5DEDA

Crystal structure of the small alarmone synthethase 1 from bacillus subtilis bound to its product pppgpp
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
198
structure length
196
Chain Sequence
DKQWERFLVPYRQAVEELKVKLKGIRTLYEYEDDHSPIEFVTGRVKPVASILEKARRKSIPLHEIETMQDIAGLRIMCQFVDDIQIVKEMLFARKDFTVVDQRDYIAEHKESGYRSYHLVVLYPLQTVSGEKHVLVEIQIRTLAMNFWATIEHSLNYKYSGNIPEKVKLRLQRASEAASRLDEEMSEIRGEVQEAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Catalytic mechanism and allosteric regulation of an oligomeric (p)ppGpp synthetase by an alarmone.
pubmed doi rcsb
source organism Bacillus subtilis py79
molecule tags Transferase
molecule keywords GTP pyrophosphokinase YjbM
total genus 62
structure length 196
sequence length 198
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.6.5: GTP diphosphokinase.
pdb deposition date 2015-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04607 RelA_SpoT Region found in RelA / SpoT proteins
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.860 Mainly Alpha Orthogonal Bundle Helix Hairpins Nucleotidyltransferase 5dedA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5dedA01
2BPGA 4I27A 3RJIA 5DEDA 5TZVA 1NO5A 5J0YA 9ICRA 1RPLA 4UB2A 4EBKA 1XSNA 4KLEA 5J2HA 4KLHA 4M9JA 4FHYA 4X4OA 5J2IA 4I2IA 3JZ0A 4X4QA 4RQ3A 5HRKA 5BOMA 8ICGA 4UB1A 3TFSA 4I2JA 4UAYA 2ZHAA 1KNYA 3MDCA 3V7JA 4Z6EA 1Q78A 4I2AA 4XQ7A 2DRAA 4NLKA 4WC4A 5J29A 3JPRA 1ZQSA 4WBZA 9ICJA 9ICOA 1PX5A 4RT2A 4NM2A 3PNCA 4I28A 1ZQWA 1XSPA 4I2CA 5IIMA 5HRDA 3HJ4A 8ICTA 2ZH9A 3HX0A 1VJ7A 2VANA 4YCXA 7ICGA 5F2VO 2M2WA 5D46A 4X4SA 4TUQA 2ID1A 9ICVA 4KLFA 7ICOA 5HRGA 8ICQA 3WFRE 2ISPA 4IQUA 4R64A 4P4MA 2P66A 4RT3A 8ICKA 4RQ1A 3MGHA 2ZHBA 3L9DA 2BPCA 3C18A 5HR9A 3K75D 1ZQHA 5J2GA 3ISBA 4NLZA 9ICLA 4XQ8A 4KLDA 1ZQTA 4Z6DA 5CWRA 4EP7A 5J2BA 9ICXA 9ICEA 3HWTA 2M2VA 5HRFA 5IIOA 1MIYA 4X4NA 4FHPA 1TV9A 4RWOA 4NM1A 1XSLA 3ISCA 7ICTA 3AQLA 2ISOA 4NKTA 4LZDA 3JPNA 3UQ0A 5IIIA 4WC1A 4LVSA 3MGIA 3WFQE 4RQ8A 2PFOA 3RJGA 4AT9B 4FH3A 5J0UA 4NKUA 4IQWA 4KLUA 4UAWA 1MIVA 2PBEA 5IINA 2M2TA 2O5AA 1ZQLA 8ICXA 2RFFA 3HIYA 5EOZA 8ICSA 4RWNA 4ATBA 1ZQKA 9ICIA 4PGXA 1Q79A 4WCWA 4F5NA 5HHHA 4PGQA 5BPCA 3WFOA 9ICKA 3RH6A 4M04A 4I2FA 2ZH2A 4K4GA 4M9HA 9ICWA 5J0XA 5HC9A 3C5GA 5DBCA 5HHIA 4RQ7A 5J0PA 4NXZA 5CP2A 4KLTA 1ZQBA 4YD1A 3OUYA 1ZQNA 1JN3A 3UXNA 4KLIA 4WC2A 3OVSA 4DO9A 4DOCA 7ICNA 4PPXA 8ICHA 3NYBA 4K4IA 8ICJA 4UBCA 8ICRA 8ICLA 3C2KA 4TURA 2ZH7A 4X5VA 2O1PA 4QZBA 8ICEA 4X4PA 4M47A 4QZFA 5CJ7A 1KDHA 3V7LA 5J2DA 1ZQEA 5J0WA 4IG8A 7ICLA 3AQKA 2HHPA 2FMPA 1R8AA 5J0SA 7ICEA 7ICRA 4LT6A 3RJHA 7ICUA 7ICIA 4MF8A 4FO6A 2FMSA 4WBYA 2ZH4A 3RJJA 1R89A 4FHWA 4GXIA 3C5FA 1ZQRA 3JPTA 3JPPA 5DBAA 3RJFA 4M9GA 4IQTA 4O5CA 8ICCA 3ISDA 1ZQGA 2BCSA 2W9MA 4AT8A 1ZQXA 4MF2A 1JAJA 4P4PA 9ICFA 5J0QA 7ICSA 4Z6CA 4F5OA 4UB4A 3UXOA 3JPSA 4F5QA 4WC5A 1ZQOA 4EBJA 3WFSC 4X4RA 4I2DA 1ZQZA 1RZTA 9ICSA 1ZQJA 4QZGA 4XUSA 9ICGA 3V7KA 5CB1A 5IILA 8ICUA 1ZQIA 3RH4A 3RJEA 1MQ2A 4DOAA 5J2CA 5IIKA 2DR5A 1TVAA 4RQ0A 5HRBA 1BPZA 8ICFA 4M9NA 1FA0A 5DB6A 5CHGA 2BE3A 1HUZA 9ICHA 9ICBA 4RWPA 4R65A 5D49A 3B0XA 5BOLA 3AU6A 1ZQFA 4KLSA 4NY8A 8ICAA 4F5RA 4RPZA 4YD2A 4WC3A 5J0OA 1TFWA 3C66A 3HJ1A 2ZH5A 3AU2A 4YN4A 3GDXA 2DVIA 4QZCA 5HRLA 4WC7A 3TFRA 4I2GA 1MQ3A 5J2AA 2Q66A 4R63A 1TFYA 3PMNA 4XRHA 4RQ4A 5J2JA 1ZQVA 3H39A 4RPYA 5DDMA 1UEVA 1JMSA 3C2LA 8ICYA 4MFFA 4AT7A 1UEUA 2DR7A 4NLNA 7ICVA 4YMOA 2GWSA 5DB8A 2ZH1A 4UD5A 2PXIA 2DRBA 8ICOA 4RQ5A 4M9LA 3OUYB 5CA7A 7ICJA 7ICQA 8ICMA 7ICMA 4QZAA 4Z6FA 1ZJNA 1ZJMA 3RH5A 4FHVA 4AT7B 4RPXA 3JPQA 9ICTA 4QZEA 4AT9A 4X0AA 4I29A 4DOBA 4WC6A 2ZH6A 4YMMA 4UBBA 5J0RA 4WC0A 4M0AA 9ICCA 2I9GA 3UQ2A 2PFPA 3AQMA 3JPOA 4RWQA 4RQ6A 4E8FA 4UB3A 3C2MA 9ICPA 4KLQA 5DB9A 3AUOA 8ICNA 5DB7A 1NOMA 7ICPA 3WFPA 4I2HA 7ICHA 3OV7A 4QZIA 4S3NA 5HREA 8ICPA 1UETA 4TUPA 4PHEA 5J2KA 9ICQA 4KLOA 9ICNA 4JWMA 3MDAA 4X4VA 5DKWA 4UD4A 4GXKA 3H3AA 2ZH3A 3H38A 2IHMA 1VFGA 5J0TA 4RQ2A 4PHPA 5J2FA 4JWNA 4MFCA 8ICBA 2BCQA 4I2BA 7ICFA 1ZQPA 4QZ8A 3RJKA 4PHAA 8ICIA 3V72A 1YLQA 2DR8A 2NRKA 3H37A 5HRIA 4TUSA 2ZH8A 1V4AA 5IIJA 1BPDA 1MIWA 5CR0A 8ICVA 1BPEA 8ICWA 2FMQA 4KLGA 1JQRA 1ZQDA 4FH5A 4QZHA 4P4OA 2M2UA 4PH5A 1ZQQA 3UPQA 4KLLA 2BCVA 4X0BA 1ZQUA 4UAZA 5J2EA 2PFNA 2BCRA 1ZQCA 1R8CA 4IQVA 1OU5A 2PFQA 3B0YA 1WOTA 5DECA 4LZGA 4FHXA 4MFAA 5DBBA 4M5DA 4K4HA 1F5AA 4F5PA 3AQNA 4E7XA 5HRHA 9ICUA 1BPYA 9ICAA 3OVBA 5DDYA 4X4TA 7ICKA 3OGUA 2BCUA 4KLJA 4O9MA 4QZ9A 4O5EA 1ZQAA 4O5KA 2DR9A 1ZQYA 4XA5A 4R66A 1HUOA 9ICMA 3HW8A 3LQCB 4GXJA 4KLMA 4ATBB 4E80A 2BPFA 4PHDA 4QZDA 5D4BA 3LK9A 1ZQMA 4M2YA 8ICZA 1R8BA 1KEJA 1BPXA 1BPBA 3OVAA 3JYYA 4AT8B 3UPSA 4YMNA 4I2EA 4PGYA 4X4UA 4P2HA 3MBYA 3UXPA 3PMLA 4UB5A
