2O1PA 4UB1A 1UT5A 4MFAA 3WK9A 2WAQF 2H5XA 2CPRA 4BJQA 3IDWA 1Z3EB 2ZIVA 2ZIUB 2O6KA 3QU4A 4EBCA 4GXKA 3PX4A 5HC9A 3PHZA 2EQYA 4JK1A 2UVUA 5B3PA 2ZH2A 5DBAA 3ETRA 3N7RC 1TFWA 2YX8A 3PSTA 4US8A 2W11A 4EBDA 5AI4A 5DKWA 4UBBA 1MA7A 1Z4NA 2MSNA 3NVZA 2W7OA 9ICEA 4P4PA 4I2FA 4JV1A 4YR3A 5HR9A 5ALFA 2ZIVB 4E7XA 1Y88A 3PR4A 4F3OA 8ICCA 3GFKB 1ZQBA 1U47A 3KKAC 1NKCA 2LM1A 2LM4A 2ZTCA 5KFNA 3MR5A 4RNNA 3F5EA 5KT6A 2K4EA 1JX4A 4DSJA 4KLLA 2DR9A 4O0IA 1SZPA 4OAFA 4NLCA 4NXZA 4EX6A 1FFUA 4KITB 4QWBA 3RAXA 4RWNA 3C5GA 4AT8B 3QUCA 1XU4A 4XQ8A 2E8MA 5HHIA 5JTIA 4F5RA 1Q79A 5B5EU 5ALIA 4M04A 4OJLA 2DWQA 1RYUA 2EAMA 4YG2A 3ZDAA 3AQLA 2DL0A 5EE3A 2E1FA 5AK4A 3HJ4A 4X4SA 1O03A 5KG7A 4RWQA 1SL1A 1RM6C 2FMPA 2ZH8A 3OSPA 1P7DA 4IG8A 2KVSA 1BPYA 4FHXA 2GOLA 5EE0A 3Q8RB 1OW5A 3VC8A 3OJSA 2I6XA 2JZBA 5L9XA 5DB7A 4PZOA 4F4KA 1V85A 3TACB 2FJ6A 3SD7A 4O5EA 5J2IA 2FPLA 5AK6A 4O3SA 3T5JA 2KP7A 1Z1BA 3V7JA 4ED6A 1L3TA 3OHBA 5JUMA 1HIWA 5J0UA 4P4MA 4RQ0A 5AI8A 1MC8A 1SV0A 4GC6A 1NK0A 2FLPA 3JCFA 2YN4A 4ICAA 4C80A 1PK1A 5HR6A 1NJXA 1ZQ1C 1ZQJA 4X0BA 4C8NA 5AI9A 3L9DA 3A0HU 3C1YA 5AI5A 4WBYA 1ZQPA 2H3QA 4ECSA 2QB1A 8ICXA 2BBJA 2IHMA 2JRZA 3BQ2A 4QZIA 1ZQLA 2HN2A 1SXEA 1ZJNA 4F93B 1SKWA 3NGDA 4K9AA 5HRGA 4DL3A 2EDUA 2NRVA 5ALSA 1ZOLA 4UAVA 1DGSA 3OUYA 4AT7B 5KFKA 1LV5A 3L5KA 4KN7A 4UD5A 2AQ0A 2KEYA 3TADC 3ED5A 1V9PA 2XY7A 4F5QA 3BQ7A 3HIYA 3SYZA 1QTMA 4MFFA 1X40A 3WFRE 3QU5A 4DQIA 3SAFA 1B0XA 3RJHA 5L1LA 5HNKA 4M47A 2ZJAA 4QWEA 5KT5A 3T5LA 2AGPA 2I5HA 4NXTA 2HN1A 4DLEA 5KL1B 2KN7A 3ISCA 2FLNA 4FZLA 4J9SA 4B9LA 4B9SA 5L1IA 1X2IA 3GQCA 5EWGA 4XJEA 4AYBF 4FS1A 3SI8A 5HMLA 3HWTA 5KFOA 3C5FA 2MA1A 5KAFU 4C7YA 4DCCA 5TISU 1J97A 4BXOB 3HT3A 4QZGA 4LZGA 4QW9A 2KZMA 4YQWA 4PPXA 4O5CA 1DK2A 4FHWA 1ZQRA 3G6VA 3KZIU 2AGQA 3RB6A 3D2SA 4EEBA 2WF9A 7ICVA 4EBKA 4MEYA 5ALVA 4QZ8A 4TURA 4DL2A 9ICLA 4LEZA 2YMQA 2FMQA 7ICFA 1KQQA 3MR3A 2D6FC 2J6SA 2NV3A 2KIWA 2V4RA 2JH1A 5BOMA 1S0OA 3RJKA 5JU5A 7ICOA 4FHYA 2V4QA 4C4TA 3QZ7A 5AKXA 3QUBA 5ALWA 4NL9A 2BPFA 4WC2A 1ZD4A 4QZEA 4ECZA 4QJFB 4O3QA 4B9UA 2YY6A 1NK4A 4DS5A 4FBUA 3RB0A 1ZQAA 2RFFA 1ZD5A 1SGGA 5DG8A 4EEDA 5KFCA 5J0OA 2HI0A 3RH5A 3TI0A 3JPQA 3AUOA 2Y9TA 1PK3A 2PXIA 2LBOA 1N5WA 4EGWA 3TFRA 3JPSA 4UB4A 5AM4A 4UAYA 3CK6A 2ZH3A 2BKEA 4USAA 4WC6A 1T94A 4OAGA 2F2AB 4TUQA 1BNPA 5J2JA 4RQ4A 5KT2A 5JTGA 3NVWA 4ED3A 5J2AA 4PGXA 2DQNB 1QCKA 1TAQA 4I29A 3WK6A 2YTUA 2B4VA 1D8LA 4KLGA 4I2AA 2ES6A 1M6YA 1X66A 2ALZA 1PVRA 3JPPA 2HOFA 4M9LA 4M2YA 5KFQA 1D9FA 1S8OA 4NM1A 4B9VA 7ICKA 2EZXA 2UVWA 5AKZA 4RUAA 5J2EA 3OJUA 2LI6A 3RFAA 8ICPA 3H38A 1IXRA 4AT9A 5F9LA 3ZD9A 4I28A 4M6WA 2HOIA 3TANA 2NRWA 4Z6CA 4KM5A 1NJZA 2ASJA 5HRBA 1J2NA 2AGOA 4F5NA 3NWIA 3O0FA 4NM2A 5CFSA 2W9MA 3BQTA 1ZQVA 2YMMA 4UB3A 1T4GA 4UQGA 2K4PA 2D8CA 2GO7A 4EV6A 4KMUA 3WKAA 2WB1C 8ICYA 5AI6A 4X4VA 5ALJA 4X0AA 2C2RA 4MFCA 4WQLA 2OEHA 3RB3A 2YB1A 4X5VA 1AQ6A 3H4BA 1S0NA 5F9NA 3Q8MA 4WBZA 1NK8A 1S76D 4M9JA 4WC4A 2QB0A 3LDAA 3WFPA 2WF7A 4QW8A 3D2NA 4CCHA 3M1YA 3MGHA 2QLTA 1RYRA 5CEHA 1Z4OA 3WFOA 3PVXA 2PI5A 3IG5A 4O3OA 9ICBA 4O69A 4RZRA 9ICGA 4JWMA 2K4IA 2ZXHA 4PGYA 1JQRA 3AN1A 1DGJA 2E8OA 3UXPA 3T5KA 3JPNA 5E79U 3L4PA 2XGQA 3TADA 2Y1IA 1NKEA 4WOYA 3H0LB 3SR6A 1QSLA 5D63A 4JMUA 2KHQA 4LZDA 3FDSA 5KFGA 4UATA 3GIKA 3QZ8A 5J0RA 2M2UA 2PFQA 1N5XA 2NRZA 5J2CA 3IV6A 4J9QA 1QQ7A 8ICGA 5KG2A 1S0MA 2HDOA 5KFMA 2YMPA 4PHPA 2G08A 5J2DA 5BOLA 4MF8A 2R8HA 4RU9A 2M2WA 4X4NA 2BR0A 4DOCA 4MEXA 4WC5A 5KFXA 4QZCA 3BQ1A 4DSFA 4ELTA 3UXNA 4F8RA 1U48A 3ISDA 1F44A 4Q8FA 5H2FU 3GZFA 3TAQA 3Q8QB 2WTFA 3IM1A 3KHGA 3H3AA 2YB4A 1GO3F 4MKPA 2JV3A 3K1ZA 2LYAA 4OJPA 4RQ5A 2G5HB 4ECUA 5ALPA 2Q4TA 5DLGA 3N7SC 1ZD3A 4ED7A 4UB2A 1D9DA 4LVSA 4QNLA 3MGVA 1L6NA 3H0MB 1COOA 4KX5A 2VA8A 1JROA 3BJYA 4UAZA 1ZQKA 1R8BA 2ZH4A 2RLTA 4PJ0U 2KJ5A 9ICMA 4Z6FA 5DBBA 3D2QA 5J2BA 4C7ZA 3EF2A 4UD4A 4J9PA 4C4RA 4X4RA 2Q0ZX 2KK0A 1Q78A 4FBTA 2BQRA 4Y2VA 1XO1A 8ICWA 3A0BU 1KTQA 9ICQA 4C4SA 2ZIWA 1KFTA 3SENA 3WKDA 4F4YA 2UVRA 1ZQEA 3FM9A 2RHFA 4CNQA 1A6SA 1RXVA 2ID1A 4DFKA 3RH6A 5DB8A 1NK9A 2Y0SC 4FH5A 8ICHA 5J0QA 5KFAA 9ICPA 4RWOA 4FE3A 3CP8A 4JV0A 1FFVA 4R8UA 7ICPA 1U49A 5G5GA 2W9BB 4KB6A 3LWMA 1RQNA 2XCAA 4M5DA 4OJ5A 4F4ZA 1JXEA 5CWRA 3PW2A 8ICSA 1NK7A 4UBCA 8ICQA 2VIXA 3ETLA 2IBKA 5AKLA 2ZJ5A 1NO5A 2HHUA 2M2VA 5HP4A 3PO5A 9ICAA 2WFAA 1C7YA 2GAFD 3WK4A 3GILA 3V72A 4NWIA 3AMZA 4R8UB 1KDHA 2DF4B 1XS9D 4G3IA 3WKBA 5AHXA 4QZDA 1SKSA 5HR7A 4K98A 3UMCA 2JEIA 2XVTA 4UASA 2J6TA 5CA7A 3NVYA 3RJEA 4RQ3A 2LHTA 3C1ZA 3QEBZ 5KFTA 1CEZA 5AK3A 2BGWA 1FA0A 1HUOA 2PI4A 4DL6A 3PSFA 3R9KA 4JWNA 4RPYA 4EYHB 4IRCA 2G06A 1TAUA 2QKQA 3T79A 4BGDA 2DFLA 1JIHA 3PMNA 1LKYB 4DSLA 1N60A 4ECYA 2Y1JA 1N56A 1WWUA 2IOFA 3HKZF 2W04A 4YMNA 1MSWD 1QQ6A 3KZXA 5KFWA 4DFMA 3EPGA 4Y2PA 4I2EA 5KFLA 4CDGA 3GIJA 2OHFA 4F4WA 1T8EA 4DWIA 2DKZA 2G09A 2N1RA 3GV7B 4E0DA 1LKYA 9ICRA 2XGPA 4QIWF 1NJWA 1IM4A 1SV4A 9ICJA 4M0AA 1K5OA 5AICA 2OWOA 3M9OB 1A76A 5AM3A 2CRXA 5KTQA 5J2FA 2FPKA 5CRXA 2PMZF 1S5LU 4M6WB 4IQWA 5DB9A 4NKUA 7ICMA 3WFSC 3M7DA 4DSEA 4LEVA 1R8AA 2KIVA 1LB2B 3NKUA 2B21A 2QARA 4NL9C 2HOQA 2JHDA 4X4PA 1BPBA 3KOOA 3N4MB 1X9MA 4RQ8A 2R8KA 5TZVA 2HHQA 5CFUA 3SEIA 4OAIZ 1B4FA 4ED1A 3RBEA 4K4HA 5ALQA 4YXJA 5L1KA 4ECQA 5FP0A 1IIPA 5J2HA 1XWLA 4I27A 1CRXA 4K97A 5CR0A 1B43A 5F2VO 3LWLA 1QH9A 2EANA 3AU2A 4PL1A 4KLSA 2BCVA 1SL0A 4O68A 4K8VA 3ZDBA 2KVCA 3ALRA 3D6JA 4I2GA 4X4TA 2ZH7A 5KG4A 3FAHA 1SL2A 4C8KA 2ZIXA 2NO5A 4KX3A 1ZQCA 3OGUA 1JN3A 4AP9A 2HVHA 4RQ2A 4BX9C 1WCNA 1ZQUA 3M8SA 2ZIWB 4ELVA 5DDMA 3RRHA 1RXWA 4NLNA 2H3IA 2M2TA 1ED1A 4YMMA 3MFHA 5KFJA 4DO9A 5J0PA 2E8PA 1Z19A 4RWPA 4O67A 1ZQYA 1UETA 4C0ZA 3F2CA 3AQEA 3H4DA 2HHVA 1X9WA 2ZIXB 1N61A 1KN5A 1GPJA 1JALA 2W3RA 4Y2XA
chains in the Genus database with same CATH topology
3KHRA 1T3NA 4DS4A 2C28A 2P6RA 1D8LA 3ZDEA 4KLGA 4I2AA 2PFPA 3JPTA 2ALZA 4YFKA 3JPPA 3ISBA 4M9LA 3ZD8A 4TQSA 4M2YA 8ICNA 5KFQA 3M8RA 1D9FA 4BWMA 8ICEA 4I2IA 2DPJA 4WC1A 4NM1A 5DGAA 4Q44A 4B9VA 3MDAA 7ICKA 4ECVA 4E8FA 2M9NA 2UVWA 5HRKA 4I2CA 4RUAA 3UQ0A 5J2EA 5DQGA 3OJUA 4X4UA 4Z6EA 4ECRA 5HREA 8ICPA 2MUTB 7ICGA 4AT9B 2XY6A 1QSYA 2GWSA 5HMMA 2BDPA 1BGXT 5CB1A 7ICIA 1IXRA 3H38A 4AT9A 3UQ2A 4EBJA 1BPXA 2DVIA 3GIMA 4DF4A 1NJYA 5F9LA 3PNCA 3ZD9A 2R8JA 4I28A 4M6WA 3PW7A 2IMWP 2XO7A 7ICQA 2DR7A 4PGQA 1X9SA 3SV4A 4UB5A 3OHAA 2W8LA 2ASLA 1V4AA 3TANA 4KLQA 3SZ2A 7ICSA 4P2HA 2NRWA 4Z6CA 5J0TA 4IQTA 3UPQA 1S97A 1TVAA 1NJZA 2ASJA 4HYKA 2AGOA 5HRBA 4F5NA 4NM2A 4ZH4A 5KFHA 3N97B 2FMSA 2KZZA 2ISPA 4J9NA 1TK5A 5EWEA 2W9MA 4J9RA 3BQTA 1K1QA 2F1JA 1ZQVA 3E2EA 1U9LA 3EWAA 4R63A 1S77D 4BWJA 8ICMA 1NK5A 4UB3A 2JEFA 3KTQA 5DECA 1T4GA 4DQQA 1ZQDA 2I1QA 2MAXA 3RB4A 4UQGA 3C23A 3PX6A 4R65A 4ED0A 2AJQA 4RPXA 3MGIA 3T5HA 1MIWA 2HHTA 4EEYA 3RTVA 5IILA 4KLOA 7ICLA 5J2KA 3V6HA 2ZUCA 5C5JA 4KMUA 4MF2A 1XSNA 8ICYA 1VJ7A 4X4VA 1K1SA 4M9HA 2C2RA 4KLMA 4X0AA 4KLDA 1EXNA 4DOAA 3GIIA 3RB3A 1XC9A 1KLNA 4X5VA 4MFCA 9ICHA 4I2DA 4F2SA 2BCRA 4WC0A 4J9OA 3H4BA 1JAJA 1DOQA 4IQUA 5F9NA 1S0NA 4DFPA 5IIIA 1TK8A 5D46A 4JV2A 4X4QA 3Q8MA 1KSPA 4KLJA 4WBZA 1MQ3A 4F4XA 1NK8A 4YCXA 1S76D 1KEJA 1B22A 4I2BA 4RQ1A 1SKRA 4GC7A 3HX0A 1UEVA 4M9JA 4WC4A 3LDAA 4IR1A 4ATBB 1WOTA 3WFPA 4F2RA 9ICWA 2A1JB 4QW8A 2J6UA 3H39A 4CCHA 1TFYA 2P66A 3MGHA 2NRXA 1RYRA 1TK0A 5KFYA 4PHDA 1BPDA 2A1JA 1CUKA 3WFOA 3PVXA 5KFEA 2PI5A 5IINA 4O3OA 1NZPA 3PR5B 1N48A 9ICBA 2NRKA 5KFZA 4YN4A 1KFDA 4RZRA 2ISOA 2VA3A 9ICGA 7ICRA 5J0SA 3RJIA 4PGYA 1D8YA 4JWMA 1JQRA 5HRLA 1UT8A 2F1HA 2BCQA 1QSSA 3UXPA 5L1JA 3RR8A 3T5KA 4QZFA 5KFFA 3V6JA 1R8CA 4WC3A 2O1PA 4UB1A 3JPNA 1UT5A 2W9BA 4MFAA 1U4BA 2XGQA 2Y1IA 4YR0A 4DF8A 2H5XA 1NKEA 4DSKA 2W8KA 1XSLA 1QSLA 3THVA 2V9WA 4LZDA 7ICUA 2AQ4A 1Z3EB 3FDSA 5KFGA 4I2HA 3V7KA 5EOZA 8ICRA 5DG9A 1PZNA 2DPIA 3GIKA 4GXJA 4EBCA 4GXKA 3PX4A 5HC9A 4JK1A 3RJFA 4RPZA 3QZ8A 5J0RA 2M2UA 4M9GA 7ICHA 2UVUA 2PFQA 9ICUA 2ZH2A 5DBAA 2NRZA 5J2CA 1KFSA 4J9QA 3H7IA 4F50A 3K4GA 4RT3A 8ICGA 5KG2A 9ICXA 1S0MA 1H38A 1TFWA 1UA1A 4EBDA 3TFSA 3LK9A 2DRAA 5IIJA 5KFMA 5DKWA 4UBBA 4PHPA 5J2DA 1OU5A 2C2EA 5BOLA 4MF8A 1U45A 2R8HA 3JPOA 4RU9A 9ICEA 4P4PA 2M2WA 4RQ7A 4I2FA 3ZDCA 4YR3A 4JV1A 4X4NA 2BR0A 4DOCA 3EZ5A 4MEXA 2I9GA 2KFZA 4WC5A 5KFXA 1ZQZA 1NOMA 4QZCA 5HR9A 3BQ1A 4DSFA 4ELTA 2IHNA 4E7XA 4YP3A 3UXNA 4F8RA 3H8JA 3ISDA 1Y88A 1U48A 2P6UA 3LQCB 4XQ7A 3PR4A 4Q8FA 4F3OA 4XRHA 8ICCA 3GFKB 1ZQBA 3TAQA 5KFSA 3OSNA 3Q8QB 4EYIB 1U47A 1NKCA 5KFVA 2WTFA 2PFOA 3IM1A 9ICKA 3KHGA 1ZQGA 2ZTCA 5KFNA 3GV8B 2C2DA 3MR5A 4KLHA 4RNNA 3EYZA 3H3AA 4IQVA 5KT6A 2HW3A 1JX4A 1BPEA 3EW9A 4DL7A 1NK6A 4DSJA 4KLLA 2DR9A 4WCWA 4RQ5A 4O0IA 1SZPA 4Q45A 1RPLA 4PH5A 4ECUA 9ICOA 5BPCA 5DLGA 4NXZA 9ICFA 4ED7A 4UB2A 1D9DA 4LVSA 4KITB 3OVAA 4QWBA 1T7PA 4K4IA 3RAXA 2BQ3A 4RWNA 3C5GA 1S0VA 3Q8PB 8ICVA 4AT8B 2JEJA 3KHLA 1XU4A 4XQ8A 5HHIA 2C22A 1COOA 1KRPA 4RQ6A 2VA8A 1ZQFA 4RNOA 4Z6DA 3MFIA 3Q8LA 4F5RA 3BJYA 4EBEA 8ICKA 1Z00A 4UAZA 4RUCA 3MR6A 1L3VA 1ZQKA 4NLKA 1R8BA 1Q79A 2ZH4A 5J2GA 2BHNA 8ICZA 2VANA 4QZAA 3NYBA 3H37A 4M04A 9ICMA 4Z6FA 3HP6A 5KFIA 4YG2A 3IHQB 5KFRA 5DBBA 5J2BA 3ZDAA 4UD4A 3AQLA 5HRIA 4IRKA 4J9PA 5KFDA 3HJ4A 4ECWA 3RR7A 4Q43A 5KG7A 4FO6A 4X4SA 4X4RA 4P4OA 4RWQA 1SL1A 4KLEA 1R89A 2Q0ZX 5DG7A 2FMPA 2HVIA 5HRFA 1Q78A 4FH3A 1KNYA 4X4OA 2ZH8A 4FBTA 4BDPA 2Q66A 2BQRA 4TUPA 1WCLA 1XO1A 4F91B 3OSPA 1KTQA 8ICWA 9ICQA 4IR9A 4ATBA 4IG8A 1ZQTA 1KFTA 1BPYA 1Z00B 3ORYA 4FHXA 4B9NA 2ZH1A 4F4YA 2UVRA 4B9MA 4YMOA 2HHPA 1ZQEA 3Q8RB 4QWCA 4ED8A 1RXVA 2ID1A 2JZBB 4DFKA 1UA0A 1MQ2A 8ICBA 3Q8KA 3OJSA 3PW5A 4DL5A 5DB8A 4J9LA 4YXMA 5CJ7A 3RH6A 4TQRA 2JZBA 1NK9A 2BQUA 3PO4A 8ICHA 9ICIA 4FH5A 5J0QA 5L9XA 5DB7A 5KFAA 2RDJA 1ZQXA 5DQIA 1ZETA 4J9MA 1BPZA 4JV0A 4R8UA 9ICPA 3JZ0A 8ICOA 7ICPA 4C8OA 4O5EA 5J2IA 2FPLA 1U49A 4O3SA 4JUZA 3PMLA 3T5JA 4NY8A 3H8WA 4O3NA 3G6XA 4YVZA 2W9BB 3LWMA 4QWAA 3HPOA 2XCAA 3TAPA 2ASDA 2AU0A 2KP7A 5KT4A 4M5DA 4F4ZA 1JXEA 5CWRA 3V7JA 3B0XA 3PW2A 4ED6A 1NK7A 1L5UA 8ICSA 3FYHA 4QZHA 4UBCA 3OHBA 3ETLA 5JUMA 1L3TA 2IBKA 8ICQA 3AQMA 2ZHAA 5IIOA 4UAWA 2ZJ5A 4YD2A 5J0UA 4P4MA 4RQ0A 1L3UA 3H40A 4F4KA 4NLGA 1MC8A 1NO5A 4AT8A 3TARA 2HHUA 4WC7A 2M2VA 7ICEA 3C2MA 4EZ6A 1QLNA 3PV8A 3H8SA 4GC6A 5DGBA 5HP4A 1NK0A 5CP2A 2FLPA 3PO5A 5D4BA 4KLUA 9ICAA 1C7YA 4NLZA 4KN4A 3AQNA 1JXLA 1NJXA 3GILA 1ZQJA 3V72A 4X0BA 4C8NA 2XC9A 3L9DA 5KG1A 4R8UB 1KDHA 4QZBA 3C1YA 3MABA 1XS9D 4G3IA 4WBYA 2W9CB 2R8IA 5KG0A 4QZDA 4GLXA 8ICFA 4XUSA 1ZQPA 8ICUA 3JYYA 1SKSA 4I2JA 2ZUDA 9ICTA 2ZH5A 4ECSA 8ICXA 3HW8A 3T3FA 2JEIA 2IHMA 2J6TA 3BQ2A 4QZIA 5CA7A 1ZQLA 2RDIA 2IA6A 2PFNA 3RJEA 4RQ3A 1ZJNA 4F93B 4FHVA 4RT2A 3C1ZA 3RJJA 3QEBZ 5KFTA 3NGDA 1SKWA 3C2LA 3M9NB 4YD1A 4FS2A 2NRTA 2BGWA 1HUOA 1CEZA 2PI4A 4DOBA 5HRGA 1FA0A 4DSIA 4AT7A 4GXIA 4DL6A 4DL3A 4R64A 2NRVA 4RNMA 1S9FA 4JWNA 4RPYA 4EYHB 2KFNA 1DGSA 4IRCA 2O5AA 1TAUA 1TV9A 3JPRA 4AT7B 3OUYA 5KFKA 1LV5A 2XY5A 1ZQHA 4BGDA 3K75D 4EP7A 4KN7A 4UD5A 2KZ3A 2AQ0A 3OUYB 3RH4A 4QZ9A 9ICCA 2DFLA 1MIYA 1JIHA 3PMNA 4M9NA 2W9CA 1V9PA 2XY7A 4DLGA 2BCUA 4DSLA 4ELUA 4F5QA 4IRDA 3OV7A 2FPMA 4TUSA 4ECYA 3HIYA 3SYZA 1QTMA 4LT6A 2ZH6A 4KLIA 2Y1JA 1N56A 5KG6A 4YR2A 4MFFA 9ICNA 3WFRE 5KG3A 1HJPA 3C2KA 1ZYQA 5J29A 4FHPA 1HUZA 4YMNA 1MSWD 4DQIA 1F5AA 2DR5A 4DEZA 2ZHBA 5KFWA 3RJHA 4XA5A 4Q8EA 4DFMA 5L1LA 5HNKA 4M47A 2ZJAA 4QWEA 4ECXA 4KLTA 3EPGA 2HHSA 4I2EA 5KFLA 5KT5A 3MDCA 3GIJA 4KTQA 5DEDA 5IIKA 3T5LA 4DL4A 5KT7A 2AGPA 3B0YA 4F4WA 1T8EA 4DLEA 4DWIA 4NKTA 2KN7A 2JEGA 5DBCA 4DQPA 1A77A 3GV7B 5DB6A 4E0DA 3ISCA 2FLNA 9ICRA 1ZQSA 7ICNA 1ZJMA 2XGPA 1NJWA 1IM4A 3SV3A 4J9SA 4B9LA 4B9SA 5L1IA 2ZJ8A 4F5PA 9ICJA 4M0AA 3GV5B 1X2IA 2OWOA 3GQCA 5EWGA 4PHEA 3QEAZ 3M9OB 4FS1A 1A76A 2FLLA 4C8MA 5HMLA 3HWTA 3SI8A 5KTQA 5J2FA 5KFOA 2FPKA 3C5FA 9ICVA 2BE3A 4M6WB 3Q8SB 4IQWA 1JMSA 5DB9A 3QE9Y 3RJGA 2VA2A 7ICMA 4NKUA 3WFSC 1L3SA 3RRGA 4BXOB 3HT3A 2HHXA 4QZGA 4LZGA 4QW9A 3MBYA 4DSEA 2KZMA 4YQWA 1ZQMA 4PPXA 1R8AA 5HHHA 4O5CA 5KG5A 1LB2B 2R8GA 3UXOA 1DK2A 4FHWA 2BCSA 2B21A 1ZQRA 2BPCA 2DR8A 3M9MB 3RBDA 3G6VA 1PX5A 3V6KA 3C66A 3G6YA 5IIMA 3RB6A 2AGQA 2ZTEA 5DDYA 3PX0A 7ICVA 4EBKA 2UVVA 4X4PA 1ZQOA 5DLFA 4MEYA 1BPBA 3N4MB 3UPSA 5KFPA 2HHWA 3OVSA 2BPGA 3MR2A 4QZ8A 4RQ8A 4TURA 4DL2A 5TZVA 1X9MA 2R8KA 2HHQA 9ICLA 2FMQA 7ICFA 1RZTA 3MR3A 2ZH9A 1ZQWA 4R66A 1S10A 8ICAA 4O9MA 4J9KA 2J6SA 5EWFA 8ICIA 4RWOA 3OVBA 2XCPA 3AU6A 4ED1A 2V4RA 3RBEA 7ICTA 3HJ1A 4K4HA 5BOMA 1S0OA 3RJKA 7ICOA 4FHYA 3PW4A 4YXJA 3EPIA 5L1KA 4ECQA 3RAQA 2W9AA 5J2HA 2V4QA 4DFJA 1UEUA 1XWLA 4I27A 3GDXA 5CR0A 1B43A 5D49A 5KFBA 5F2VO 5KFUA 5J0YA 2MUTA 3QZ7A 4ED2A 2ATLA 3LWLA 1DK3A 3AU2A 4ECTA 3C18A 5HRDA 1TKDA 4KLSA 4E80A 2BCVA 1SL0A 2LYHA 2F1IA 1XSPA 2BPFA 1VFGA 4WC2A 4ECZA 4QZEA 4O3QA 8ICTA 4B9UA 1NK4A 4DS5A 4QWDA 3ZDBA 9ICSA 4X4TA 4I2GA 4FBUA 4KLFA 2ZH7A 4O3PA 5KG4A 1TFRA 3TQ1A 3RB0A 1SL2A 1ZQAA 2PBEA 4C8KA 3NTUA 2RFFA 3BQ0A 5DG8A 1ZQNA 3V7LA 3OGUA 1ZQCA 1JN3A 7ICJA 4PHAA 5KT3A 2HVHA 2ZUBA 5KFCA 5J0OA 4B9TA 4O5KA 4RQ2A 3RH5A 8ICLA 2DRBA 3TI0A 3WFQE 3JPQA 3AUOA 1WCNA 1ZQUA 3M8SA 1ZQQA 1BVSA 4C8LA 2PXIA 1ZQIA 4ELVA 4BXOA 5CHGA 5J0WA 3PY8A 1MIVA 3AQKA 4DQRA 3BDPA 5DDMA 3RRHA 3TFRA 3C21A 1RXWA 1RYSA 3PW0A 4NLNA 1YLQA 3JPSA 4I29A 4UB4A 4YMMA 3MFHA 4UAYA 4F5OA 4DQSA 2M2TA 2ZH3A 5KFJA 4F92B 4DO9A 2BKEA 4O3RA 5J0PA 2KTQA 5HRHA 4RWPA 4WC6A 3KHHA 4K4GA 8ICJA 1ZQYA 4TUQA 5J2JA 1BNPA 4S3NA 1AROP 4RQ4A 1UETA 5KT2A 1NKBA 3H4DA 2HHVA 5J0XA 1X9WA 4ED3A 5J2AA 1BNOA 4PGXA 2ZTDA 5DQHA 1TAQA 3ZDDA 4EZ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KHR A;  1T3N A;  4DS4 A;  2C28 A;  2P6R A;  1D8L A;  3ZDE A;  4KLG A;  4I2A A;  2PFP A;  3JPT A;  2ALZ A;  4YFK A;  3JPP A;  3ISB A;  4M9L A;  3ZD8 A;  4TQS A;  4M2Y A;  8ICN A;  5KFQ A;  3M8R A;  1D9F A;  4BWM A;  8ICE A;  4I2I A;  2DPJ A;  4WC1 A;  4NM1 A;  5DGA A;  4Q44 A;  4B9V A;  3MDA A;  7ICK A;  4ECV A;  4E8F A;  2M9N A;  2UVW A;  5HRK A;  4I2C A;  4RUA A;  3UQ0 A;  5J2E A;  5DQG A;  3OJU A;  4X4U A;  4Z6E A;  4ECR A;  5HRE A;  8ICP A;  2MUT B;  7ICG A;  