chains in the Genus database with same CATH superfamily
4D7SA 3OM3B 5DEDA 1PL4A 3L74H 1NTMH 2R70A 4B3RO 3F5WC 4KLEA 5J2HA 4KM5A 4KLHA 1S77D 5J2IA 2ETNA 4KHPO 5B1NA 1LR1A 2HHHO 4UB1A 4I2JA 2JJ1G 4YJ3A 1KP3A 4ZOLA 1S5HC 3QTCA 3T1HO 1QVFU 1Y76B 1M56C 2IBZH 1Q78A 3CCRV 4LNUB 2IU3A 4X65O 3JPRA 5CFSA 4WBZA 4RT2A 5IY5B 3B09A 2GDSA 2XASA 3OUSA 1ZQWA 4H44B 4I2CA 4B3TO 2MW2B 5IIMA 5HRDA 2IU0A 3K7DA 4MVUA 2MK3A 1PV0A 1JFFA 3CWBH 4PI0A 4OGQB 3CCSV 5CFUA 3K9AA 5LA6B 5F2VO 3ER9B 1X59A 2W6JG 3BY6A 2QKCA 5EZYA 1N33O 2LQTA 2GUZA 4NXNB 3E8BA 3ETQA 4LF6B 7ICOA 2ISPA 1XUQA 2P66A 1OCOC 3TGUH 2F43G 2ZIMA 4WF9V 4LH6A 2XAHA 2GA9D 5BXZA 3PN1A 3T2MA 2EZPA 1K92A 5IYBO 4JAUA 2H3OA 3K04A 2FL4A 2Z3YA 3DGEA 1BL8A 4X4NA 4MVOA 3P30A 4FMTA 3ISCA 4O4LB 2ISOA 4NKTA 5KHHA 2EWRA 3UQ0A 1FXKC 2AXTZ 1OCCC 4WC1A 2PFOA 2F66C 4FH3A 3S3WA 1TUBA 5GTHZ 5E1AC 2XT9A 1H2SB 8ICSA 4PA3A 2BTQB 2QM4A 2WLLB 2AZ2A 1O9GA 2M7WA 4F5NA 3SPIA 3RH6A 3ZMUA 2DWDC 1OCRC 4K4GA 4M9HA 1QQCA 5J0XA 4JI1O 4X88A 2BOCC 4BWAA 3JSNA 4K9BA 2UU9O 1VP7A 2H8PC 5LYJA 4NXZA 5IYZA 1IBLO 1L1FA 2ADPA 2YICA 4JAVA 1ZQNA 2LP7A 1Q86W 4PPXA 2JVDA 2QTOA 2QTSA 4RAIA 4H37A 3JD4A 1FKAO 8ICLA 3HB3B 3JATA 1ZTEA 4DR6O 4X4PA 1AR1B 4JI5O 4M47A 4EV6A 5CJ7A 4WCEV 3RYIA 3E83A 4QZFA 2B1IA 3HKCA 2Z0AA 4BIZA 3THOA 4IG8A 5J2UA 3CXCU 3AQKA 5J0SA 3RGBA 3LSQA 4DO2A 4JAAA 3K5OA 1AROP 2WLIB 4CC6A 3U10A 7ICUA 3OR6C 3X2QB 3K5MA 3RJJA 2DN9A 2AHYA 3F7YC 4DR4O 2Q0OC 4M9GA 2BOBC 3SYOA 3ZHVA 4AQYB 1ZQGA 5JTGA 4UCUA 2HKOA 1RP3B 3K3WA 4MF2A 4P4PA 2KSDA 4U7NA 3NWIA 4I4TB 2UXNA 1JJ2U 3AG2C 1G4YB 1ZWIC 3JPSA 2Q68A 2WLIA 3CRMA 4EBJA 1KU9A 3WFSC 1BT8A 1I7FA 4B7KA 1FFXA 4I2DA 2B4VA 1SQPH 1DF5A 3B40A 2W0XA 4I50A 1ZQZA 1J95A 3JALB 1RZTA 9ICSA 3L75H 3HKEB 1FXHA 1ZUQA 1IBKO 2DR5A 4UV9A 3JAWA 2JJ2G 3K0GA 4RO2A 2HLDG 1L0NH 3AG4C 5KMGA 3CRRA 9ICHA 9ICBA 4RWPA 5D49A 4U3FH 4QE7A 5BOLA 3CCEV 3WG7B 1FFXB 2N04A 2JK5C 4F5RA 1RFYA 2YIAA 1YXBA 4YHHO 4YN4A 3FB8C 1XL4A 2HEPA 3P3PA 4Z1VA 4JF3A 3TFRA 3TCUA 4I2GA 3AG4B 1WA8B 2OCCB 3RW0A 1JA8A 4B3MO 3ABLB 1S5LZ 4N23A 2CAZC 2C2AA 4RPYA 3RYCA 1BZKA 1UEVA 2GTAA 3ZN0A 2AGAA 5EBLC 4UB6Z 2XHBA 4ZI7B 1AILA 1JMSA 3TETA 2EIMC 3C2LA 4AT7A 3ZRWB 1QR9A 1YDXA 1B06A 2Q67A 4AQYO 7ICVA 2A06H 4TV8A 5DB8A 3E22B 4LEWA 1KMIZ 4LEZA 4E2LA 3K08A 4JGSA 2Y4UA 4ZIBA 5CA0B 3GVMA 2PXIA 3M99B 4WFAV 4DR1B 4DW0A 3O65A 7ICQA 4FFBB 5CA7A 4O2BB 2ZIOA 3CRQA 7ICMA 4FO1A 4QZAA 3RT3C 3OFNG 4LF9B 1E1RG 3LDEA 4JI8B 3RH5A 2FKXA 4JTCB 4JI3O 3C90A 1YCIA 5IYDO 5D62A 4AT7B 3JD0A 3WB0A 5IT9N 4TV8B 2IJHA 2EULA 4AT9A 2LGWA 1JCHA 3CK6A 4DR6B 1K33A 3UQ2A 4DUZO 1VQ6V 3AQMA 1K5SA 4RWQA 3QVNA 4E8FA 3UO3A 9ICPA 3FAVB 2ZCEA 5L3BA 4KLQA 3CC2V 3JARB 5LHHA 2F4VB 4JPRA 3OMIB 3CMAV 2DW4A 4AHCA 1P7GA 4JI6O 4PHEA 1OCZB 2CGOA 2Q73A 1V55C 1RSOA 3D36C 1VQLV 2OCCC 5DKWA 4IL6Z 1W0KG 1AI6A 4DK0A 3J81N 2OT5A 3FAVA 3SYCA 2BCCH 3E8FA 4I2BA 2A79B 7ICFA 3VOUA 3ASNC 1EN4A 3CCLV 4PHAA 2ZDIA 4MVQA 4JASA 2NRKA 3H37A 4CH4A 4DV4B 2WA4A 5EZYB 3MAQA 1KKDA 5IIJA 1BPDA 1MIWA 4GKJB 1H2KA 1BPEA 1YEWA 4KLGA 2W0FC 3ZMVA 4FZ1A 4FVMA 1ZQDA 4KLLA 3E35A 3UM7A 1AP6A 1ZQUA 3PHZA 1IVSA 3KKYA 2BCRA 1NI8A 1ZQCA 4L87A 1S72V 3CCJV 1IXMA 1N8RW 4UUJC 4LR3A 4IQVA 2PFQA 2ZE8A 1R6NA 3D36A 3D8CA 2X0LA 4LWSB 3J80N 4FLTA 3OAAG 3STZC 5LP6C 4MFAA 1BGYH 4M5DA 1PNKA 5IDJA 1SQGA 4K98A 3STLC 3ZMTA 3ZCCA 5HRHA 4LNUA 3I55V 4QPKA 1GK9A 3J7AU 3K03A 2NN4A 2D3OW 1K7DA 4CH5A 1Z2GA 5FPOA 1XNQO 4DV2O 4O5KA 4QGPA 1ZQAA 2QE7G 5B5EZ 5GTIZ 1JFFB 3SPJA 4PA7A 3IFXA 3HW8A 4GXJA 5JCOC 1MABG 4GKKB 4K3AA 4PHDA 4MSWC 4K0KO 4DV0B 4GX1A 4PHZA 1BSMA 3SGIA 2R9IA 1PPJH 3SJBC 4M2YA 4UCSA 4GX0A 4C7UA 2QA4V 3OVAA 3UT5B 3JYYA 1WNSA 3UPSA 2Q6AA 4PGYA 1Q82W 3PJSK 1N34B 1UPGA 4X4UA 1IXBA 5IJ0A 1GAXA 1SS3A 1U97A 4H33A 3PMLA 3FD9A 3EHBB 2QM7A 4FZ0A 4GKJO 5IJ9A 1XREA 5J0YA 3JSLA 1RPLA 3JCZA 4FHYA 3BA8A 1QBZA 1TVKA 5L3CA 4X4QA 5J2UB 4RQ3A 5B3QA 4DUZB 1VQKV 1IBKB 1XILA 2YXHA 3MDCA 3G6BA 3ABKB 1WP8A 2CK3G 4Z6EA 4I2AA 5A9GA 1KYOF 3N2KB 4WFBV 4UVBA 3N2GB 3D3QA 2CGNA 9ICJA 2LFRA 4NM2A 4LFCO 4I28A 4LFBO 1NR7A 1XSPA 3ABMC 2E75B 3UKMA 4NKGB 2KG7B 4O2AA 3E8GA 2V7QG 3UCSC 3HJ4A 4KLIA 3H1LH 3HX0A 3LUTB 1SQVH 4EB6B 4DV2B 2VANA 7ICGA 3DSQA 5IYZB 1SKVA 4BIUA 4OX9O 3LDCA 1B04A 3VQXA 5LGUA 3GWKC 9ICVA 4WH5A 2HHHB 1SC5B 3F7VC 4U7OA 4KLFA 5HRGA 8ICQA 2CTPA 1OV9A 2XTAA 4CH3A 2KB1A 1UFIA 4KXRA 4X1YB 3JATB 4RT3A 3CEIA 