4AT9 B;  2XY6 A;  1QSY A;  2GWS A;  5HMM A;  2BDP A;  1BGX T;  5CB1 A;  7ICI A;  1IXR A;  3H38 A;  4AT9 A;  3UQ2 A;  4EBJ A;  1BPX A;  2DVI A;  3GIM A;  4DF4 A;  1NJY A;  5F9L A;  3PNC A;  3ZD9 A;  2R8J A;  4I28 A;  4M6W A;  3PW7 A;  2IMW P;  2XO7 A;  7ICQ A;  2DR7 A;  4PGQ A;  1X9S A;  3SV4 A;  4UB5 A;  3OHA A;  2W8L A;  2ASL A;  1V4A A;  3TAN A;  4KLQ A;  3SZ2 A;  7ICS A;  4P2H A;  2NRW A;  4Z6C A;  5J0T A;  4IQT A;  3UPQ A;  1S97 A;  1TVA A;  1NJZ A;  2ASJ A;  4HYK A;  2AGO A;  5HRB A;  4F5N A;  4NM2 A;  4ZH4 A;  5KFH A;  3N97 B;  2FMS A;  2KZZ A;  2ISP A;  4J9N A;  1TK5 A;  5EWE A;  2W9M A;  4J9R A;  3BQT A;  1K1Q A;  2F1J A;  1ZQV A;  3E2E A;  1U9L A;  3EWA A;  4R63 A;  1S77 D;  4BWJ A;  8ICM A;  1NK5 A;  4UB3 A;  2JEF A;  3KTQ A;  5DEC A;  1T4G A;  4DQQ A;  1ZQD A;  2I1Q A;  2MAX A;  3RB4 A;  4UQG A;  3C23 A;  3PX6 A;  4R65 A;  4ED0 A;  2AJQ A;  4RPX A;  3MGI A;  3T5H A;  1MIW A;  2HHT A;  4EEY A;  3RTV A;  5IIL A;  4KLO A;  7ICL A;  5J2K A;  3V6H A;  2ZUC A;  5C5J A;  4KMU A;  4MF2 A;  1XSN A;  8ICY A;  1VJ7 A;  4X4V A;  1K1S A;  4M9H A;  2C2R A;  4KLM A;  4X0A A;  4KLD A;  1EXN A;  4DOA A;  3GII A;  3RB3 A;  1XC9 A;  1KLN A;  4X5V A;  4MFC A;  9ICH A;  4I2D A;  4F2S A;  2BCR A;  4WC0 A;  4J9O A;  3H4B A;  1JAJ A;  1DOQ A;  4IQU A;  5F9N A;  1S0N A;  4DFP A;  5III A;  1TK8 A;  5D46 A;  4JV2 A;  4X4Q A;  3Q8M A;  1KSP A;  4KLJ A;  4WBZ A;  1MQ3 A;  4F4X A;  1NK8 A;  4YCX A;  1S76 D;  1KEJ A;  1B22 A;  4I2B A;  4RQ1 A;  1SKR A;  4GC7 A;  3HX0 A;  1UEV A;  4M9J A;  4WC4 A;  3LDA A;  4IR1 A;  4ATB B;  1WOT A;  3WFP A;  4F2R A;  9ICW A;  2A1J B;  4QW8 A;  2J6U A;  3H39 A;  4CCH A;  1TFY A;  2P66 A;  3MGH A;  2NRX A;  1RYR A;  1TK0 A;  5KFY A;  4PHD A;  1BPD A;  2A1J A;  1CUK A;  3WFO A;  3PVX A;  5KFE A;  2PI5 A;  5IIN A;  4O3O A;  1NZP A;  3PR5 B;  1N48 A;  9ICB A;  2NRK A;  5KFZ A;  4YN4 A;  1KFD A;  4RZR A;  2ISO A;  2VA3 A;  9ICG A;  7ICR A;  5J0S A;  3RJI A;  4PGY A;  1D8Y A;  4JWM A;  1JQR A;  5HRL A;  1UT8 A;  2F1H A;  2BCQ A;  1QSS A;  3UXP A;  5L1J A;  3RR8 A;  3T5K A;  4QZF A;  5KFF A;  3V6J A;  1R8C A;  4WC3 A;  2O1P A;  4UB1 A;  3JPN A;  1UT5 A;  2W9B A;  4MFA A;  1U4B A;  2XGQ A;  2Y1I A;  4YR0 A;  4DF8 A;  2H5X A;  1NKE A;  4DSK A;  2W8K A;  1XSL A;  1QSL A;  3THV A;  2V9W A;  4LZD A;  7ICU A;  2AQ4 A;  1Z3E B;  3FDS A;  5KFG A;  4I2H A;  3V7K A;  5EOZ A;  8ICR A;  5DG9 A;  1PZN A;  2DPI A;  3GIK A;  4GXJ A;  4EBC A;  4GXK A;  3PX4 A;  5HC9 A;  4JK1 A;  3RJF A;  4RPZ A;  3QZ8 A;  5J0R A;  2M2U A;  4M9G A;  7ICH A;  2UVU A;  2PFQ A;  9ICU A;  2ZH2 A;  5DBA A;  2NRZ A;  5J2C A;  1KFS A;  4J9Q A;  3H7I A;  4F50 A;  3K4G A;  4RT3 A;  8ICG A;  5KG2 A;  9ICX A;  1S0M A;  1H38 A;  1TFW A;  1UA1 A;  4EBD A;  3TFS A;  3LK9 A;  2DRA A;  5IIJ A;  5KFM A;  5DKW A;  4UBB A;  4PHP A;  5J2D A;  1OU5 A;  2C2E A;  5BOL A;  4MF8 A;  1U45 A;  2R8H A;  3JPO A;  4RU9 A;  9ICE A;  4P4P A;  2M2W A;  4RQ7 A;  4I2F A;  3ZDC A;  4YR3 A;  4JV1 A;  4X4N A;  2BR0 A;  4DOC A;  3EZ5 A;  4MEX A;  2I9G A;  2KFZ A;  4WC5 A;  5KFX A;  1ZQZ A;  1NOM A;  4QZC A;  5HR9 A;  3BQ1 A;  4DSF A;  4ELT A;  2IHN A;  4E7X A;  4YP3 A;  3UXN A;  4F8R A;  3H8J A;  3ISD A;  1Y88 A;  1U48 A;  2P6U A;  3LQC B;  4XQ7 A;  3PR4 A;  4Q8F A;  4F3O A;  4XRH A;  8ICC A;  3GFK B;  1ZQB A;  3TAQ A;  5KFS A;  3OSN A;  3Q8Q B;  4EYI B;  1U47 A;  1NKC A;  5KFV A;  2WTF A;  2PFO A;  3IM1 A;  9ICK A;  3KHG A;  1ZQG A;  2ZTC A;  5KFN A;  3GV8 B;  2C2D A;  3MR5 A;  4KLH A;  4RNN A;  3EYZ A;  3H3A A;  4IQV A;  5KT6 A;  2HW3 A;  1JX4 A;  1BPE A;  3EW9 A;  4DL7 A;  1NK6 A;  4DSJ A;  4KLL A;  2DR9 A;  4WCW A;  4RQ5 A;  4O0I A;  1SZP A;  4Q45 A;  1RPL A;  4PH5 A;  4ECU A;  9ICO A;  5BPC A;  5DLG A;  4NXZ A;  9ICF A;  4ED7 A;  4UB2 A;  1D9D A;  4LVS A;  4KIT B;  3OVA A;  4QWB A;  1T7P A;  4K4I A;  3RAX A;  2BQ3 A;  4RWN A;  3C5G A;  1S0V A;  3Q8P B;  8ICV A;  4AT8 B;  2JEJ A;  3KHL A;  1XU4 A;  4XQ8 A;  5HHI A;  2C22 A;  1COO A;  1KRP A;  4RQ6 A;  2VA8 A;  1ZQF A;  4RNO A;  4Z6D A;  3MFI A;  3Q8L A;  4F5R A;  3BJY A;  4EBE A;  8ICK A;  1Z00 A;  4UAZ A;  4RUC A;  3MR6 A;  1L3V A;  1ZQK A;  4NLK A;  1R8B A;  1Q79 A;  2ZH4 A;  5J2G A;  2BHN A;  8ICZ A;  2VAN A;  4QZA A;  3NYB A;  3H37 A;  4M04 A;  9ICM A;  4Z6F A;  3HP6 A;  5KFI A;  4YG2 A;  3IHQ B;  5KFR A;  5DBB A;  5J2B A;  3ZDA A;  4UD4 A;  3AQL A;  5HRI A;  4IRK A;  4J9P A;  5KFD A;  3HJ4 A;  4ECW A;  3RR7 A;  4Q43 A;  5KG7 A;  4FO6 A;  4X4S A;  4X4R A;  4P4O A;  4RWQ A;  1SL1 A;  4KLE A;  1R89 A;  2Q0Z X;  5DG7 A;  2FMP A;  2HVI A;  5HRF A;  1Q78 A;  4FH3 A;  1KNY A;  4X4O A;  2ZH8 A;  4FBT A;  4BDP A;  2Q66 A;  2BQR A;  4TUP A;  1WCL A;  1XO1 A;  4F91 B;  3OSP A;  1KTQ A;  8ICW A;  9ICQ A;  4IR9 A;  4ATB A;  4IG8 A;  1ZQT A;  1KFT A;  1BPY A;  1Z00 B;  3ORY A;  4FHX A;  4B9N A;  2ZH1 A;  4F4Y A;  2UVR A;  4B9M A;  4YMO A;  2HHP A;  1ZQE A;  3Q8R B;  4QWC A;  4ED8 A;  1RXV A;  2ID1 A;  2JZB B;  4DFK A;  1UA0 A;  1MQ2 A;  8ICB A;  3Q8K A;  3OJS A;  3PW5 A;  4DL5 A;  5DB8 A;  4J9L A;  4YXM A;  5CJ7 A;  3RH6 A;  4TQR A;  2JZB A;  1NK9 A;  2BQU A;  3PO4 A;  8ICH A;  9ICI A;  4FH5 A;  5J0Q A;  5L9X A;  5DB7 A;  5KFA A;  2RDJ A;  1ZQX A;  5DQI A;  1ZET A;  4J9M A;  1BPZ A;  4JV0 A;  4R8U A;  9ICP A;  3JZ0 A;  8ICO A;  7ICP A;  4C8O A;  4O5E A;  5J2I A;  2FPL A;  1U49 A;  4O3S A;  4JUZ A;  3PML A;  3T5J A;  4NY8 A;  3H8W A;  4O3N A;  3G6X A;  4YVZ A;  2W9B B;  3LWM A;  4QWA A;  3HPO A;  2XCA A;  3TAP A;  2ASD A;  2AU0 A;  2KP7 A;  5KT4 A;  4M5D A;  4F4Z A;  1JXE A;  5CWR A;  3V7J A;  3B0X A;  3PW2 A;  4ED6 A;  1NK7 A;  1L5U A;  8ICS A;  3FYH A;  4QZH A;  4UBC A;  3OHB A;  3ETL A;  5JUM A;  1L3T A;  2IBK A;  8ICQ A;  3AQM A;  2ZHA A;  5IIO A;  4UAW A;  2ZJ5 A;  4YD2 A;  5J0U A;  4P4M A;  4RQ0 A;  1L3U A;  3H40 A;  4F4K A;  4NLG A;  1MC8 A;  1NO5 A;  4AT8 A;  3TAR A;  2HHU A;  4WC7 A;  2M2V A;  7ICE A;  3C2M A;  4EZ6 A;  1QLN A;  3PV8 A;  3H8S A;  4GC6 A;  5DGB A;  5HP4 A;  1NK0 A;  5CP2 A;  2FLP A;  3PO5 A;  5D4B A;  4KLU A;  9ICA A;  1C7Y A;  4NLZ A;  4KN4 A;  3AQN A;  1JXL A;  1NJX A;  3GIL A;  1ZQJ A;  3V72 A;  4X0B A;  4C8N A;  2XC9 A;  3L9D A;  5KG1 A;  4R8U B;  1KDH A;  4QZB A;  3C1Y A;  3MAB A;  1XS9 D;  4G3I A;  4WBY A;  2W9C B;  2R8I A;  5KG0 A;  4QZD A;  4GLX A;  8ICF A;  4XUS A;  1ZQP A;  8ICU A;  3JYY A;  1SKS A;  4I2J A;  2ZUD A;  9ICT A;  2ZH5 A;  4ECS A;  8ICX A;  3HW8 A;  3T3F A;  2JEI A;  2IHM A;  2J6T A;  3BQ2 A;  4QZI A;  5CA7 A;  1ZQL A;  2RDI A;  2IA6 A;  2PFN A;  3RJE A;  4RQ3 A;  1ZJN A;  4F93 B;  4FHV A;  4RT2 A;  3C1Z A;  3RJJ A;  3QEB Z;  5KFT A;  3NGD A;  1SKW A;  3C2L A;  3M9N B;  4YD1 A;  4FS2 A;  2NRT A;  2BGW A;  1HUO A;  1CEZ A;  2PI4 A;  4DOB A;  5HRG A;  1FA0 A;  4DSI A;  4AT7 A;  4GXI A;  4DL6 A;  4DL3 A;  4R64 A;  2NRV A;  4RNM A;  1S9F A;  4JWN A;  4RPY A;  4EYH B;  2KFN A;  1DGS A;  4IRC A;  2O5A A;  1TAU A;  1TV9 A;  3JPR A;  4AT7 B;  3OUY A;  5KFK A;  1LV5 A;  2XY5 A;  1ZQH A;  4BGD A;  3K75 D;  4EP7 A;  4KN7 A;  4UD5 A;  2KZ3 A;  2AQ0 A;  3OUY B;  3RH4 A;  4QZ9 A;  9ICC A;  2DFL A;  1MIY A;  1JIH A;  3PMN A;  4M9N A;  2W9C A;  1V9P A;  2XY7 A;  4DLG A;  2BCU A;  4DSL A;  4ELU A;  4F5Q A;  4IRD A;  3OV7 A;  2FPM A;  4TUS A;  4ECY A;  3HIY A;  3SYZ A;  1QTM A;  4LT6 A;  2ZH6 A;  4KLI A;  2Y1J A;  1N56 A;  5KG6 A;  4YR2 A;  4MFF A;  9ICN A;  3WFR E;  5KG3 A;  1HJP A;  3C2K A;  1ZYQ A;  5J29 A;  4FHP A;  1HUZ A;  4YMN A;  1MSW D;  4DQI A;  1F5A A;  2DR5 A;  4DEZ A;  2ZHB A;  5KFW A;  3RJH A;  4XA5 A;  4Q8E A;  4DFM A;  5L1L A;  5HNK A;  4M47 A;  2ZJA A;  4QWE A;  4ECX A;  4KLT A;  3EPG A;  2HHS A;  4I2E A;  5KFL A;  5KT5 A;  3MDC A;  3GIJ A;  4KTQ A;  5DED A;  5IIK A;  3T5L A;  4DL4 A;  5KT7 A;  2AGP A;  3B0Y A;  4F4W A;  1T8E A;  4DLE A;  4DWI A;  4NKT A;  2KN7 A;  2JEG A;  5DBC A;  4DQP A;  1A77 A;  3GV7 B;  5DB6 A;  4E0D A;  3ISC A;  2FLN A;  9ICR A;  1ZQS A;  7ICN A;  1ZJM A;  2XGP A;  1NJW A;  1IM4 A;  3SV3 A;  4J9S A;  4B9L A;  4B9S A;  5L1I A;  2ZJ8 A;  4F5P A;  9ICJ A;  4M0A A;  3GV5 B;  1X2I A;  2OWO A;  3GQC A;  5EWG A;  4PHE A;  3QEA Z;  3M9O B;  4FS1 A;  1A76 A;  2FLL A;  4C8M A;  5HML A;  3HWT A;  3SI8 A;  5KTQ A;  5J2F A;  5KFO A;  2FPK A;  3C5F A;  9ICV A;  2BE3 A;  4M6W B;  3Q8S B;  4IQW A;  1JMS A;  5DB9 A;  3QE9 Y;  3RJG A;  2VA2 A;  7ICM A;  4NKU A;  3WFS C;  1L3S A;  3RRG A;  4BXO B;  3HT3 A;  2HHX A;  4QZG A;  4LZG A;  4QW9 A;  3MBY A;  4DSE A;  2KZM A;  4YQW A;  1ZQM A;  4PPX A;  1R8A A;  5HHH A;  4O5C A;  5KG5 A;  1LB2 B;  2R8G A;  3UXO A;  1DK2 A;  4FHW A;  2BCS A;  2B21 A;  1ZQR A;  2BPC A;  2DR8 A;  3M9M B;  3RBD A;  3G6V A;  1PX5 A;  3V6K A;  3C66 A;  3G6Y A;  5IIM A;  3RB6 A;  2AGQ A;  2ZTE A;  5DDY A;  3PX0 A;  7ICV A;  4EBK A;  2UVV A;  4X4P A;  1ZQO A;  5DLF A;  4MEY A;  1BPB A;  3N4M B;  3UPS A;  5KFP A;  2HHW A;  3OVS A;  2BPG A;  3MR2 A;  4QZ8 A;  4RQ8 A;  4TUR A;  4DL2 A;  5TZV A;  1X9M A;  2R8K A;  2HHQ A;  9ICL A;  2FMQ A;  7ICF A;  1RZT A;  3MR3 A;  2ZH9 A;  1ZQW A;  4R66 A;  1S10 A;  8ICA A;  4O9M A;  4J9K A;  2J6S A;  5EWF A;  8ICI A;  4RWO A;  3OVB A;  2XCP A;  3AU6 A;  4ED1 A;  2V4R A;  3RBE A;  7ICT A;  3HJ1 A;  4K4H A;  5BOM A;  1S0O A;  3RJK A;  7ICO A;  4FHY A;  3PW4 A;  4YXJ A;  3EPI A;  5L1K A;  4ECQ A;  3RAQ A;  2W9A A;  5J2H A;  2V4Q A;  4DFJ A;  1UEU A;  1XWL A;  4I27 A;  3GDX A;  5CR0 A;  1B43 A;  5D49 A;  5KFB A;  5F2V O;  5KFU A;  5J0Y A;  2MUT A;  3QZ7 A;  4ED2 A;  2ATL A;  3LWL A;  1DK3 A;  3AU2 A;  4ECT A;  3C18 A;  5HRD A;  1TKD A;  4KLS A;  4E80 A;  2BCV A;  1SL0 A;  2LYH A;  2F1I A;  1XSP A;  2BPF A;  1VFG A;  4WC2 A;  4ECZ A;  4QZE A;  4O3Q A;  8ICT A;  4B9U A;  1NK4 A;  4DS5 A;  4QWD A;  3ZDB A;  9ICS A;  4X4T A;  4I2G A;  4FBU A;  4KLF A;  2ZH7 A;  4O3P A;  5KG4 A;  1TFR A;  3TQ1 A;  3RB0 A;  1SL2 A;  1ZQA A;  2PBE A;  4C8K A;  3NTU A;  2RFF A;  3BQ0 A;  5DG8 A;  1ZQN A;  3V7L A;  3OGU A;  1ZQC A;  1JN3 A;  7ICJ A;  4PHA A;  5KT3 A;  2HVH A;  2ZUB A;  5KFC A;  5J0O A;  4B9T A;  4O5K A;  4RQ2 A;  3RH5 A;  8ICL A;  2DRB A;  3TI0 A;  3WFQ E;  3JPQ A;  3AUO A;  1WCN A;  1ZQU A;  3M8S A;  1ZQQ A;  1BVS A;  4C8L A;  2PXI A;  1ZQI A;  4ELV A;  4BXO A;  5CHG A;  5J0W A;  3PY8 A;  1MIV A;  3AQK A;  4DQR A;  3BDP A;  5DDM A;  3RRH A;  3TFR A;  3C21 A;  1RXW A;  1RYS A;  3PW0 A;  4NLN A;  1YLQ A;  3JPS A;  4I29 A;  4UB4 A;  4YMM A;  3MFH A;  4UAY A;  4F5O A;  4DQS A;  2M2T A;  2ZH3 A;  5KFJ A;  4F92 B;  4DO9 A;  2BKE A;  4O3R A;  5J0P A;  2KTQ A;  5HRH A;  4RWP A;  4WC6 A;  3KHH A;  4K4G A;  8ICJ A;  1ZQY A;  4TUQ A;  5J2J A;  1BNP A;  4S3N A;  1ARO P;  4RQ4 A;  1UET A;  5KT2 A;  1NKB A;  3H4D A;  2HHV A;  5J0X A;  1X9W A;  4ED3 A;  5J2A A;  1BNO A;  4PGX A;  2ZTD A;  5DQH A;  1TAQ A;  3ZDD A;  4EZ9 A; 
#chains in the Genus database with same CATH topology
 4NXX A;  2PFP A;  2WF5 A;  4TQS A;  2IHO A;  2F8L A;  2VJ5 A;  3M8R A;  4BWM A;  4WC1 A;  2DPJ A;  5DGA A;  4Q44 A;  4ECV A;  2M9N A;  3NRW A;  2JMG A;  3UQ0 A;  4X4U A;  4Z6E A;  4ECR A;  5HRE A;  2MUT B;  1QSY A;  2BDP A;  1VLB A;  5CB1 A;  7ICI A;  3UQ2 A;  2DUY A;  2BZF A;  1BPX A;  2DVI A;  3GIM A;  1NJY A;  2GA9 D;  2IMW P;  3QU2 A;  2XO7 A;  2F76 X;  1XO0 A;  4PGQ A;  4UB5 A;  2K89 A;  4FZM A;  3OHA A;  2W8L A;  4KLQ A;  3SZ2 A;  1S97 A;  5ALU A;  4I0U A;  2F77 X;  4ZH4 A;  5EWE A;  3E2E A;  8ICM A;  1S77 D;  4BWJ A;  4US9 A;  1WUD A;  3KTQ A;  4OJ6 A;  4CRX A;  2MAX A;  3SMV A;  5CHE A;  3C23 A;  4RPX A;  7ICL A;  2ZUC A;  5C5J A;  3ER9 B;  2JH7 A;  1XSN A;  2OM6 A;  3I76 A;  1KLN A;  1XC9 A;  1QQ5 A;  2K8C B;  4F2S A;  4J9O A;  1JAJ A;  1DOQ A;  1Z1V A;  4X4Q A;  4MHV A;  1ZD2 P;  1MQ3 A;  1YT3 A;  4CF3 A;  1SKR A;  4GC7 A;  1UEV A;  4IR1 A;  3SQI A;  2LMR A;  2ESE A;  4U7C A;  4F2R A;  2A1J B;  3K1R B;  2P66 A;  1XNS A;  1CUK A;  5ALN A;  3KKA A;  1N48 A;  5KFZ A;  1KFD A;  1X6J A;  2W03 A;  4LJX A;  3F2D A;  2F1H A;  2W55 A;  5K4L A;  1R8C A;  4QZF A;  5KFF A;  4EZ9 A;  2W9B A;  2XIC A;  3NS1 A;  4PZN A;  1U4B A;  4YR0 A;  4DSK A;  3E0F A;  2W8K A;  3I1Y A;  3THV A;  1Q46 A;  7ICU A;  2AQ4 A;  1L8O A;  5EOZ A;  8ICR A;  5DG9 A;  1PZN A;  2DPI A;  2QB0 B;  5AIB A;  9ICU A;  4NXW A;  2XI9 A;  1KFS A;  4F50 A;  4UAR A;  3K4G A;  4RT3 A;  1H38 A;  3TFS A;  2H3V A;  3LK9 A;  2DRA A;  5AM2 A;  1SWW A;  3M6Z A;  3N28 A;  3CYM A;  1U45 A;  3DDH A;  1IV8 A;  3HRD D;  3EZ5 A;  1RG6 A;  3H8J A;  2P6U A;  3LQC B;  4XQ7 A;  3EUB 2;  4P0P B;  5AK5 A;  2PFO A;  5KFV A;  1VDV A;  2KSO B;  4JLZ A;  3GV8 B;  4K96 A;  2RP5 A;  1BPE A;  2HCF A;  3EW9 A;  9ICO A;  1RPL A;  3DEE A;  3OVA A;  1T7P A;  4K4I A;  1S0V A;  5T14 A;  2JEJ A;  2P35 A;  2C22 A;  1ZQF A;  4RNO A;  4Z6D A;  3Q8L A;  4EBE A;  1Z00 A;  3MR6 A;  4RQM A;  2VAN A;  4QZA A;  2LPE A;  3HP6 A;  3IHQ B;  5KFD A;  4FZN A;  3RR7 A;  4FO6 A;  5L1M A;  1N2X A;  5J8Y A;  1R89 A;  2HVI A;  4FH3 A;  1KNY A;  1PVP A;  2KV2 A;  1WCL A;  2KKV A;  4F91 B;  4IR9 A;  4ATB A;  1L7M A;  2HBK A;  2W43 A;  1Z00 B;  4B9N A;  3S6J A;  2HHP A;  1UQV A;  4QWC A;  4GIB A;  2JZB B;  1UA0 A;  1MQ2 A;  3NVV A;  2QAR B;  4DL5 A;  2KFZ A;  4J9L A;  5CJ7 A;  3PO4 A;  3CNH A;  2RDJ A;  1ZQD A;  4J9M A;  1BPZ A;  3JZ0 A;  2BBH A;  2IOF K;  3PML A;  4NY8 A;  2KIC A;  5C0Y A;  3TAP A;  4YVZ A;  2W7P A;  4QWA A;  3HPO A;  2ASD A;  2AU0 A;  5KT4 A;  1L7O A;  5ALM A;  1JUD A;  1L5U A;  2OCE A;  3HJE A;  1COK A;  2H3F A;  5IIO A;  5AIA A;  1L3U A;  2ZHB A;  5B3Q A;  4WC7 A;  1SXD A;  3TAR A;  7ICE A;  3C2M A;  1QLN A;  3PV8 A;  4KLU A;  5D4B A;  4NLZ A;  4KN4 A;  3AQN A;  1JXL A;  2XC9 A;  2K8B B;  1PK1 B;  3WU2 U;  4QZB A;  2W54 A;  3MAB A;  5KG0 A;  4I2J A;  9ICT A;  4NXV A;  2MRL A;  2IA6 A;  4FHV A;  1NZB A;  4N7R A;  