4X89A 4RQ1A 4LF5B 1JMKC 2GBOA 3CB2A 1M57B 2Q7EA 2ZHBA 3C18A 2BPCA 1SF9A 2X7RB 3HKEA 4K8ZA 3K75D 2QM8A 5C8YB 5J2GA 1ZQHA 2HJFC 1GO3F 1CPYA 2JEXA 2GTSA 1OCRB 9ICXA 1ZSPA 4DR5O 9ICEA 1R73A 3BVOA 2M2VA 2UXCB 1KB9F 2ARHA 3O9OA 4JI8O 5JVDB 1TV9A 1F4MA 1R6KA 1FYJA 4NM1A 4LZDA 2DQ3A 1YF2A 2HVJC 4MTOA 5IIIA 1IURA 1N33B 4LVSA 3WFQE 1YHQV 4RQ8A 3RJGA 1Y74B 3ZMZA 1EM1A 4MW8A 2PBEA 5IINA 2M2TA 2ZINA 8ICXA 3HIYA 5EOZA 2GHYA 4RWNA 4CZZA 4DW1A 1ZQKA 2EIJB 1HR0B 9ICIA 4RQEA 2X6BA 1I08A 3WFOA 2VRZA 3ZIAG 2F4VO 1G8MA 2Q9LA 2P06A 1R3KC 5HC9A 1N4CA 3C3TA 4J9YB 3E89A 4R8CA 1FAFA 5KX5B 4JLZA 4HX0A 5HFMA 1Y74A 3M8AA 2PY5A 1MZFA 4TWKA 5CP2A 3JAWB 1Z5VA 1YITV 4O2BA 2IH1C 1P49A 3ML0A 4DOCA 3RYFB 3R65A 4J7JA 4LBEC 3A0HZ 2F93B 4P2ZA 4TUYA 5EC2C 8ICJA 1XMQO 3H1HH 3SJQC 4TURA 2ZH7A 2O1PA 4X5VA 1NTZH 3K5LA 4RQFA 2OTJV 4CS2A 2YXYA 4EEDA 2FMPA 2IJJA 5JH7B 4AILC 4EGWA 1R3IC 3BFRA 4DV6O 2UXBO 3RJHA 3K5NA 7ICIA 4MF8A 4FO6A 2FYUH 1IBMB 1I0HA 4PI2A 4OAIZ 3RYCB 3C5FA 4G2KA 5DBAA 4YY3B 5KAIZ 2ODMA 1Q6UA 1GM7A 2BCSA 4AT8A 1K97A 1N32O 1GN3A 1DK1A 2EIKB 2PZSA 9ICFA 3E22A 2PTMA 3OGCC 7ICSA 2LW7A 4CC5A 3VQWA 2XNDG 3UXOA 4LFCB 4F5QA 4J42A 5C93A 1SA0A 3G80A 3OGIB 2RCVA 2PGGA 2E5LB 4OPAA 3JD1A 4O4IB 1ZQJA 1JJOA 4QZGA 1BS3A 3V7KA 2P5OA 2OIGA 4JI7B 4JYAB 2DQ0A 1ZQIA 3RH4A 3RJEA 3UO2A 4KFMA 5J2CA 5H5NA 3KZIZ 1XNRO 5HRBA 4RWUA 8ICFA 1Y76A 2JS3A 2YEVA 4X64O 4DV3O 5DB6A 4JV5B 4F6EA 2GAFD 4DV0O 4R65A 3DXRB 3ETGA 3AU6A 1ZQFA 4L8JA 2XAQA 4NY8A 3G71V 4RPZA 5J0OA 3C66A 1F7YA 2HJDA 4FLZA 1VIBA 4DR5B 2DVIA 5LMNO 4QZCA 5HRLA 3OT7A 1QLNA 4K0KB 4UXNA 2FB5A 3SYPA 1G6UA 1SESA 3ETEA 5LA6A 5J2AA 3ZN1A 2XUMA 1T5EA 2CE4A 3QO5A 1A32A 1NQTA 2OYQA 5CHEA 4XRHA 4RQ4A 2V4DA 5DDMA 3T4DA 3G6EV 1HW7A 1NVPD 3BABA 2ITDC 3RVZA 4NLNA 1KKCA 2GWSA 1XOUA 4B3TB 5EIBC 5LOVA 1NZ6A 1IDSA 3K59A 5JJJB 2CH7A 1DGSA 1BQ0A 1HR0O 1RPRA 3MHHC 8ICOA 4JYCA 4IYHA 4MTFA 5L3FA 8ICMA 1SQQH 2JS5A 3B8MA 4PDMA 4ABMA 2WPDG 3FYEB 3NR7A 1H2GA 4JI4O 4RPXA 4FM2A 1M90W 4IYIA 9ICTA 1NJIW 1PM9A 5LHIA 4J11A 5IJ0B 4O4JA 1YTFD 4DOBA 3G4SV 4YMMA 3E86A 1VARA 4DR3B 4FLWA 4UBBA 3MDSA 4R6ZA 1AJNA 4LWSA 3FB5C 2ZXWB 2VQFB 1JQ0A 4RQ6A 2QR4A 3QO7A 4UB3A 4WFGA 1SETA 4PA4A 1I5YA 3ZHTA 8ICNA 5DB7A 3WFPA 1VF6A 4OX9B 2CTQA 5KA6A 2EBOA 4FLVA 1OCZC 4Z1MG 4NXWA 4QZIA 3OV7A 5HREA 1UETA 3LSSA 5KUKA 1ROPA 4TUPA 5J2KA 4TSFG 3X2QC 1V54C 4PA9A 9ICQA 2FMLA 9ICNA 1K4CC 3HKDA 1N0JA 3OUFA 4KL1A 5KHIA 1NVPB 1GM8A 5CBFA 5LGTA 1THZA 1PNMA 3VQVA 4QNHB 5LBQA 4N7RA 3H3AA 2WLNA 5IYCO 3JD3A 4FIPC 4KUMA 4DR7O 1HNWO 3N27A 1H8EG 1VFGA 3IAYA 2BTOA 4FJCC 2VS0A 4JWNA 1ORQC 5ITZA 3UT5A 8ICIA 1YLQA 2E5LO 4YXWG 4TQDA 1P84F 1V4AA 3G67A 5B3PA 3JCFA 5CR0A 3HKDB 8ICWA 2FMQA 1XBLA 1S0VA 4X65B 4X1YA 1WPBA 5IJ9B 1JQRA 1JOYA 4FH5A 1ZQQA 4P4OA 4PH5A 1VQ9V 2GSMB 1NBMG 4DYLA 1W2BU 1TVKB 1N36B 5J2EA 2PFNA 5CA1B 1R8CA 3QNEA 4J9ZB 1OU5A 5B3SB 1KBHA 1WJZA 5K1XA 4O4HB 3APOA 1XMOO 5JVDA 1PP9H 2RQ6A 3H9VA 4K4HA 2D2CB 4HNAB 3BRCA 4E7XA 2EJ7A 3DC6A 3N2KA 2L35A 2B1GA 1NH2D 4O69A 2UXDB 1AI5A 4HYOA 3EF2A 2BCUA 2KG7A 5DN6G 4NXMO 4W4KA 1HNZB 4QZ9A 1Q6IA 1ZLZA 4GX5A 1QHTA 1ZQYA 4XA5A 4P30A 3K06A 1HUOA 9ICMA 2L6LA 5KHGA 2YUAA 2BPFA 3I5DA 3U0ZA 2DYSB 4QZDA 3KCYA 1YI2V 5CFTA 5BMVB 3LK9A 1M1KW 5LXTA 2OTLV 3SJCC 8ICZA 2A0LA 1GN4A 4PDVA 2CTRA 1TGOA 4GZRB 1Q8IA 2KQXA 2R72A 3SYAA 4OPHA 5H2FZ 5D63A 4YMNA 2IJKA 5C8YA 4X66B 5FNVA 5GW7A 5CA3A 3FYIB 4EKWA 3TXSA 3AEIA 4PDLA 1H38A 2V1DA 3JAKA 5TZVA 2PI5A 2ADQB 2WLHA 4K8XA 1FS0G 1XSNA 3T1YO 4P9PA 4X4OA 4I2IA 4JYAO 5IWAO 1M5IA 4G28B 4MVMA 5BOMA 8ICGA 4B08A 3TFSA 3HKBA 5KA5A 3S3XA 2LW1A 2UUCO 1KNYA 3CSXA 2XOKG 4MTGA 1E1QG 2WLKA 3V7JA 1QLEB 2VQEB 1K9MW 1GMGA 2DRAA 3CPWU 1XMOB 1H2NA 3JAKB 4WC4A 4UVCA 3CC7V 5J29A 1K4DC 1XNRB 1PX5A 1HNXO 5BR8O 4FM0A 1KQSU 4PJ0Z 4XDKA 1HP8A 3FX7A 4LF7B 1LUVA 5EBMC 3CCMV 8ICTA 2IHOA 2ZH9A 1Q3EA 1W0JG 1VJ7A 4YCXA 1M57C 2A3QA 2IW5A 2RNBA 4FPPA 3ABTA 1EBOA 2DJVA 4I0UA 4LP8A 3GWOA 3ZHSA 4H13B 1SA0B 5D46A 4X4SA 1GN6A 2WWWA 2ID1A 1VQNV 4WQKA 2Q7GA 4TUYB 5IE9A 3WFRE 3JARA 4F6RA 2WLMA 2BBJA 4P4MA 2LJ2A 3BA9A 8ICKA 5H9CA 5FLXN 1N0NA 2UUAO 2B56A 3ISBA 4X9QA 4NLZA 3CMEV 4XQ8A 2YEVB 3CC4V 4O68A 4EP7A 1RSOB 2X6CA 4UVAA 5B1AB 1M93A 5HRFA 2LGQA 1MIYA 1K34A 4FHPA 3OEEG 1WB7A 1FJGO 3OD4A 7ICTA 2RMKB 3IC7A 3P3NA 2UUBO 1YIJV 2BSKA 1VQ8V 3CCVV 1MSWD 4ZKIA 2PYLA 3MGIA 3M7MX 1WB8A 5DM6V 5J0UA 4NKUA 4IQWA 4GYCB 2XAJA 5LP6B 2WAMA 2UUCB 4JI4B 2Y48A 1URFA 1NR1A 3BPZA 4PA6A 5LHGA 4PGXA 1HNZO 3B77A 3EFFK 3HPLC 4XBFA 4DV7B 1XNQB 1Q79A 5BPCA 4PGQA 2IM9A 3ASOB 9ICKA 1Y67A 4M04A 4DR3O 9ICWA 4O4IA 4K9AA 3H1JH 5DBCA 1EZVH 1JR9A 3FB6C 4BAYA 3OEHG 1VEWA 1TA8A 4U3JB 4KLTA 3T1HB 1ZQBA 3R66A 4X8AA 1D2DA 5LP6A 3F5TA 3L73H 4J7KA 2DE0X 4EEQA 4LF4B 4DO9A 3IGAC 1AI7A 1QR8A 4R7CA 2WSSG 5L3EA 2NNUA 1NTKH 1TUEB 3NYBA 1PL0A 4IIJB 3DXRA 1NH2B 5CN0A 4QZBA 5EBWC 1BHBA 5J2DA 7ICLA 2HHPA 1R8AA 1EZJA 3AG3C 2A9HA 4RUEA 7ICEA 2DYSC 4LT6A 4BW5A 3BCCH 3IC9A 1SZXA 4DRXA 1KUQA 1HNWB 3ABMB 4ICGA 1CEZA 2ZH4A 3ZRSA 5IWAB 3ZX6A 3CRCA 5CBGA 1R89A 4FHWA 4GXIA 1Q5OA 2PI4A 3JPTA 3JPPA 2HP8A 4LF6O 4UCOA 5BZBA 3ZMSA 3ABKC 3L72H 4IIJA 1FJGB 3ISDA 2RDCA 5GONB 2W9MA 4MVRA 3CRAA 2HFEC 3JASB 1K5QA 3H01A 5J0QA 4X1KB 5LOVB 1FXKA 2CH7B 3RWRD 2YIBD 4UB4A 5B1BC 1HNXB 1J5EO 1VQ4V 4DRXB 2QKSA 5FL7G 4K8VA 4TQFA 2O57A 4PDRA 3B4SA 5H6RA 4X20A 2VWJA 3RYHA 3RN4A 2EILB 5CB1A 5IILA 1IX9A 4K99A 3FB7C 3EXAA 5GONA 4O6AA 8ICUA 5H6QA 3I56V 1MQ2A 4DOAA 2NR5A 3JASA 4JI6B 3SYQA 5IIKA 1TVAA 4O4JB 1BPZA 4M9NA 1FA0A 4I5SA 4I9QA 2N05A 1XDCA 2HN2A 1S76D 2ZR3A 5FPRA 3N2GA 1QU7A 3B0XA 2UUAB 3DTUB 2ZE5A 1OHHG 8ICAA 3ZRXA 4YD2A 4WC3A 3WU2Z 3HJ1A 2ZH5A 3W7TA 2HG5C 5CA1A 3GDXA 4DUYO 2F23A 4E4EA 1VQ5V 1MQ3A 3ZHUA 4GT1A 4R63A 1WP7A 3T1CA 4NXVA 3PMNA 5J2JA 3H39A 1EN5A 4IHJB 3ERCC 4HNAA 4O67A 1S3JA 2YXLA 8ICYA 4MFFA 1SZTA 4LC1A 4OAGA 4LF8O 3LNNA 2ZT9B 4Z2WA 2ZH1A 3AG7A 4UD5A 4EFBA 5LMUB 2DRBA 3DC5A 4DV7O 2YI8A 1FXVA 2QWOB 1R3JC 3OE7G 1FD9A 3ZRVA 3ICXA 4K35A 4M9LA 4XDLA 3OUYB 3KCXA 1E79G 3ZHQA 4Z6FA 4JI0B 1ZJNA 5LMNB 1ZJMA 3AG1C 4YJ2B 3QO8A 4YIOA 1EN6A 2K9PA 1GH6A 3JPQA 2VQEO 1NKDA 3BEHA 3ETDA 1DLBA 1QNMA 4LEVA 5J0RA 4BR6A 4PELA 9ICCA 4M0AA 2QWPB 1RM1B 2FTKA 4LFAO 3FFQA 2PFPA 3JPOA 4O4HA 3UQ8A 4WQLA 1GKFA 3C2MA 1NU1H 4DV6B 1HDJA 1ZL8B 2YIDA 3AUOA 7ICPA 3GB7C 4D6TH 1X4TA 7ICHA 4GUNA 2ITCC 3TXQA 1Y4MA 5D61A 8ICPA 5KX5A 1YJNV 3CXHF 4FLYA 4WBNA 4MVSA 2FCLA 3NVOA 2P90A 3RYFA 1S5JA 1SQXH 1U96A 4X4VA 4X62O 4UD4A 4DV1O 3WB2A 2QWQB 3SPHA 5BMVA 2IHMA 5J0TA 3W7WA 5LXTB 2ZQMA 3CCUV 4JI1B 1Q81W 4MFCA 3ABUA 3CJHA 5CB4B 2IJIA 3U11A 4FLUA 2P4KA 3V72A 1R3LC 1G1XB 2PUSA 4TUSA 1LNQA 2WA3A 1IBLB 4JLXA 3CP1A 4G27B 2JRIA 3IJ4A 3AG1B 4F6RB 2Q0AA 3RFRA 1MNGA 3Q4HB 2DWEC 4CS4A 4QZHA 4LCUC 2M2UA 1F4NA 1LUWA 1FPOA 2K1EA 4X0BA 4UAZA 3OW2U 2IH3C 3JAMN 1OCCB 5EC1C 2DYRB 3CJHB 2RN9A 1VF5B 4UCRA 5LYJB 4DR1O 5K1PA 1BE3H 4OAHA 4DR7B 1YZBA 3B0YA 1WOTA 5DECA 1ZAUA 1GRJA 1IBMO 4LFAB 2EIMB 4FHXA 4NXTA 5KAFZ 4F5PA 1MOFA 5TISZ 4YY3O 3W7SA 2EJRA 3ABLC 5DDYA 4X4TA 4KLJA 3OMNB 3RYIB 4O9MA 1WAZA 2DR9A 3BAAA 4B3RB 1PD3A 4UV8A 1Y66A 4KP4A 2EINC 4R66A 4NR1A 1OCOB 4JYBA 1R6TA 1I5XA 4W4LA 2UXCO 1N36O 3ZBHA 2F95B 4J10A 4RUFA 4UCTA 1GTOA 5EYPA 4BW9A 1R8BA 2CDYA 1M9NA 3ZHRA 4EFEA 2OCHA 3A0RA 3HR0A 1OJHA 4CBCA 1B3QA 4J7ZA 5J2TB 3SPGA 2Q7HA 4I4TA 2VWKA 4FK5C 2RJZA 1VF7A 4LH7A 3MBYA 3UXPA 4JI5B 4K96A 4UB5A 2HVKC 4X64B 4DV3B 1AI4A 4XJEA 1YVWA 4JI2O 2H94A 1AB3A 2BPGA 2P7TC 4I27A 3RJIA 1B6QA 3K9SA 1NO5A 9ICRA 4NVPA 4UB2A 2QJ1A 4I0XB 4EBKA 4M9JA 4I50B 4DR2B 3JZ0A 5HRKA 2VQFO 4OXSA 5CMUA 3CE2A 1Q90D 3W7UA 4UAYA 2EX3A 1TAEA 2Q5ZA 2ZHAA 4ZHQA 1QLEC 2QSAA 1NS1A 5D5QA 4DV4O 3TJTA 2X6AA 3OTFA 5KUMA 5KMGB 4XQ7A 4JZGA 2Y0PA 1US6A 4XDJA 4NLKA 1ZQSA 9ICOA 3PNCA 4UFZA 2NLJC 1AJPA 1IZ3A 2ZKOA 4I55A 1WLEA 4J80A 5BY1A 3JYCA 1VQMV 1XEQA 4B3SB 4DV1B 2UXBB 1FFTB 1H8HG 1SQFA 1CP9A 1WPXA 2EINB 4J41A 4U3JA 1Q7YW 3W7XA 2M2WA 2IUBA 1VQOV 2HN1A 3OR7C 4TUQA 2OIEA 1VMGA 1WN7A 2ZDIC 1BHAA 4DUYB 3JD2A 4IQUA 4R64A 4IT5A 5E79Z 3LNMB 1MG1A 1VF6C 5IY5C 4NTWA 2Y4TA 3LSUA 3ZRWA 1N32B 1O9HA 2JDIG 2ATKC 3ZS8C 3MGHA 3L9DA 5HR9A 4TT3G 3A2FA 4FM1A 2Q69A 4K97A 9ICLA 2Z5UA 4NXUA 4KLDA 1ZQTA 2Q8VA 4Z6DA 1F23A 5CWRA 2A7WA 4YHHB 5J2BA 2OWOA 3OTOB 2AZ0A 3HWTA 4FFBA 2Y0IA 2R9AA 4JI0O 2UU9B 5IIOA 3OMAB 3NXSA 4MS2A 4RWOA 1ENVA 1XSLA 3AQLA 4JI7O 3AK2A 3JPNA 2PYJA 5ITZB 4AT9B 4X1KA 1FXKB 4I9WA 4KLUA 4DK1A 4UAWA 1MIVA 4JV5O 4OAFA 3E8HA 3ER8C 2O5AA 1ZQLA 2RFFA 3L70H 4ATBA 4IGGA 2YC0A 4WCWA 5HHHA 1V9PA 4D7TA 5B1AC 4I7ZB 4UCVA 3CYOA 3K0DA 4I2FA 2ZH2A 4X20B 5JWPA 1BMFG 3VBBA 3RYHB 3ASNB 4X1IB 3C5GA 5HHIA 3B8NA 4PD4F 4MKPA 4RQ7A 5J0PA 1KECA 3A0BZ 1VQPV 2ILMA 4JTAB 4JI3B 4YD1A 3OUYA 4NB5A 1JN3A 3UXNA 4WC2A 3OVSA 7ICNA 8ICHA 1SERA 4K4IA 4WFFA 4UBCA 8ICRA 4YJ2A 4ASUG 3OWGA 2QEXV 3C2KA 1BCCH 1COWG 3MHSC 8ICEA 5JQGB 4UB8Z 4HBNA 1KDHA 1H2MA 3V7LA 1ZQEA 5J0WA 2E3CA 3P32A 4DV5B 4AI8A 5AG2A 1D5AA 7ICRA 2ZE7A 1EFRG 1Q43A 3CCQV 5LGNA 4ZOLB 3B2EE 1Z5WA 1V55B 3QG5A 2FMSA 4ZBMA 4WBYA 1DTOA 2AW9A 4GCZA 1ZQRA 3K57A 1MSDA 3RJFA 1VQ7V 4IQTA 4O5CA 3CHXA 8ICCA 2W6IG 2ZR2A 4MVZA 4Q20A 3SPCA 5JQGA 1K8AW 1RPOA 1ZQXA 3CX5F 4LF5O 1JAJA 2Y69B 