1FO4 A;  3C2L A;  4YD1 A;  2NRT A;  2K60 A;  5KNI A;  4DOB A;  4Y2Y A;  4AT7 A;  4GXI A;  3WK5 A;  4RNM A;  4R64 A;  2KFN A;  2KJ9 A;  2O5A A;  1TV9 A;  2XY5 A;  3K75 D;  4EP7 A;  3OUY B;  1RQL A;  3HKZ C;  4M9N A;  4IRD A;  4DLG A;  3OV7 A;  3KBB A;  2H3Z A;  2ZH6 A;  2PKE A;  3BS5 A;  5KG3 A;  4FHP A;  1HUZ A;  4PL2 A;  2DR5 A;  1SV0 C;  3LVV A;  4Q8E A;  2HHS A;  2F8K A;  1ZXI A;  4HAI A;  4KTQ A;  1SZH A;  5DED A;  5IIK A;  4DL4 A;  5KT7 A;  3B0Y A;  4NKT A;  4NJ8 A;  5DBC A;  1A77 A;  1ZQS A;  7ICN A;  1ZJM A;  2IUB A;  4B6J A;  3SV3 A;  5ALH A;  2XID A;  2ZJ8 A;  4F5P A;  1YZ6 A;  1HEK A;  4PHE A;  1X6I A;  5EE1 A;  2RQ5 A;  4C8M A;  3GU3 A;  1MN8 A;  2BE3 A;  3Q8S B;  3RJG A;  2VA2 A;  1L3S A;  3ONN A;  5ALZ A;  2L5Y A;  2ZXI A;  2HHX A;  5AI0 A;  1ZQM A;  4ZOH C;  5KG5 A;  2R8G A;  3M9M B;  2KSO A;  3RBD A;  3V6K A;  4CGZ A;  5DDY A;  4IC9 A;  3PX0 A;  2UVV A;  3OVS A;  2AH5 A;  2HHW A;  2BPG A;  1OXJ A;  3MC1 A;  3CW2 C;  2B51 A;  1RZT A;  3NRZ A;  2DBY A;  1ZQW A;  4R66 A;  1PVQ A;  8ICA A;  2Y0S F;  5EE9 A;  4J9K A;  4O9M A;  3OVB A;  2XCP A;  3AU6 A;  2FDR A;  3J81 j;  3HJ1 A;  2CXY A;  3EPI A;  2R18 A;  2W9A A;  4DFJ A;  1UEU A;  3GDX A;  1A0P A;  5D49 A;  5KFU A;  5J0Y A;  2MUT A;  4ED2 A;  1F0M A;  3C18 A;  2FE9 A;  4ECT A;  1WG8 A;  5HRD A;  3U26 A;  2E1E A;  1NNL A;  2LYH A;  2F1I A;  1XSP A;  4EEL A;  3B9J A;  2LYB A;  9ICS A;  4KLF A;  5AM0 A;  2HBM A;  3IP4 B;  4O3P A;  4F71 A;  1ECW A;  2PBE A;  3ZI4 A;  3ER8 C;  1ZQN A;  4Y2R A;  2EWR A;  4PHA A;  5KT3 A;  8ICL A;  3WFQ E;  3AM9 A;  5CHG A;  5J0W A;  3PY8 A;  1MIV A;  3AQK A;  3BDP A;  1YLQ A;  2YQE A;  1JRP A;  4F5O A;  1X42 A;  5A0L A;  4DQS A;  8ICJ A;  3QNM A;  1NKB A;  5J0X A;  1T3Q A;  3NVO A;  3F2B A;  4GXJ A;  3ZDD A;  4EX7 A;  1O08 A;  1T3N A;  2P6R A;  2C28 A;  3I28 A;  2DGZ A;  4GFJ A;  3JPT A;  3ISB A;  5AKK A;  4I2I A;  5ALE A;  3MDA A;  4E8F A;  5HRK A;  5DQG A;  4AT9 B;  2XY6 A;  2GWS A;  5HMM A;  1L8L A;  4P0P A;  4DF4 A;  4P0Q B;  3IRU A;  3PNC A;  2R8J A;  2WHE A;  7ICQ A;  4HX0 A;  1KW4 A;  1V4A A;  2VKQ A;  4P2H A;  7ICS A;  2VJ4 A;  5J0T A;  2EZZ A;  3UPQ A;  1TVA A;  4HYK A;  3N97 B;  5AKI A;  5AM5 A;  4J9N A;  2ISP A;  2KZZ A;  4J9R A;  1K1Q A;  5JRT A;  1U9L A;  4R63 A;  1NK5 A;  2I1Q A;  2Z7J A;  3TKA A;  1WWV A;  2HHT A;  3RTV A;  5IIL A;  2E3T A;  3V6H A;  2FI1 A;  4MF2 A;  1VJ7 A;  1ZRN A;  4KLD A;  1EXN A;  3GII A;  9ICH A;  2BDU A;  2EH9 A;  3HIL A;  4K99 A;  4IQU A;  1L7P A;  1LVH A;  4WH5 A;  4KLJ A;  1KSP A;  4F4X A;  1B22 A;  4I2B A;  4RQ1 A;  3HX0 A;  4EEN A;  2FCL A;  3H0R B;  4ATB B;  3PZP A;  9ICW A;  2J6U A;  3H39 A;  2NRX A;  1TK0 A;  5KFY A;  4PHD A;  4JB3 A;  4UB8 U;  5ALK A;  2G5I B;  5IIN A;  1NZP A;  3QUQ A;  3PR5 B;  2EAP A;  4YN4 A;  2A19 A;  2ISO A;  1Q8K A;  4BUG A;  7ICR A;  2HBL A;  1D8Y A;  1UT8 A;  3H8M A;  3SAH A;  2BCQ A;  1QSS A;  3RR8 A;  5L1J A;  4WC3 A;  5ALX A;  4IL6 U;  2LKY A;  1FEZ A;  2D3D A;  5CFT A;  4EEK A;  4DF8 A;  2G0A A;  1XSL A;  2V9W A;  4UAU A;  4I2H A;  3V7K A;  4WQK A;  4K9B A;  3CRX A;  2GLE A;  3RJF A;  3WK8 A;  4RPZ A;  4M9G A;  7ICH A;  5AKE A;  1KL9 A;  1JI7 A;  3H7I A;  9ICX A;  1UA1 A;  5IIJ A;  4LEY A;  2B6G A;  2KG5 A;  4ACO A;  1OU5 A;  5ALG A;  2C2E A;  5D61 A;  2KJ8 A;  2A3V A;  3JPO A;  4RQ7 A;  3ZDC A;  1V97 A;  2I9G A;  1ZQZ A;  1NOM A;  4G9B A;  2IHN A;  4YP3 A;  3UMB A;  4XRH A;  5KFS A;  3OSN A;  4EYI B;  9ICK A;  1ZQG A;  2C2D A;  4KLH A;  2HSZ A;  3NUQ A;  4Y2T A;  3EYZ A;  4IQV A;  5J8Y C;  2HW3 A;  4DL7 A;  1NK6 A;  4WCW A;  4Q45 A;  4PH5 A;  5BPC A;  3M6K A;  4Y2U A;  9ICF A;  2KD1 A;  2BQ3 A;  8ICV A;  3Q8P B;  2AXT U;  4UW9 A;  3KHL A;  2KOB A;  3PSP A;  1KRP A;  4RQ6 A;  2ZG6 A;  3MFI A;  8ICK A;  2KKP A;  4RUC A;  1L3V A;  4NLK A;  1URJ A;  5J2G A;  2BHN A;  8ICZ A;  3NYB A;  3SAG A;  4F72 A;  3H37 A;  4RQN A;  5KFI A;  5KFR A;  3F5A A;  5HRI A;  4IRK A;  2E8N A;  4ECW A;  1VJ5 A;  4Q43 A;  4P4O A;  4KLE A;  4Y2Q A;  5DG7 A;  4FFD A;  5HRF A;  4X4O A;  2OYY A;  4BDP A;  2Q66 A;  4TUP A;  1ZQT A;  5AKY A;  3ORY A;  2ZH1 A;  4B9M A;  4YMO A;  4OD0 A;  3ICX A;  3WKC A;  2OXO A;  4ED8 A;  2Y9U A;  3N7P D;  3OTQ A;  8ICB A;  5GTH U;  3Q8K A;  2K4H A;  3PW5 A;  4YXM A;  9ICI A;  4TQR A;  2BQU A;  1ZQX A;  5DQI A;  3BS5 B;  3DV9 A;  1ZET A;  1UPH A;  8ICO A;  4C8O A;  4JUZ A;  2B56 A;  4JLX A;  4Y2J A;  1N63 A;  3H8W A;  4O3N A;  3G6X A;  4IS7 A;  3B0X A;  1DXS A;  4OAH A;  5AM1 A;  3E58 A;  3FYH A;  4QZH A;  3AQM A;  2ZHA A;  2F44 A;  4UAW A;  4YD2 A;  4NLG A;  3H40 A;  2A1A A;  4AT8 A;  4EZ6 A;  3H8S A;  5DGB A;  5CP2 A;  3QYP A;  2PMZ C;  1ZRM A;  1NI3 A;  3OPX A;  5KG1 A;  4AYB C;  4KMO B;  3UMG A;  2W9C B;  2R8I A;  8ICU A;  4GLX A;  8ICF A;  4XUS A;  3MCR A;  4QIW C;  2ZUD A;  2ZH5 A;  3HW8 A;  3T3F A;  2MU2 A;  1TE2 A;  2RDI A;  2PFN A;  2G07 A;  1N62 A;  2HBJ A;  5AKJ A;  4RT2 A;  3RJJ A;  3JYY A;  3M9N B;  1SB3 C;  1TAM A;  4FS2 A;  3C29 A;  4DSI A;  3AL0 B;  5AKH A;  1S9F A;  1KKX A;  3JPR A;  1ZQH A;  1IG6 A;  2KZ3 A;  3RH4 A;  4QZ9 A;  9ICC A;  1MIY A;  2W9C A;  2BCU A;  4ELU A;  2FPM A;  3QU7 A;  4TUS A;  2K8A A;  4LT6 A;  5F3X B;  4KLI A;  5KG6 A;  3IG8 A;  1Q3U A;  4YR2 A;  9ICN A;  1ZYQ A;  1HJP A;  3C2K A;  5J29 A;  1C20 A;  2ODG A;  3LVW A;  1F5A A;  4DEZ A;  3PSI A;  3BZC A;  4XA5 A;  4OCZ A;  4ECX A;  4KLT A;  3MDC A;  3LYS A;  1L7N A;  2AHO B;  2WAQ C;  3QX7 A;  5KL8 B;  3AQF A;  2JEG A;  4DQP A;  5DB6 A;  1D8B A;  3F53 A;  3GV5 B;  2KNJ A;  3QEA Z;  2FLL A;  1WYG A;  9ICV A;  3NAS A;  4CF5 A;  1JMS A;  3QE9 Y;  4J03 A;  3RRG A;  3MBY A;  4O6A A;  1V38 A;  5HHH A;  3K7D A;  3UXO A;  2BCS A;  2DR8 A;  2BPC A;  1PX5 A;  4FO1 A;  3C66 A;  3UM9 A;  3G6Y A;  1FIQ A;  5IIM A;  1CI4 A;  4NV0 A;  2ZTE A;  1ZQO A;  5DLF A;  3UPS A;  5KFP A;  3MR2 A;  5ALL A;  3KFU F;  4U6P A;  2ZH9 A;  3IN5 A;  2EZY A;  2WB1 F;  1S10 A;  4A8E A;  3QU9 A;  5EWF A;  2JGA A;  8ICI A;  5AKG A;  7ICT A;  3PW4 A;  3RAQ A;  5B66 U;  2YML A;  5KFB A;  2ATL A;  2NYV A;  1DK3 A;  1TKD A;  4E80 A;  2KHV A;  2WF6 A;  3RF9 A;  1VFG A;  8ICT A;  4QWD A;  1RDF A;  1TFR A;  2JR5 A;  3TQ1 A;  5ALO A;  3L3F X;  3NTU A;  3FC4 A;  5G5H A;  3BQ0 A;  4OJO A;  2NO4 A;  3V7L A;  7ICJ A;  2WF8 A;  2ZUB A;  4B9T A;  4O5K A;  2DRB A;  3AEV A;  2JXJ A;  4NLB A;  1ZQQ A;  4UB6 U;  1BVS A;  4C8L A;  1X9X A;  1ZQI A;  4BXO A;  4DQR A;  3C21 A;  1RYS A;  3PW0 A;  2F3N A;  4F92 B;  4O3R A;  2KTQ A;  5HRH A;  2KMD A;  3KHH A;  4K4G A;  4S3N A;  1ARO P;  1UHU A;  5ALY A;  4LEW A;  1BNO A;  3QXG A;  2ZTD A;  5DQH A;  5GTI U;  3KHR A;  4DS4 A;  3C28 A;  2M0N A;  3ZDE A;  4WJ3 B;  4YFK A;  3ZD8 A;  4DFD A;  8ICN A;  1PUZ A;  1UCV A;  3BZK A;  8ICE A;  4NXU A;  4I2C A;  3KD3 A;  5ALT A;  2E5S A;  7ICG A;  2RRD A;  1BGX T;  2CN1 A;  2W3S A;  5ALR A;  1Q3V A;  4EBJ A;  3QUT A;  4CE6 A;  3PW7 A;  1J2M A;  3BS7 A;  2DR7 A;  1X9S A;  3SV4 A;  2ASL A;  1DRG A;  4IQT A;  2B0C A;  1SIJ A;  5KFH A;  2FMS A;  2IOH A;  1TK5 A;  5KAI U;  2F1J A;  3EWA A;  2OH2 A;  5D62 A;  4OO1 J;  2JEF A;  5DEC A;  4DQQ A;  3RB4 A;  1MIW A;  3PX6 A;  4R65 A;  4ED0 A;  2AJQ A;  3MGI A;  3T5H A;  3OWG A;  4EEY A;  4KLO A;  4CF4 A;  5J2K A;  2KE7 A;  1OUQ A;  1K1S A;  4P0Q A;  4M9H A;  4KLM A;  4DOA A;  4I2D A;  2BCR A;  4WC0 A;  4DFP A;  5III A;  1TK8 A;  5D46 A;  4JV2 A;  2HMX A;  4YCX A;  1KEJ A;  1KBU A;  1F5S A;  1WOT A;  4Y2S A;  2ZIU A;  1TFY A;  2EAO A;  3ERC C;  1YZ7 A;  1SWV A;  1BPD A;  2A1J A;  4O3M A;  5KFE A;  3WKE A;  5ALD A;  2NRK A;  3WK7 A;  2VA3 A;  2GH1 A;  5J0S A;  3RJI A;  5HRL A;  2DKX A;  3VCB A;  3V6J A;  2O1P A;  4UB1 A;  1UT5 A;  4MFA A;  3WK9 A;  2WAQ F;  2H5X A;  2CPR A;  4BJQ A;  3IDW A;  1Z3E B;  2ZIV A;  2ZIU B;  2O6K A;  3QU4 A;  4EBC A;  4GXK A;  3PX4 A;  5HC9 A;  3PHZ A;  2EQY A;  4JK1 A;  2UVU A;  5B3P A;  2ZH2 A;  5DBA A;  3ETR A;  3N7R C;  1TFW A;  2YX8 A;  3PST A;  4US8 A;  2W11 A;  4EBD A;  5AI4 A;  5DKW A;  4UBB A;  1MA7 A;  1Z4N A;  2MSN A;  3NVZ A;  2W7O A;  9ICE A;  4P4P A;  4I2F A;  4JV1 A;  4YR3 A;  5HR9 A;  5ALF A;  2ZIV B;  4E7X A;  1Y88 A;  3PR4 A;  4F3O A;  8ICC A;  3GFK B;  1ZQB A;  1U47 A;  3KKA C;  1NKC A;  2LM1 A;  2LM4 A;  2ZTC A;  5KFN A;  3MR5 A;  4RNN A;  3F5E A;  5KT6 A;  2K4E A;  1JX4 A;  4DSJ A;  4KLL A;  2DR9 A;  4O0I A;  1SZP A;  4OAF A;  4NLC A;  4NXZ A;  4EX6 A;  1FFU A;  4KIT B;  4QWB A;  3RAX A;  4RWN A;  3C5G A;  4AT8 B;  3QUC A;  1XU4 A;  4XQ8 A;  2E8M A;  5HHI A;  5JTI A;  4F5R A;  1Q79 A;  5B5E U;  5ALI A;  4M04 A;  4OJL A;  2DWQ A;  1RYU A;  2EAM A;  4YG2 A;  3ZDA A;  3AQL A;  2DL0 A;  5EE3 A;  2E1F A;  5AK4 A;  3HJ4 A;  4X4S A;  1O03 A;  5KG7 A;  4RWQ A;  1SL1 A;  1RM6 C;  2FMP A;  2ZH8 A;  3OSP A;  1P7D A;  4IG8 A;  2KVS A;  1BPY A;  4FHX A;  2GOL A;  5EE0 A;  3Q8R B;  1OW5 A;  3VC8 A;  3OJS A;  2I6X A;  2JZB A;  5L9X A;  5DB7 A;  4PZO A;  4F4K A;  1V85 A;  3TAC B;  2FJ6 A;  3SD7 A;  4O5E A;  5J2I A;  2FPL A;  5AK6 A;  4O3S A;  3T5J A;  2KP7 A;  1Z1B A;  3V7J A;  4ED6 A;  1L3T A;  3OHB A;  5JUM A;  1HIW A;  5J0U A;  4P4M A;  4RQ0 A;  5AI8 A;  1MC8 A;  1SV0 A;  4GC6 A;  1NK0 A;  2FLP A;  3JCF A;  2YN4 A;  4ICA A;  4C80 A;  1PK1 A;  5HR6 A;  1NJX A;  1ZQ1 C;  1ZQJ A;  4X0B A;  4C8N A;  5AI9 A;  3L9D A;  3A0H U;  3C1Y A;  5AI5 A;  4WBY A;  1ZQP A;  2H3Q A;  4ECS A;  2QB1 A;  8ICX A;  2BBJ A;  2IHM A;  2JRZ A;  3BQ2 A;  4QZI A;  1ZQL A;  2HN2 A;  1SXE A;  1ZJN A;  4F93 B;  1SKW A;  3NGD A;  4K9A A;  5HRG A;  4DL3 A;  2EDU A;  2NRV A;  5ALS A;  1ZOL A;  4UAV A;  1DGS A;  3OUY A;  4AT7 B;  5KFK A;  1LV5 A;  3L5K A;  4KN7 A;  4UD5 A;  2AQ0 A;  2KEY A;  3TAD C;  3ED5 A;  1V9P A;  2XY7 A;  4F5Q A;  3BQ7 A;  3HIY A;  3SYZ A;  1QTM A;  4MFF A;  1X40 A;  3WFR E;  3QU5 A;  4DQI A;  3SAF A;  1B0X A;  3RJH A;  5L1L A;  5HNK A;  4M47 A;  2ZJA A;  4QWE A;  5KT5 A;  3T5L A;  2AGP A;  2I5H A;  4NXT A;  2HN1 A;  4DLE A;  5KL1 B;  2KN7 A;  3ISC A;  2FLN A;  4FZL A;  4J9S A;  4B9L A;  4B9S A;  5L1I A;  1X2I A;  3GQC A;  5EWG A;  4XJE A;  4AYB F;  4FS1 A;  3SI8 A;  5HML A;  3HWT A;  5KFO A;  3C5F A;  2MA1 A;  5KAF U;  4C7Y A;  4DCC A;  5TIS U;  1J97 A;  4BXO B;  3HT3 A;  4QZG A;  4LZG A;  4QW9 A;  2KZM A;  4YQW A;  4PPX A;  4O5C A;  1DK2 A;  4FHW A;  1ZQR A;  3G6V A;  3KZI U;  2AGQ A;  3RB6 A;  3D2S A;  4EEB A;  2WF9 A;  7ICV A;  4EBK A;  4MEY A;  5ALV A;  4QZ8 A;  4TUR A;  4DL2 A;  9ICL A;  4LEZ A;  2YMQ A;  2FMQ A;  7ICF A;  1KQQ A;  3MR3 A;  2D6F C;  2J6S A;  2NV3 A;  2KIW A;  2V4R A;  2JH1 A;  5BOM A;  1S0O A;  3RJK A;  5JU5 A;  7ICO A;  4FHY A;  2V4Q A;  4C4T A;  3QZ7 A;  5AKX A;  3QUB A;  5ALW A;  4NL9 A;  2BPF A;  4WC2 A;  1ZD4 A;  4QZE A;  4ECZ A;  4QJF B;  4O3Q A;  4B9U A;  2YY6 A;  1NK4 A;  4DS5 A;  4FBU A;  3RB0 A;  1ZQA A;  2RFF A;  1ZD5 A;  1SGG A;  5DG8 A;  4EED A;  5KFC A;  5J0O A;  2HI0 A;  3RH5 A;  3TI0 A;  3JPQ A;  3AUO A;  2Y9T A;  1PK3 A;  2PXI A;  2LBO A;  1N5W A;  4EGW A;  3TFR A;  3JPS A;  4UB4 A;  5AM4 A;  4UAY A;  3CK6 A;  2ZH3 A;  2BKE A;  4USA A;  4WC6 A;  1T94 A;  4OAG A;  2F2A B;  4TUQ A;  1BNP A;  5J2J A;  4RQ4 A;  5KT2 A;  5JTG A;  3NVW A;  4ED3 A;  5J2A A;  4PGX A;  2DQN B;  1QCK A;  1TAQ A;  4I29 A;  3WK6 A;  2YTU A;  2B4V A;  1D8L A;  4KLG A;  4I2A A;  2ES6 A;  1M6Y A;  1X66 A;  2ALZ A;  1PVR A;  3JPP A;  2HOF A;  4M9L A;  4M2Y A;  5KFQ A;  1D9F A;  1S8O A;  4NM1 A;  4B9V A;  7ICK A;  2EZX A;  2UVW A;  5AKZ A;  4RUA A;  5J2E A;  3OJU A;  2LI6 A;  3RFA A;  8ICP A;  3H38 A;  1IXR A;  4AT9 A;  5F9L A;  3ZD9 A;  4I28 A;  4M6W A;  2HOI A;  3TAN A;  2NRW A;  4Z6C A;  4KM5 A;  1NJZ A;  2ASJ A;  5HRB A;  1J2N A;  2AGO A;  4F5N A;  3NWI A;  3O0F A;  4NM2 A;  5CFS A;  2W9M A;  3BQT A;  1ZQV A;  2YMM A;  4UB3 A;  1T4G A;  4UQG A;  2K4P A;  2D8C A;  2GO7 A;  4EV6 A;  4KMU A;  3WKA A;  2WB1 C;  8ICY A;  5AI6 A;  4X4V A;  5ALJ A;  4X0A A;  2C2R A;  4MFC A;  4WQL A;  2OEH A;  3RB3 A;  2YB1 A;  4X5V A;  1AQ6 A;  3H4B A;  1S0N A;  5F9N A;  3Q8M A;  4WBZ A;  1NK8 A;  1S76 D;  4M9J A;  4WC4 A;  2QB0 A;  3LDA A;  3WFP A;  2WF7 A;  4QW8 A;  3D2N A;  4CCH A;  3M1Y A;  3MGH A;  2QLT A;  1RYR A;  5CEH A;  1Z4O A;  3WFO A;  3PVX A;  2PI5 A;  3IG5 A;  4O3O A;  9ICB A;  4O69 A;  4RZR A;  9ICG A;  4JWM A;  2K4I A;  2ZXH A;  4PGY A;  1JQR A;  3AN1 A;  1DGJ A;  2E8O A;  3UXP A;  3T5K A;  3JPN A;  5E79 U;  3L4P A;  2XGQ A;  3TAD A;  2Y1I A;  1NKE A;  4WOY A;  3H0L B;  3SR6 A;  1QSL A;  5D63 A;  4JMU A;  2KHQ A;  4LZD A;  3FDS A;  5KFG A;  4UAT A;  3GIK A;  3QZ8 A;  5J0R A;  2M2U A;  2PFQ A;  1N5X A;  2NRZ A;  5J2C A;  3IV6 A;  4J9Q A;  1QQ7 A;  8ICG A;  5KG2 A;  1S0M A;  2HDO A;  5KFM A;  2YMP A;  4PHP A;  2G08 A;  5J2D A;  5BOL A;  4MF8 A;  2R8H A;  4RU9 A;  2M2W A;  4X4N A;  2BR0 A;  4DOC A;  4MEX A;  4WC5 A;  5KFX A;  4QZC A;  3BQ1 A;  4DSF A;  4ELT A;  3UXN A;  4F8R A;  1U48 A;  3ISD A;  1F44 A;  4Q8F A;  5H2F U;  3GZF A;  3TAQ A;  3Q8Q B;  2WTF A;  3IM1 A;  3KHG A;  3H3A A;  2YB4 A;  1GO3 F;  4MKP A;  2JV3 A;  3K1Z A;  2LYA A;  4OJP A;  4RQ5 A;  2G5H B;  4ECU A;  5ALP A;  2Q4T A;  5DLG A;  3N7S C;  1ZD3 A;  4ED7 A;  4UB2 A;  1D9D A;  4LVS A;  4QNL A;  3MGV A;  1L6N A;  3H0M B;  1COO A;  4KX5 A;  2VA8 A;  1JRO A;  3BJY A;  4UAZ A;  1ZQK A;  1R8B A;  2ZH4 A;  2RLT A;  4PJ0 U;  2KJ5 A;  9ICM A;  4Z6F A;  5DBB A;  3D2Q A;  5J2B A;  4C7Z A;  3EF2 A;  4UD4 A;  4J9P A;  4C4R A;  4X4R A;  2Q0Z X;  2KK0 A;  1Q78 A;  4FBT A;  2BQR A;  4Y2V A;  1XO1 A;  8ICW A;  3A0B U;  1KTQ A;  9ICQ A;  4C4S A;  2ZIW A;  1KFT A;  3SEN A;  3WKD A;  4F4Y A;  2UVR A;  1ZQE A;  3FM9 A;  2RHF A;  4CNQ A;  1A6S A;  1RXV A;  2ID1 A;  4DFK A;  3RH6 A;  5DB8 A;  1NK9 A;  2Y0S C;  4FH5 A;  8ICH A;  5J0Q A;  5KFA A;  9ICP A;  4RWO A;  4FE3 A;  3CP8 A;  4JV0 A;  1FFV A;  4R8U A;  7ICP A;  1U49 A;  5G5G A;  2W9B B;  4KB6 A;  3LWM A;  1RQN A;  2XCA A;  4M5D A;  4OJ5 A;  4F4Z A;  1JXE A;  5CWR A;  3PW2 A;  8ICS A;  1NK7 A;  4UBC A;  8ICQ A;  2VIX A;  3ETL A;  2IBK A;  5AKL A;  2ZJ5 A;  1NO5 A;  2HHU A;  2M2V A;  5HP4 A;  3PO5 A;  9ICA A;  2WFA A;  1C7Y A;  2GAF D;  3WK4 A;  3GIL A;  3V72 A;  4NWI A;  3AMZ A;  4R8U B;  1KDH A;  2DF4 B;  1XS9 D;  4G3I A;  3WKB A;  5AHX A;  4QZD A;  1SKS A;  5HR7 A;  4K98 A;  3UMC A;  2JEI A;  2XVT A;  4UAS A;  2J6T A;  5CA7 A;  3NVY A;  3RJE A;  4RQ3 A;  2LHT A;  3C1Z A;  3QEB Z;  5KFT A;  1CEZ A;  5AK3 A;  2BGW A;  1FA0 A;  1HUO A;  2PI4 A;  4DL6 A;  3PSF A;  3R9K A;  4JWN A;  4RPY A;  4EYH B;  4IRC A;  2G06 A;  1TAU A;  2QKQ A;  3T79 A;  4BGD A;  2DFL A;  1JIH A;  3PMN A;  1LKY B;  4DSL A;  1N60 A;  4ECY A;  2Y1J A;  1N56 A;  1WWU A;  2IOF A;  3HKZ F;  2W04 A;  4YMN A;  1MSW D;  1QQ6 A;  3KZX A;  5KFW A;  4DFM A;  3EPG A;  4Y2P A;  4I2E A;  5KFL A;  4CDG A;  3GIJ A;  2OHF A;  4F4W A;  1T8E A;  4DWI A;  2DKZ A;  2G09 A;  2N1R A;  3GV7 B;  4E0D A;  1LKY A;  9ICR A;  2XGP A;  4QIW F;  1NJW A;  1IM4 A;  1SV4 A;  9ICJ A;  4M0A A;  1K5O A;  5AIC A;  2OWO A;  3M9O B;  1A76 A;  5AM3 A;  2CRX A;  5KTQ A;  5J2F A;  2FPK A;  5CRX A;  2PMZ F;  1S5L U;  4M6W B;  4IQW A;  5DB9 A;  4NKU A;  7ICM A;  3WFS C;  3M7D A;  4DSE A;  4LEV A;  1R8A A;  2KIV A;  1LB2 B;  3NKU A;  2B21 A;  2QAR A;  4NL9 C;  2HOQ A;  2JHD A;  4X4P A;  1BPB A;  3KOO A;  3N4M B;  1X9M A;  4RQ8 A;  2R8K A;  5TZV A;  2HHQ A;  5CFU A;  3SEI A;  4OAI Z;  1B4F A;  4ED1 A;  3RBE A;  4K4H A;  5ALQ A;  4YXJ A;  5L1K A;  4ECQ A;  5FP0 A;  1IIP A;  5J2H A;  1XWL A;  4I27 A;  1CRX A;  4K97 A;  5CR0 A;  1B43 A;  5F2V O;  3LWL A;  1QH9 A;  2EAN A;  3AU2 A;  4PL1 A;  4KLS A;  2BCV A;  1SL0 A;  4O68 A;  4K8V A;  3ZDB A;  2KVC A;  3ALR A;  3D6J A;  4I2G A;  4X4T A;  2ZH7 A;  5KG4 A;  3FAH A;  1SL2 A;  4C8K A;  2ZIX A;  2NO5 A;  4KX3 A;  1ZQC A;  3OGU A;  1JN3 A;  4AP9 A;  2HVH A;  4RQ2 A;  4BX9 C;  1WCN A;  1ZQU A;  3M8S A;  2ZIW B;  4ELV A;  5DDM A;  3RRH A;  1RXW A;  4NLN A;  2H3I A;  2M2T A;  1ED1 A;  4YMM A;  3MFH A;  5KFJ A;  4DO9 A;  5J0P A;  2E8P A;  1Z19 A;  4RWP A;  4O67 A;  1ZQY A;  1UET A;  4C0Z A;  3F2C A;  3AQE A;  3H4D A;  2HHV A;  1X9W A;  2ZIX B;  1N61 A;  1KN5 A;  1GPJ A;  1JAL A;  2W3R A;  4Y2X A; 
#chains in the Genus database with same CATH homology
 3KHR A;  1T3N A;  4DS4 A;  2C28 A;  2P6R A;  1D8L A;  3ZDE A;  4KLG A;  4I2A A;  2PFP A;  3JPT A;  2ALZ A;  4YFK A;  3JPP A;  3ISB A;  4M9L A;  3ZD8 A;  4TQS A;  4M2Y A;  8ICN A;  5KFQ A;  3M8R A;  1D9F A;  4BWM A;  8ICE A;  4I2I A;  2DPJ A;  4WC1 A;  4NM1 A;  5DGA A;  4Q44 A;  4B9V A;  3MDA A;  7ICK A;  4ECV A;  4E8F A;  2M9N A;  2UVW A;  5HRK A;  4I2C A;  4RUA A;  3UQ0 A;  5J2E A;  5DQG A;  3OJU A;  4X4U A;  4Z6E A;  4ECR A;  5HRE A;  8ICP A;  2MUT B;  7ICG A;  4AT9 B;  2XY6 A;  1QSY A;  2GWS A;  5HMM A;  2BDP A;  1BGX T;  5CB1 A;  7ICI A;  1IXR A;  3H38 A;  4AT9 A;  3UQ2 A;  4EBJ A;  1BPX A;  2DVI A;  3GIM A;  4DF4 A;  1NJY A;  5F9L A;  3PNC A;  3ZD9 A;  2R8J A;  4I28 A;  4M6W A;  3PW7 A;  2IMW P;  2XO7 A;  7ICQ A;  2DR7 A;  4PGQ A;  1X9S A;  3SV4 A;  4UB5 A;  3OHA A;  2W8L A;  2ASL A;  1V4A A;  3TAN A;  4KLQ A;  3SZ2 A;  7ICS A;  4P2H A;  2NRW A;  4Z6C A;  5J0T A;  4IQT A;  3UPQ A;  1S97 A;  1TVA A;  1NJZ A;  2ASJ A;  4HYK A;  2AGO A;  5HRB A;  4F5N A;  4NM2 A;  4ZH4 A;  5KFH A;  3N97 B;  2FMS A;  2KZZ A;  2ISP A;  4J9N A;  1TK5 A;  5EWE A;  2W9M A;  4J9R A;  3BQT A;  1K1Q A;  2F1J A;  1ZQV A;  3E2E A;  1U9L A;  3EWA A;  4R63 A;  1S77 D;  4BWJ A;  8ICM A;  1NK5 A;  4UB3 A;  2JEF A;  3KTQ A;  5DEC A;  1T4G A;  4DQQ A;  1ZQD A;  2I1Q A;  2MAX A;  3RB4 A;  4UQG A;  3C23 A;  3PX6 A;  4R65 A;  4ED0 A;  2AJQ A;  4RPX A;  3MGI A;  3T5H A;  1MIW A;  2HHT A;  4EEY A;  3RTV A;  5IIL A;  4KLO A;  7ICL A;  5J2K A;  3V6H A;  2ZUC A;  5C5J A;  4KMU A;  4MF2 A;  1XSN A;  8ICY A;  1VJ7 A;  4X4V A;  1K1S A;  4M9H A;  2C2R A;  4KLM A;  4X0A A;  4KLD A;  1EXN A;  4DOA A;  3GII A;  3RB3 A;  1XC9 A;  1KLN A;  4X5V A;  4MFC A;  9ICH A;  4I2D A;  4F2S A;  2BCR A;  4WC0 A;  4J9O A;  3H4B A;  1JAJ A;  1DOQ A;  4IQU A;  5F9N A;  1S0N A;  4DFP A;  5III A;  1TK8 A;  5D46 A;  4JV2 A;  4X4Q A;  3Q8M A;  1KSP A;  4KLJ A;  4WBZ A;  1MQ3 A;  4F4X A;  1NK8 A;  4YCX A;  1S76 D;  1KEJ A;  1B22 A;  4I2B A;  4RQ1 A;  1SKR A;  4GC7 A;  3HX0 A;  1UEV A;  4M9J A;  4WC4 A;  3LDA A;  4IR1 A;  4ATB B;  1WOT A;  3WFP A;  4F2R A;  9ICW A;  2A1J B;  4QW8 A;  2J6U A;  3H39 A;  4CCH A;  1TFY A;  2P66 A;  3MGH A;  2NRX A;  1RYR A;  1TK0 A;  5KFY A;  4PHD A;  1BPD A;  2A1J A;  1CUK A;  3WFO A;  3PVX A;  5KFE A;  2PI5 A;  5IIN A;  4O3O A;  1NZP A;  3PR5 B;  1N48 A;  9ICB A;  2NRK A;  5KFZ A;  4YN4 A;  1KFD A;  4RZR A;  2ISO A;  2VA3 A;  9ICG A;  7ICR A;  5J0S A;  3RJI A;  4PGY A;  1D8Y A;  4JWM A;  1JQR A;  5HRL A;  1UT8 A;  2F1H A;  2BCQ A;  1QSS A;  3UXP A;  5L1J A;  3RR8 A;  3T5K A;  4QZF A;  5KFF A;  3V6J A;  1R8C A;  4WC3 A;  2O1P A;  4UB1 A;  3JPN A;  1UT5 A;  2W9B A;  4MFA A;  1U4B A;  2XGQ A;  2Y1I A;  4YR0 A;  4DF8 A;  2H5X A;  1NKE A;  4DSK A;  2W8K A;  1XSL A;  1QSL A;  3THV A;  2V9W A;  4LZD A;  7ICU A;  2AQ4 A;  1Z3E B;  3FDS A;  5KFG A;  4I2H A;  3V7K A;  5EOZ A;  8ICR A;  5DG9 A;  1PZN A;  2DPI A;  3GIK A;  4GXJ A;  4EBC A;  4GXK A;  3PX4 A;  5HC9 A;  4JK1 A;  3RJF A;  4RPZ A;  3QZ8 A;  5J0R A;  2M2U A;  4M9G A;  7ICH A;  2UVU A;  2PFQ A;  9ICU A;  2ZH2 A;  5DBA A;  2NRZ A;  5J2C A;  1KFS A;  4J9Q A;  3H7I A;  4F50 A;  3K4G A;  4RT3 A;  8ICG A;  5KG2 A;  9ICX A;  1S0M A;  1H38 A;  1TFW A;  1UA1 A;  4EBD A;  3TFS A;  3LK9 A;  2DRA A;  5IIJ A;  5KFM A;  5DKW A;  4UBB A;  4PHP A;  5J2D A;  1OU5 A;  2C2E A;  5BOL A;  4MF8 A;  1U45 A;  2R8H A;  3JPO A;  4RU9 A;  9ICE A;  4P4P A;  2M2W A;  4RQ7 A;  4I2F A;  3ZDC A;  4YR3 A;  4JV1 A;  4X4N A;  2BR0 A;  4DOC A;  3EZ5 A;  4MEX A;  2I9G A;  2KFZ A;  4WC5 A;  5KFX A;  1ZQZ A;  1NOM A;  4QZC A;  5HR9 A;  3BQ1 A;  4DSF A;  4ELT A;  2IHN A;  4E7X A;  4YP3 A;  3UXN A;  4F8R A;  3H8J A;  3ISD A;  1Y88 A;  1U48 A;  2P6U A;  3LQC B;  4XQ7 A;  3PR4 A;  4Q8F A;  4F3O A;  4XRH A;  8ICC A;  3GFK B;  1ZQB A;  3TAQ A;  5KFS A;  3OSN A;  3Q8Q B;  4EYI B;  1U47 A;  1NKC A;  5KFV A;  2WTF A;  2PFO A;  3IM1 A;  9ICK A;  3KHG A;  1ZQG A;  2ZTC A;  5KFN A;  3GV8 B;  2C2D A;  3MR5 A;  4KLH A;  4RNN A;  3EYZ A;  3H3A A;  4IQV A;  5KT6 A;  2HW3 A;  1JX4 A;  1BPE A;  3EW9 A;  4DL7 A;  1NK6 A;  4DSJ A;  4KLL A;  2DR9 A;  4WCW A;  4RQ5 A;  4O0I A;  1SZP A;  4Q45 A;  1RPL A;  4PH5 A;  4ECU A;  9ICO A;  5BPC A;  5DLG A;  4NXZ A;  9ICF A;  4ED7 A;  4UB2 A;  1D9D A;  4LVS A;  4KIT B;  3OVA A;  4QWB A;  1T7P A;  4K4I A;  3RAX A;  2BQ3 A;  4RWN A;  3C5G A;  1S0V A;  3Q8P B;  8ICV A;  4AT8 B;  2JEJ A;  3KHL A;  1XU4 A;  4XQ8 A;  