1QVGU 4NXMB 2DYRC 1YJWV 4Z6CA 4F5OA 2GV9A 2YIBA 5FNVB 4B7EA 2M6YA 5BR8B 3QF7A 4WC5A 1RM1C 4GKKO 3VQYA 2XAGA 1ZQOA 2WLLA 1R1BA 4X4RA 2GUZB 4B3SO 5HFLA 3K58A 3T4ZA 4XUSA 9ICGA 3AG2B 1K3EA 2ZNJA 1F51A 5CB4A 3HKBB 2AHZA 1MZEA 3RBZA 4QE9A 4RQ0A 3AK1A 3EVKA 1GPJA 4X66O 1V54B 4QIWF 5CHGA 2BE3A 5JCOA 1HUZA 4DXWA 1AP5A 4H0LB 4WFHA 5B66Z 4KLSA 2R9RB 4JTDB 3SR2C 1ZL8A 1TFWA 1P7BA 3HKCB 2YS8A 4QPJA 1M4UA 4O4LA 1K73W 3AU2A 5CBHA 3OTOO 2Q4PA 4LF9O 4NXNO 4WC7A 3E2EA 1TUBB 2Q66A 1TFYA 4WBNB 1AVMA 2ZE6A 1ZQVA 3WG7C 1ZX3A 3C3SA 2PF4E 1YSCA 1XHXA 2BTQA 1JX9A 1XMQB 2BBHA 4LFBB 2ZXWC 4DR2O 1UEUA 2DR7A 4YMOA 2QWNB 5B3SC 2LFSA 4JI2B 1Q6HA 1KC8W 3BHPA 5EIBD 4RQ5A 5L3DA 2KKWA 7ICJA 2QWRB 2B9ZA 4HZ3A 1MMMA 3JALA 2B51A 2P22C 4YIPA 2ZM6B 1XL6A 3APQA 4FHVA 3Q4HA 5B1BB 2ZNIA 2BSKB 2YSUB 4MT8A 2DMXA 4FLXA 2UXDO 1YJ9V 1I94B 4QZEA 5J2TA 3CS5A 4O2AB 4X0AA 4I29A 3MCRA 4WC6A 2EIKC 2ZH6A 3CD6V 4Q6GA 4EB6A 4N21A 3WFVA 4WC0A 4KHPB 5B1OA 2I9GA 1AJQA 2YI9A 4GX2A 4LF8B 4TV9A 3RVYA 2UXXA 2P67A 2CUGA 2QKAA 3FKSG 3A8TA 4NTYA 3SDLA 5DB9A 3D3IA 1NOMA 1DF4A 4I2HA 2P6JA 2UUBB 4PV1B 4CS3A 1AR4A 1P4RA 3AG3B 4S3NA 4BIOA 4ZHQB 1SQBH 2JIZG 3LDDA 4TOIA 3AK3A 4KLOA 1L8DA 4JWMA 3MDAA 2B5UA 3JCUZ 4ZI7A 5L3GA 4TV9B 4GXKA 2EZOA 2ZH3A 2G38A 2JGDB 3T1YB 3H38A 1BQZA 4NYKA 3NKUA 4RQ2A 1JPXA 3ASOC 4PHPA 1NT2B 5EYPB 5J2FA 4HAMA 3K79A 1XI1A 8ICBA 2BCQA 1GN2A 2QDOA 4DR4B 5JJEB 1ZQPA 4QZ8A 3RJKA 2DR8A 5HRIA 2ZH8A 2ZD9A 1PKXA 4NTXA 1CXZB 4LF4O 2JEUA 8ICVA 2N74A 2Y69C 5D5PA 1XQ8A 1M56B 5J9PC 2ZM6O 5KHJA 3UPQA 1Y6XA 2JGDA 4I0XA 2EILC 2BCVA 4LF7O 4WFEA 3MD0A 1GM9A 1I94O 2CTWA 1L0LH 4X62B 3ZJZA 4CH6A 5KLVH 5EK0A 4P9OA 1H2LA 1WA8A 4LZGA 2DOSA 4KB6A 2LO1A 5DBBA 1N34O 1F5AA 4A5UB 1KD1W 3AQNA 2E76B 2E74B 9ICUA 1BPYA 9ICAA 1UJWB 3OVBA 3H1KH 7ICKA 1XHZA 4LEYA 3OGUA 5JJNB 1D5NA 3SJAC 4EEBA 2JGUA 4I55B 2YDEA 4O5EA 5JH7A 4MW3A 1AR5A 1QCEA 5CA0A 2F1MA 4F4LA 1MA1A 3WB1A 2P4VA 5LL6Y 1J5EB 3LQCB 4KLMA 3H1IH 4ATBB 1W59A 4E80A 4QJFB 1OZ0A 1KP2A 1PNLA 4WOYA 3KG2A 4DV5O 2HR3A 5D4BA 4R50A 4JYYA 5LMUO 1ZQMA 1JVMA 4B3MB 1SRYA 2QGNA 4GLXA 4X1IA 2XAFA 1HWYA 1BPBA 1KEJA 1BPXA 4AT8B 2EIJC 4YJ3B 4I2EA 3ZEDA 4FFKA 3TK1A 3L71H 5A2QN 4JZ2A 1YTFB 4P2HA 4MTXA 4NXXA 2WLJA 4IHJA 5KHKA
chains in the Genus database with same CATH topology
2BPGA 4I27A 3RJIA 5DEDA 5TZVA 1NO5A 5J0YA 9ICRA 1RPLA 4UB2A 4EBKA 1XSNA 4KLEA 5J2HA 4KLHA 4M9JA 4FHYA 4X4OA 5J2IA 4I2IA 3JZ0A 4X4QA 4RQ3A 5HRKA 5BOMA 8ICGA 4UB1A 3TFSA 4I2JA 4UAYA 2ZHAA 1KNYA 3MDCA 3V7JA 4Z6EA 1Q78A 4I2AA 4XQ7A 2DRAA 4NLKA 4WC4A 5J29A 3JPRA 1ZQSA 4WBZA 9ICJA 9ICOA 1PX5A 4RT2A 4NM2A 3PNCA 4I28A 1ZQWA 1XSPA 4I2CA 5IIMA 5HRDA 3HJ4A 8ICTA 2ZH9A 3HX0A 1VJ7A 2VANA 4YCXA 7ICGA 5F2VO 2M2WA 5D46A 4X4SA 4TUQA 2ID1A 9ICVA 4KLFA 7ICOA 5HRGA 8ICQA 3WFRE 2ISPA 4IQUA 4R64A 4P4MA 2P66A 4RT3A 8ICKA 4RQ1A 3MGHA 2ZHBA 3L9DA 2BPCA 3C18A 5HR9A 3K75D 1ZQHA 5J2GA 3ISBA 4NLZA 9ICLA 4XQ8A 4KLDA 1ZQTA 4Z6DA 5CWRA 4EP7A 5J2BA 9ICXA 9ICEA 3HWTA 2M2VA 5HRFA 5IIOA 1MIYA 4X4NA 4FHPA 1TV9A 4RWOA 4NM1A 1XSLA 3ISCA 7ICTA 3AQLA 2ISOA 4NKTA 4LZDA 3JPNA 3UQ0A 5IIIA 4WC1A 4LVSA 3MGIA 3WFQE 4RQ8A 2PFOA 3RJGA 4AT9B 4FH3A 5J0UA 4NKUA 4IQWA 4KLUA 4UAWA 1MIVA 2PBEA 5IINA 2M2TA 2O5AA 1ZQLA 8ICXA 2RFFA 3HIYA 5EOZA 8ICSA 4RWNA 4ATBA 1ZQKA 9ICIA 4PGXA 1Q79A 4WCWA 4F5NA 5HHHA 4PGQA 5BPCA 3WFOA 9ICKA 3RH6A 4M04A 4I2FA 2ZH2A 4K4GA 4M9HA 9ICWA 5J0XA 5HC9A 3C5GA 5DBCA 5HHIA 4RQ7A 5J0PA 4NXZA 5CP2A 4KLTA 1ZQBA 4YD1A 3OUYA 1ZQNA 1JN3A 3UXNA 4KLIA 4WC2A 3OVSA 4DO9A 4DOCA 7ICNA 4PPXA 8ICHA 3NYBA 4K4IA 8ICJA 4UBCA 8ICRA 8ICLA 3C2KA 4TURA 2ZH7A 4X5VA 2O1PA 4QZBA 8ICEA 4X4PA 4M47A 4QZFA 5CJ7A 1KDHA 3V7LA 5J2DA 1ZQEA 5J0WA 4IG8A 7ICLA 3AQKA 2HHPA 2FMPA 1R8AA 5J0SA 7ICEA 7ICRA 4LT6A 3RJHA 7ICUA 7ICIA 4MF8A 4FO6A 2FMSA 4WBYA 2ZH4A 3RJJA 1R89A 4FHWA 4GXIA 3C5FA 1ZQRA 3JPTA 3JPPA 5DBAA 3RJFA 4M9GA 4IQTA 4O5CA 8ICCA 3ISDA 1ZQGA 2BCSA 2W9MA 4AT8A 1ZQXA 4MF2A 1JAJA 4P4PA 9ICFA 5J0QA 7ICSA 4Z6CA 4F5OA 4UB4A 3UXOA 3JPSA 4F5QA 4WC5A 1ZQOA 4EBJA 3WFSC 4X4RA 4I2DA 1ZQZA 1RZTA 9ICSA 1ZQJA 4QZGA 4XUSA 9ICGA 3V7KA 5CB1A 5IILA 8ICUA 1ZQIA 3RH4A 3RJEA 1MQ2A 4DOAA 5J2CA 5IIKA 2DR5A 1TVAA 4RQ0A 5HRBA 1BPZA 8ICFA 4M9NA 1FA0A 5DB6A 5CHGA 2BE3A 1HUZA 9ICHA 9ICBA 4RWPA 4R65A 5D49A 3B0XA 5BOLA 3AU6A 1ZQFA 4KLSA 4NY8A 8ICAA 4F5RA 4RPZA 4YD2A 4WC3A 5J0OA 1TFWA 3C66A 3HJ1A 2ZH5A 3AU2A 4YN4A 3GDXA 2DVIA 4QZCA 5HRLA 4WC7A 3TFRA 4I2GA 1MQ3A 5J2AA 2Q66A 4R63A 1TFYA 3PMNA 4XRHA 4RQ4A 5J2JA 1ZQVA 3H39A 4RPYA 5DDMA 1UEVA 1JMSA 3C2LA 8ICYA 4MFFA 4AT7A 1UEUA 2DR7A 4NLNA 7ICVA 4YMOA 2GWSA 5DB8A 2ZH1A 4UD5A 2PXIA 2DRBA 8ICOA 4RQ5A 4M9LA 3OUYB 5CA7A 7ICJA 7ICQA 8ICMA 7ICMA 4QZAA 4Z6FA 1ZJNA 1ZJMA 3RH5A 4FHVA 4AT7B 4RPXA 3JPQA 9ICTA 4QZEA 4AT9A 4X0AA 4I29A 4DOBA 4WC6A 2ZH6A 4YMMA 4UBBA 5J0RA 4WC0A 4M0AA 9ICCA 2I9GA 3UQ2A 2PFPA 3AQMA 3JPOA 4RWQA 4RQ6A 4E8FA 4UB3A 3C2MA 9ICPA 4KLQA 5DB9A 3AUOA 8ICNA 5DB7A 1NOMA 7ICPA 3WFPA 4I2HA 7ICHA 3OV7A 4QZIA 4S3NA 5HREA 8ICPA 1UETA 4TUPA 4PHEA 5J2KA 9ICQA 4KLOA 9ICNA 4JWMA 3MDAA 4X4VA 5DKWA 4UD4A 4GXKA 3H3AA 2ZH3A 3H38A 2IHMA 1VFGA 5J0TA 4RQ2A 4PHPA 5J2FA 4JWNA 4MFCA 8ICBA 2BCQA 4I2BA 7ICFA 1ZQPA 4QZ8A 3RJKA 4PHAA 8ICIA 3V72A 1YLQA 2DR8A 2NRKA 3H37A 5HRIA 4TUSA 2ZH8A 1V4AA 5IIJA 1BPDA 1MIWA 5CR0A 8ICVA 1BPEA 8ICWA 2FMQA 4KLGA 1JQRA 1ZQDA 4FH5A 4QZHA 4P4OA 2M2UA 4PH5A 1ZQQA 3UPQA 4KLLA 2BCVA 4X0BA 1ZQUA 4UAZA 5J2EA 2PFNA 2BCRA 1ZQCA 1R8CA 4IQVA 1OU5A 2PFQA 3B0YA 1WOTA 5DECA 4LZGA 4FHXA 4MFAA 5DBBA 4M5DA 4K4HA 1F5AA 4F5PA 3AQNA 4E7XA 5HRHA 9ICUA 1BPYA 9ICAA 3OVBA 5DDYA 4X4TA 7ICKA 3OGUA 2BCUA 4KLJA 4O9MA 4QZ9A 4O5EA 1ZQAA 4O5KA 2DR9A 1ZQYA 4XA5A 4R66A 1HUOA 9ICMA 3HW8A 3LQCB 4GXJA 4KLMA 4ATBB 4E80A 2BPFA 4PHDA 4QZDA 5D4BA 3LK9A 1ZQMA 4M2YA 8ICZA 1R8BA 1KEJA 1BPXA 1BPBA 3OVAA 3JYYA 4AT8B 3UPSA 4YMNA 4I2EA 4PGYA 4X4UA 4P2HA 3MBYA 3UXPA 3PMLA 4UB5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BPG A;  4I27 A;  3RJI A;  5DED A;  5TZV A;  1NO5 A;  5J0Y A;  9ICR A;  1RPL A;  4UB2 A;  4EBK A;  1XSN A;  4KLE A;  5J2H A;  4KLH A;  4M9J A;  4FHY A;  4X4O A;  5J2I A;  4I2I A;  3JZ0 A;  4X4Q A;  4RQ3 A;  5HRK A;  5BOM A;  8ICG A;  4UB1 A;  3TFS A;  4I2J A;  4UAY A;  2ZHA A;  1KNY A;  3MDC A;  3V7J A;  4Z6E A;  1Q78 A;  4I2A A;  4XQ7 A;  2DRA A;  4NLK A;  4WC4 A;  5J29 A;  3JPR A;  1ZQS A;  4WBZ A;  9ICJ A;  9ICO A;  1PX5 A;  4RT2 A;  4NM2 A;  3PNC A;  4I28 A;  1ZQW A;  1XSP A;  4I2C A;  5IIM A;  5HRD A;  3HJ4 A;  8ICT A;  2ZH9 A;  3HX0 A;  1VJ7 A;  2VAN A;  4YCX A;  7ICG A;  5F2V O;  2M2W A;  5D46 A;  4X4S A;  4TUQ A;  2ID1 A;  9ICV A;  4KLF A;  7ICO A;  5HRG A;  8ICQ A;  3WFR E;  2ISP A;  4IQU A;  4R64 A;  4P4M A;  2P66 A;  4RT3 A;  8ICK A;  4RQ1 A;  3MGH A;  2ZHB A;  3L9D A;  2BPC A;  3C18 A;  5HR9 A;  3K75 D;  1ZQH A;  5J2G A;  3ISB A;  4NLZ A;  9ICL A;  4XQ8 A;  4KLD A;  1ZQT A;  4Z6D A;  5CWR A;  4EP7 A;  5J2B A;  9ICX A;  9ICE A;  3HWT A;  2M2V A;  5HRF A;  5IIO A;  1MIY A;  4X4N A;  4FHP A;  1TV9 A;  4RWO A;  4NM1 A;  1XSL A;  3ISC A;  7ICT A;  3AQL A;  2ISO A;  4NKT A;  4LZD A;  3JPN A;  3UQ0 A;  5III A;  4WC1 A;  4LVS A;  3MGI A;  3WFQ E;  4RQ8 A;  2PFO A;  3RJG A;  4AT9 B;  4FH3 A;  5J0U A;  4NKU A;  4IQW A;  4KLU A;  4UAW A;  1MIV A;  2PBE A;  5IIN A;  2M2T A;  2O5A A;  1ZQL A;  8ICX A;  2RFF A;  3HIY A;  5EOZ A;  8ICS A;  4RWN A;  4ATB A;  1ZQK A;  9ICI A;  4PGX A;  1Q79 A;  4WCW A;  4F5N A;  5HHH A;  4PGQ A;  5BPC A;  3WFO A;  9ICK A;  3RH6 A;  4M04 A;  4I2F A;  2ZH2 A;  4K4G A;  4M9H A;  9ICW A;  5J0X A;  5HC9 A;  3C5G A;  5DBC A;  5HHI A;  4RQ7 A;  5J0P A;  4NXZ A;  5CP2 A;  4KLT A;  1ZQB A;  4YD1 A;  3OUY A;  1ZQN A;  1JN3 A;  3UXN A;  4KLI A;  4WC2 A;  3OVS A;  4DO9 A;  4DOC A;  7ICN A;  4PPX A;  8ICH A;  3NYB A;  4K4I A;  8ICJ A;  4UBC A;  8ICR A;  8ICL A;  3C2K A;  4TUR A;  2ZH7 A;  4X5V A;  2O1P A;  4QZB A;  8ICE A;  4X4P A;  4M47 A;  4QZF A;  5CJ7 A;  1KDH A;  3V7L A;  5J2D A;  1ZQE A;  5J0W A;  4IG8 A;  7ICL A;  3AQK A;  2HHP A;  2FMP A;  1R8A A;  5J0S A;  7ICE A;  7ICR A;  4LT6 A;  3RJH A;  7ICU A;  7ICI A;  4MF8 A;  4FO6 A;  2FMS A;  4WBY A;  2ZH4 A;  3RJJ A;  1R89 A;  4FHW A;  4GXI A;  3C5F A;  1ZQR A;  3JPT A;  3JPP A;  5DBA A;  3RJF A;  4M9G A;  4IQT A;  4O5C A;  8ICC A;  3ISD A;  1ZQG A;  2BCS A;  2W9M A;  4AT8 A;  1ZQX A;  4MF2 A;  1JAJ A;  4P4P A;  9ICF A;  5J0Q A;  7ICS A;  4Z6C A;  4F5O A;  4UB4 A;  3UXO A;  3JPS A;  4F5Q A;  4WC5 A;  1ZQO A;  4EBJ A;  3WFS C;  4X4R A;  4I2D A;  1ZQZ A;  1RZT A;  9ICS A;  1ZQJ A;  4QZG A;  4XUS A;  9ICG A;  3V7K A;  5CB1 A;  5IIL A;  8ICU A;  1ZQI A;  3RH4 A;  3RJE A;  1MQ2 A;  4DOA A;  5J2C A;  5IIK A;  2DR5 A;  1TVA A;  4RQ0 A;  5HRB A;  1BPZ A;  8ICF A;  4M9N A;  1FA0 A;  5DB6 A;  5CHG A;  2BE3 A;  1HUZ A;  9ICH A;  9ICB A;  4RWP A;  4R65 A;  5D49 A;  3B0X A;  5BOL A;  3AU6 A;  1ZQF A;  4KLS A;  4NY8 A;  8ICA A;  4F5R A;  4RPZ A;  4YD2 A;  4WC3 A;  5J0O A;  1TFW A;  3C66 A;  3HJ1 A;  2ZH5 A;  3AU2 A;  4YN4 A;  3GDX A;  2DVI A;  4QZC A;  5HRL A;  4WC7 A;  3TFR A;  4I2G A;  1MQ3 A;  5J2A A;  2Q66 A;  4R63 A;  1TFY A;  3PMN A;  4XRH