5HHI A;  2C22 A;  1COO A;  1KRP A;  4RQ6 A;  2VA8 A;  1ZQF A;  4RNO A;  4Z6D A;  3MFI A;  3Q8L A;  4F5R A;  3BJY A;  4EBE A;  8ICK A;  1Z00 A;  4UAZ A;  4RUC A;  3MR6 A;  1L3V A;  1ZQK A;  4NLK A;  1R8B A;  1Q79 A;  2ZH4 A;  5J2G A;  2BHN A;  8ICZ A;  2VAN A;  4QZA A;  3NYB A;  3H37 A;  4M04 A;  9ICM A;  4Z6F A;  3HP6 A;  5KFI A;  4YG2 A;  3IHQ B;  5KFR A;  5DBB A;  5J2B A;  3ZDA A;  4UD4 A;  3AQL A;  5HRI A;  4IRK A;  4J9P A;  5KFD A;  3HJ4 A;  4ECW A;  3RR7 A;  4Q43 A;  5KG7 A;  4FO6 A;  4X4S A;  4X4R A;  4P4O A;  4RWQ A;  1SL1 A;  4KLE A;  1R89 A;  2Q0Z X;  5DG7 A;  2FMP A;  2HVI A;  5HRF A;  1Q78 A;  4FH3 A;  1KNY A;  4X4O A;  2ZH8 A;  4FBT A;  4BDP A;  2Q66 A;  2BQR A;  4TUP A;  1WCL A;  1XO1 A;  4F91 B;  3OSP A;  1KTQ A;  8ICW A;  9ICQ A;  4IR9 A;  4ATB A;  4IG8 A;  1ZQT A;  1KFT A;  1BPY A;  1Z00 B;  3ORY A;  4FHX A;  4B9N A;  2ZH1 A;  4F4Y A;  2UVR A;  4B9M A;  4YMO A;  2HHP A;  1ZQE A;  3Q8R B;  4QWC A;  4ED8 A;  1RXV A;  2ID1 A;  2JZB B;  4DFK A;  1UA0 A;  1MQ2 A;  8ICB A;  3Q8K A;  3OJS A;  3PW5 A;  4DL5 A;  5DB8 A;  4J9L A;  4YXM A;  5CJ7 A;  3RH6 A;  4TQR A;  2JZB A;  1NK9 A;  2BQU A;  3PO4 A;  8ICH A;  9ICI A;  4FH5 A;  5J0Q A;  5L9X A;  5DB7 A;  5KFA A;  2RDJ A;  1ZQX A;  5DQI A;  1ZET A;  4J9M A;  1BPZ A;  4JV0 A;  4R8U A;  9ICP A;  3JZ0 A;  8ICO A;  7ICP A;  4C8O A;  4O5E A;  5J2I A;  2FPL A;  1U49 A;  4O3S A;  4JUZ A;  3PML A;  3T5J A;  4NY8 A;  3H8W A;  4O3N A;  3G6X A;  4YVZ A;  2W9B B;  3LWM A;  4QWA A;  3HPO A;  2XCA A;  3TAP A;  2ASD A;  2AU0 A;  2KP7 A;  5KT4 A;  4M5D A;  4F4Z A;  1JXE A;  5CWR A;  3V7J A;  3B0X A;  3PW2 A;  4ED6 A;  1NK7 A;  1L5U A;  8ICS A;  3FYH A;  4QZH A;  4UBC A;  3OHB A;  3ETL A;  5JUM A;  1L3T A;  2IBK A;  8ICQ A;  3AQM A;  2ZHA A;  5IIO A;  4UAW A;  2ZJ5 A;  4YD2 A;  5J0U A;  4P4M A;  4RQ0 A;  1L3U A;  3H40 A;  4F4K A;  4NLG A;  1MC8 A;  1NO5 A;  4AT8 A;  3TAR A;  2HHU A;  4WC7 A;  2M2V A;  7ICE A;  3C2M A;  4EZ6 A;  1QLN A;  3PV8 A;  3H8S A;  4GC6 A;  5DGB A;  5HP4 A;  1NK0 A;  5CP2 A;  2FLP A;  3PO5 A;  5D4B A;  4KLU A;  9ICA A;  1C7Y A;  4NLZ A;  4KN4 A;  3AQN A;  1JXL A;  1NJX A;  3GIL A;  1ZQJ A;  3V72 A;  4X0B A;  4C8N A;  2XC9 A;  3L9D A;  5KG1 A;  4R8U B;  1KDH A;  4QZB A;  3C1Y A;  3MAB A;  1XS9 D;  4G3I A;  4WBY A;  2W9C B;  2R8I A;  5KG0 A;  4QZD A;  4GLX A;  8ICF A;  4XUS A;  1ZQP A;  8ICU A;  3JYY A;  1SKS A;  4I2J A;  2ZUD A;  9ICT A;  2ZH5 A;  4ECS A;  8ICX A;  3HW8 A;  3T3F A;  2JEI A;  2IHM A;  2J6T A;  3BQ2 A;  4QZI A;  5CA7 A;  1ZQL A;  2RDI A;  2IA6 A;  2PFN A;  3RJE A;  4RQ3 A;  1ZJN A;  4F93 B;  4FHV A;  4RT2 A;  3C1Z A;  3RJJ A;  3QEB Z;  5KFT A;  3NGD A;  1SKW A;  3C2L A;  3M9N B;  4YD1 A;  4FS2 A;  2NRT A;  2BGW A;  1HUO A;  1CEZ A;  2PI4 A;  4DOB A;  5HRG A;  1FA0 A;  4DSI A;  4AT7 A;  4GXI A;  4DL6 A;  4DL3 A;  4R64 A;  2NRV A;  4RNM A;  1S9F A;  4JWN A;  4RPY A;  4EYH B;  2KFN A;  1DGS A;  4IRC A;  2O5A A;  1TAU A;  1TV9 A;  3JPR A;  4AT7 B;  3OUY A;  5KFK A;  1LV5 A;  2XY5 A;  1ZQH A;  4BGD A;  3K75 D;  4EP7 A;  4KN7 A;  4UD5 A;  2KZ3 A;  2AQ0 A;  3OUY B;  3RH4 A;  4QZ9 A;  9ICC A;  2DFL A;  1MIY A;  1JIH A;  3PMN A;  4M9N A;  2W9C A;  1V9P A;  2XY7 A;  4DLG A;  2BCU A;  4DSL A;  4ELU A;  4F5Q A;  4IRD A;  3OV7 A;  2FPM A;  4TUS A;  4ECY A;  3HIY A;  3SYZ A;  1QTM A;  4LT6 A;  2ZH6 A;  4KLI A;  2Y1J A;  1N56 A;  5KG6 A;  4YR2 A;  4MFF A;  9ICN A;  3WFR E;  5KG3 A;  1HJP A;  3C2K A;  1ZYQ A;  5J29 A;  4FHP A;  1HUZ A;  4YMN A;  1MSW D;  4DQI A;  1F5A A;  2DR5 A;  4DEZ A;  2ZHB A;  5KFW A;  3RJH A;  4XA5 A;  4Q8E A;  4DFM A;  5L1L A;  5HNK A;  4M47 A;  2ZJA A;  4QWE A;  4ECX A;  4KLT A;  3EPG A;  2HHS A;  4I2E A;  5KFL A;  5KT5 A;  3MDC A;  3GIJ A;  4KTQ A;  5DED A;  5IIK A;  3T5L A;  4DL4 A;  5KT7 A;  2AGP A;  3B0Y A;  4F4W A;  1T8E A;  4DLE A;  4DWI A;  4NKT A;  2KN7 A;  2JEG A;  5DBC A;  4DQP A;  1A77 A;  3GV7 B;  5DB6 A;  4E0D A;  3ISC A;  2FLN A;  9ICR A;  1ZQS A;  7ICN A;  1ZJM A;  2XGP A;  1NJW A;  1IM4 A;  3SV3 A;  4J9S A;  4B9L A;  4B9S A;  5L1I A;  2ZJ8 A;  4F5P A;  9ICJ A;  4M0A A;  3GV5 B;  1X2I A;  2OWO A;  3GQC A;  5EWG A;  4PHE A;  3QEA Z;  3M9O B;  4FS1 A;  1A76 A;  2FLL A;  4C8M A;  5HML A;  3HWT A;  3SI8 A;  5KTQ A;  5J2F A;  5KFO A;  2FPK A;  3C5F A;  9ICV A;  2BE3 A;  4M6W B;  3Q8S B;  4IQW A;  1JMS A;  5DB9 A;  3QE9 Y;  3RJG A;  2VA2 A;  7ICM A;  4NKU A;  3WFS C;  1L3S A;  3RRG A;  4BXO B;  3HT3 A;  2HHX A;  4QZG A;  4LZG A;  4QW9 A;  3MBY A;  4DSE A;  2KZM A;  4YQW A;  1ZQM A;  4PPX A;  1R8A A;  5HHH A;  4O5C A;  5KG5 A;  1LB2 B;  2R8G A;  3UXO A;  1DK2 A;  4FHW A;  2BCS A;  2B21 A;  1ZQR A;  2BPC A;  2DR8 A;  3M9M B;  3RBD A;  3G6V A;  1PX5 A;  3V6K A;  3C66 A;  3G6Y A;  5IIM A;  3RB6 A;  2AGQ A;  2ZTE A;  5DDY A;  3PX0 A;  7ICV A;  4EBK A;  2UVV A;  4X4P A;  1ZQO A;  5DLF A;  4MEY A;  1BPB A;  3N4M B;  3UPS A;  5KFP A;  2HHW A;  3OVS A;  2BPG A;  3MR2 A;  4QZ8 A;  4RQ8 A;  4TUR A;  4DL2 A;  5TZV A;  1X9M A;  2R8K A;  2HHQ A;  9ICL A;  2FMQ A;  7ICF A;  1RZT A;  3MR3 A;  2ZH9 A;  1ZQW A;  4R66 A;  1S10 A;  8ICA A;  4O9M A;  4J9K A;  2J6S A;  5EWF A;  8ICI A;  4RWO A;  3OVB A;  2XCP A;  3AU6 A;  4ED1 A;  2V4R A;  3RBE A;  7ICT A;  3HJ1 A;  4K4H A;  5BOM A;  1S0O A;  3RJK A;  7ICO A;  4FHY A;  3PW4 A;  4YXJ A;  3EPI A;  5L1K A;  4ECQ A;  3RAQ A;  2W9A A;  5J2H A;  2V4Q A;  4DFJ A;  1UEU A;  1XWL A;  4I27 A;  3GDX A;  5CR0 A;  1B43 A;  5D49 A;  5KFB A;  5F2V O;  5KFU A;  5J0Y A;  2MUT A;  3QZ7 A;  4ED2 A;  2ATL A;  3LWL A;  1DK3 A;  3AU2 A;  4ECT A;  3C18 A;  5HRD A;  1TKD A;  4KLS A;  4E80 A;  2BCV A;  1SL0 A;  2LYH A;  2F1I A;  1XSP A;  2BPF A;  1VFG A;  4WC2 A;  4ECZ A;  4QZE A;  4O3Q A;  8ICT A;  4B9U A;  1NK4 A;  4DS5 A;  4QWD A;  3ZDB A;  9ICS A;  4X4T A;  4I2G A;  4FBU A;  4KLF A;  2ZH7 A;  4O3P A;  5KG4 A;  1TFR A;  3TQ1 A;  3RB0 A;  1SL2 A;  1ZQA A;  2PBE A;  4C8K A;  3NTU A;  2RFF A;  3BQ0 A;  5DG8 A;  1ZQN A;  3V7L A;  3OGU A;  1ZQC A;  1JN3 A;  7ICJ A;  4PHA A;  5KT3 A;  2HVH A;  2ZUB A;  5KFC A;  5J0O A;  4B9T A;  4O5K A;  4RQ2 A;  3RH5 A;  8ICL A;  2DRB A;  3TI0 A;  3WFQ E;  3JPQ A;  3AUO A;  1WCN A;  1ZQU A;  3M8S A;  1ZQQ A;  1BVS A;  4C8L A;  2PXI A;  1ZQI A;  4ELV A;  4BXO A;  5CHG A;  5J0W A;  3PY8 A;  1MIV A;  3AQK A;  4DQR A;  3BDP A;  5DDM A;  3RRH A;  3TFR A;  3C21 A;  1RXW A;  1RYS A;  3PW0 A;  4NLN A;  1YLQ A;  3JPS A;  4I29 A;  4UB4 A;  4YMM A;  3MFH A;  4UAY A;  4F5O A;  4DQS A;  2M2T A;  2ZH3 A;  5KFJ A;  4F92 B;  4DO9 A;  2BKE A;  4O3R A;  5J0P A;  2KTQ A;  5HRH A;  4RWP A;  4WC6 A;  3KHH A;  4K4G A;  8ICJ A;  1ZQY A;  4TUQ A;  5J2J A;  1BNP A;  4S3N A;  1ARO P;  4RQ4 A;  1UET A;  5KT2 A;  1NKB A;  3H4D A;  2HHV A;  5J0X A;  1X9W A;  4ED3 A;  5J2A A;  1BNO A;  4PGX A;  2ZTD A;  5DQH A;  1TAQ A;  3ZDD A;  4EZ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...