A;  4RQ4 A;  5J2J A;  1ZQV A;  3H39 A;  4RPY A;  5DDM A;  1UEV A;  1JMS A;  3C2L A;  8ICY A;  4MFF A;  4AT7 A;  1UEU A;  2DR7 A;  4NLN A;  7ICV A;  4YMO A;  2GWS A;  5DB8 A;  2ZH1 A;  4UD5 A;  2PXI A;  2DRB A;  8ICO A;  4RQ5 A;  4M9L A;  3OUY B;  5CA7 A;  7ICJ A;  7ICQ A;  8ICM A;  7ICM A;  4QZA A;  4Z6F A;  1ZJN A;  1ZJM A;  3RH5 A;  4FHV A;  4AT7 B;  4RPX A;  3JPQ A;  9ICT A;  4QZE A;  4AT9 A;  4X0A A;  4I29 A;  4DOB A;  4WC6 A;  2ZH6 A;  4YMM A;  4UBB A;  5J0R A;  4WC0 A;  4M0A A;  9ICC A;  2I9G A;  3UQ2 A;  2PFP A;  3AQM A;  3JPO A;  4RWQ A;  4RQ6 A;  4E8F A;  4UB3 A;  3C2M A;  9ICP A;  4KLQ A;  5DB9 A;  3AUO A;  8ICN A;  5DB7 A;  1NOM A;  7ICP A;  3WFP A;  4I2H A;  7ICH A;  3OV7 A;  4QZI A;  4S3N A;  5HRE A;  8ICP A;  1UET A;  4TUP A;  4PHE A;  5J2K A;  9ICQ A;  4KLO A;  9ICN A;  4JWM A;  3MDA A;  4X4V A;  5DKW A;  4UD4 A;  4GXK A;  3H3A A;  2ZH3 A;  3H38 A;  2IHM A;  1VFG A;  5J0T A;  4RQ2 A;  4PHP A;  5J2F A;  4JWN A;  4MFC A;  8ICB A;  2BCQ A;  4I2B A;  7ICF A;  1ZQP A;  4QZ8 A;  3RJK A;  4PHA A;  8ICI A;  3V72 A;  1YLQ A;  2DR8 A;  2NRK A;  3H37 A;  5HRI A;  4TUS A;  2ZH8 A;  1V4A A;  5IIJ A;  1BPD A;  1MIW A;  5CR0 A;  8ICV A;  1BPE A;  8ICW A;  2FMQ A;  4KLG A;  1JQR A;  1ZQD A;  4FH5 A;  4QZH A;  4P4O A;  2M2U A;  4PH5 A;  1ZQQ A;  3UPQ A;  4KLL A;  2BCV A;  4X0B A;  1ZQU A;  4UAZ A;  5J2E A;  2PFN A;  2BCR A;  1ZQC A;  1R8C A;  4IQV A;  1OU5 A;  2PFQ A;  3B0Y A;  1WOT A;  5DEC A;  4LZG A;  4FHX A;  4MFA A;  5DBB A;  4M5D A;  4K4H A;  1F5A A;  4F5P A;  3AQN A;  4E7X A;  5HRH A;  9ICU A;  1BPY A;  9ICA A;  3OVB A;  5DDY A;  4X4T A;  7ICK A;  3OGU A;  2BCU A;  4KLJ A;  4O9M A;  4QZ9 A;  4O5E A;  1ZQA A;  4O5K A;  2DR9 A;  1ZQY A;  4XA5 A;  4R66 A;  1HUO A;  9ICM A;  3HW8 A;  3LQC B;  4GXJ A;  4KLM A;  4ATB B;  4E80 A;  2BPF A;  4PHD A;  4QZD A;  5D4B A;  3LK9 A;  1ZQM A;  4M2Y A;  8ICZ A;  1R8B A;  1KEJ A;  1BPX A;  1BPB A;  3OVA A;  3JYY A;  4AT8 B;  3UPS A;  4YMN A;  4I2E A;  4PGY A;  4X4U A;  4P2H A;  3MBY A;  3UXP A;  3PML A;  4UB5 A; 
#chains in the Genus database with same CATH topology
 4D7S A;  3OM3 B;  5DED A;  1PL4 A;  3L74 H;  1NTM H;  2R70 A;  4B3R O;  3F5W C;  4KLE A;  5J2H A;  4KM5 A;  4KLH A;  1S77 D;  5J2I A;  2ETN A;  4KHP O;  5B1N A;  1LR1 A;  2HHH O;  4UB1 A;  4I2J A;  2JJ1 G;  4YJ3 A;  1KP3 A;  4ZOL A;  1S5H C;  3QTC A;  3T1H O;  1QVF U;  1Y76 B;  1M56 C;  2IBZ H;  1Q78 A;  3CCR V;  4LNU B;  2IU3 A;  4X65 O;  3JPR A;  5CFS A;  4WBZ A;  4RT2 A;  5IY5 B;  3B09 A;  2GDS A;  2XAS A;  3OUS A;  1ZQW A;  4H44 B;  4I2C A;  4B3T O;  2MW2 B;  5IIM A;  5HRD A;  2IU0 A;  3K7D A;  4MVU A;  2MK3 A;  1PV0 A;  1JFF A;  3CWB H;  4PI0 A;  4OGQ B;  3CCS V;  5CFU A;  3K9A A;  5LA6 B;  5F2V O;  3ER9 B;  1X59 A;  2W6J G;  3BY6 A;  2QKC A;  5EZY A;  1N33 O;  2LQT A;  2GUZ A;  4NXN B;  3E8B A;  3ETQ A;  4LF6 B;  7ICO A;  2ISP A;  1XUQ A;  2P66 A;  1OCO C;  3TGU H;  2F43 G;  2ZIM A;  4WF9 V;  4LH6 A;  2XAH A;  2GA9 D;  5BXZ A;  3PN1 A;  3T2M A;  2EZP A;  1K92 A;  5IYB O;  4JAU A;  2H3O A;  3K04 A;  2FL4 A;  2Z3Y A;  3DGE A;  1BL8 A;  4X4N A;  4MVO A;  3P30 A;  4FMT A;  3ISC A;  4O4L B;  2ISO A;  4NKT A;  5KHH A;  2EWR A;  3UQ0 A;  1FXK C;  2AXT Z;  1OCC C;  4WC1 A;  2PFO A;  2F66 C;  4FH3 A;  3S3W A;  1TUB A;  5GTH Z;  5E1A C;  2XT9 A;  1H2S B;  8ICS A;  4PA3 A;  2BTQ B;  2QM4 A;  2WLL B;  2AZ2 A;  1O9G A;  2M7W A;  4F5N A;  3SPI A;  3RH6 A;  3ZMU A;  2DWD C;  1OCR C;  4K4G A;  4M9H A;  1QQC A;  5J0X A;  4JI1 O;  4X88 A;  2BOC C;  4BWA A;  3JSN A;  4K9B A;  2UU9 O;  1VP7 A;  2H8P C;  5LYJ A;  4NXZ A;  5IYZ A;  1IBL O;  1L1F A;  2ADP A;  2YIC A;  4JAV A;  1ZQN A;  2LP7 A;  1Q86 W;  4PPX A;  2JVD A;  2QTO A;  2QTS A;  4RAI A;  4H37 A;  3JD4 A;  1FKA O;  8ICL A;  3HB3 B;  3JAT A;  1ZTE A;  4DR6 O;  4X4P A;  1AR1 B;  4JI5 O;  4M47 A;  4EV6 A;  5CJ7 A;  4WCE V;  3RYI A;  3E83 A;  4QZF A;  2B1I A;  3HKC A;  2Z0A A;  4BIZ A;  3THO A;  4IG8 A;  5J2U A;  3CXC U;  3AQK A;  5J0S A;  3RGB A;  3LSQ A;  4DO2 A;  4JAA A;  3K5O A;  1ARO P;  2WLI B;  4CC6 A;  3U10 A;  7ICU A;  3OR6 C;  3X2Q B;  3K5M A;  3RJJ A;  2DN9 A;  2AHY A;  3F7Y C;  4DR4 O;  2Q0O C;  4M9G A;  2BOB C;  3SYO A;  3ZHV A;  4AQY B;  1ZQG A;  5JTG A;  4UCU A;  2HKO A;  1RP3 B;  3K3W A;  4MF2 A;  4P4P A;  2KSD A;  4U7N A;  3NWI A;  4I4T B;  2UXN A;  1JJ2 U;  3AG2 C;  1G4Y B;  1ZWI C;  3JPS A;  2Q68 A;  2WLI A;  3CRM A;  4EBJ A;  1KU9 A;  3WFS C;  1BT8 A;  1I7F A;  4B7K A;  1FFX A;  4I2D A;  2B4V A;  1SQP H;  1DF5 A;  3B40 A;  2W0X A;  4I50 A;  1ZQZ A;  1J95 A;  3JAL B;  1RZT A;  9ICS A;  3L75 H;  3HKE B;  1FXH A;  1ZUQ A;  1IBK O;  2DR5 A;  4UV9 A;  3JAW A;  2JJ2 G;  3K0G A;  4RO2 A;  2HLD G;  1L0N H;  3AG4 C;  5KMG A;  3CRR A;  9ICH A;  9ICB A;  4RWP A;  5D49 A;  4U3F H;  4QE7 A;  5BOL A;  3CCE V;  3WG7 B;  1FFX B;  2N04 A;  2JK5 C;  4F5R A;  1RFY A;  2YIA A;  1YXB A;  4YHH O;  4YN4 A;  3FB8 C;  1XL4 A;  2HEP A;  3P3P A;  4Z1V A;  4JF3 A;  3TFR A;  3TCU A;  4I2G A;  3AG4 B;  1WA8 B;  2OCC B;  3RW0 A;  1JA8 A;  4B3M O;  3ABL B;  1S5L Z;  4N23 A;  2CAZ C;  2C2A A;  4RPY A;  3RYC A;  1BZK A;  1UEV A;  2GTA A;  3ZN0 A;  2AGA A;  5EBL C;  4UB6 Z;  2XHB A;  4ZI7 B;  1AIL A;  1JMS A;  3TET A;  2EIM C;  3C2L A;  4AT7 A;  3ZRW B;  1QR9 A;  1YDX A;  1B06 A;  2Q67 A;  4AQY O;  7ICV A;  2A06 H;  4TV8 A;  5DB8 A;  3E22 B;  4LEW A;  1KMI Z;  4LEZ A;  4E2L A;  3K08 A;  4JGS A;  2Y4U A;  4ZIB A;  5CA0 B;  3GVM A;  2PXI A;  3M99 B;  4WFA V;  4DR1 B;  4DW0 A;  3O65 A;  7ICQ A;  4FFB B;  5CA7 A;  4O2B B;  2ZIO A;  3CRQ A;  7ICM A;  4FO1 A;  4QZA A;  3RT3 C;  3OFN G;  4LF9 B;  1E1R G;  3LDE A;  4JI8 B;  3RH5 A;  2FKX A;  4JTC B;  4JI3 O;  3C90 A;  1YCI A;  5IYD O;  5D62 A;  4AT7 B;  3JD0 A;  3WB0 A;  5IT9 N;  4TV8 B;  2IJH A;  2EUL A;  4AT9 A;  2LGW A;  1JCH A;  3CK6 A;  4DR6 B;  1K33 A;  3UQ2 A;  4DUZ O;  1VQ6 V;  3AQM A;  1K5S A;  4RWQ A;  3QVN A;  4E8F A;  3UO3 A;  9ICP A;  3FAV B;  2ZCE A;  5L3B A;  4KLQ A;  3CC2 V;  3JAR B;  5LHH A;  2F4V B;  4JPR A;  3OMI B;  3CMA V;  2DW4 A;  4AHC A;  1P7G A;  4JI6 O;  4PHE A;  1OCZ B;  2CGO A;  2Q73 A;  1V55 C;  1RSO A;  3D36 C;  1VQL V;  2OCC C;  5DKW A;  4IL6 Z;  1W0K G;  1AI6 A;  4DK0 A;  3J81 N;  2OT5 A;  3FAV A;  3SYC A;  2BCC H;  3E8F A;  4I2B A;  2A79 B;  7ICF A;  3VOU A;  3ASN C;  1EN4 A;  3CCL V;  4PHA A;  2ZDI A;  4MVQ A;  4JAS A;  2NRK A;  3H37 A;  4CH4 A;  4DV4 B;  2WA4 A;  5EZY B;  3MAQ A;  1KKD A;  5IIJ A;  1BPD A;  1MIW A;  4GKJ B;  1H2K A;  1BPE A;  1YEW A;  4KLG A;  2W0F C;  3ZMV A;  4FZ1 A;  4FVM A;  1ZQD A;  4KLL A;  3E35 A;  3UM7 A;  1AP6 A;  1ZQU A;  3PHZ A;  1IVS A;  3KKY A;  2BCR A;  1NI8 A;  1ZQC A;  4L87 A;  1S72 V;  3CCJ V;  1IXM A;  1N8R W;  4UUJ C;  4LR3 A;  4IQV A;  2PFQ A;  2ZE8 A;  1R6N A;  3D36 A;  3D8C A;  2X0L A;  4LWS B;  3J80 N;  4FLT A;  3OAA G;  3STZ C;  5LP6 C;  4MFA A;  1BGY H;  4M5D A;  1PNK A;  5IDJ A;  1SQG A;  4K98 A;  3STL C;  3ZMT A;  3ZCC A;  5HRH A;  4LNU A;  3I55 V;  4QPK A;  1GK9 A;  3J7A U;  3K03 A;  2NN4 A;  2D3O W;  1K7D A;  4CH5 A;  1Z2G A;  5FPO A;  1XNQ O;  4DV2 O;  4O5K A;  4QGP A;  1ZQA A;  2QE7 G;  5B5E Z;  5GTI Z;  1JFF B;  3SPJ A;  4PA7 A;  3IFX A;  3HW8 A;  4GXJ A;  5JCO C;  1MAB G;  4GKK B;  4K3A A;  4PHD A;  4MSW C;  4K0K O;  4DV0 B;  4GX1 A;  4PHZ A;  1BSM A;  3SGI A;  2R9I A;  1PPJ H;  3SJB C;  4M2Y A;  4UCS A;  4GX0 A;  4C7U A;  2QA4 V;  3OVA A;  3UT5 B;  3JYY A;  1WNS A;  3UPS A;  2Q6A A;  4PGY A;  1Q82 W;  3PJS K;  1N34 B;  1UPG A;  4X4U A;  1IXB A;  5IJ0 A;  1GAX A;  1SS3 A;  1U97 A;  4H33 A;  3PML A;  3FD9 A;  3EHB B;  2QM7 A;  4FZ0 A;  4GKJ O;  5IJ9 A;  1XRE A;  5J0Y A;  3JSL A;  1RPL A;  3JCZ A;  4FHY A;  3BA8 A;  1QBZ A;  1TVK A;  5L3C A;  4X4Q A;  5J2U B;  4RQ3 A;  5B3Q A;  4DUZ B;  1VQK V;  1IBK B;  1XIL A;  2YXH A;  3MDC A;  3G6B A;  3ABK B;  1WP8 A;  2CK3 G;  4Z6E A;  4I2A A;  5A9G A;  1KYO F;  3N2K B;  4WFB V;  4UVB A;  3N2G B;  3D3Q A;  2CGN A;  9ICJ A;  2LFR A;  4NM2 A;  4LFC O;  4I28 A;  4LFB O;  1NR7 A;  1XSP A;  3ABM C;  2E75 B;  3UKM A;  4NKG B;  2KG7 B;  4O2A A;  3E8G A;  2V7Q G;  3UCS C;  3HJ4 A;  4KLI A;  3H1L H;  3HX0 A;  3LUT B;  1SQV H;  4EB6 B;  4DV2 B;  2VAN A;  7ICG A;  3DSQ A;  5IYZ B;  1SKV A;  4BIU A;  4OX9 O;  3LDC A;  1B04 A;  3VQX A;  5LGU A;  3GWK C;  9ICV A;  4WH5 A;  2HHH B;  1SC5 B;  3F7V C;  4U7O A;  4KLF A;  5HRG A;  8ICQ A;  2CTP A;  1OV9 A;  2XTA A;  4CH3 A;  2KB1 A;  1UFI A;  4KXR A;  4X1Y B;  3JAT B;  4RT3 A;  3CEI A;  4X89 A;  4RQ1 A;  4LF5 B;  1JMK C;  2GBO A;  3CB2 A;  1M57 B;  2Q7E A;  2ZHB A;  3C18 A;  2BPC A;  1SF9 A;  2X7R B;  3HKE A;  4K8Z A;  3K75 D;  2QM8 A;  5C8Y B;  5J2G A;  1ZQH A;  2HJF C;  1GO3 F;  1CPY A;  2JEX A;  2GTS A;  1OCR B;  9ICX A;  1ZSP A;  4DR5 O;  9ICE A;  1R73 A;  3BVO A;  2M2V A;  2UXC B;  1KB9 F;  2ARH A;  3O9O A;  4JI8 O;  5JVD B;  1TV9 A;  1F4M A;  1R6K A;  1FYJ A;  4NM1 A;  4LZD A;  2DQ3 A;  1YF2 A;  2HVJ C;  4MTO A;  5III A;  1IUR A;  1N33 B;  4LVS A;  3WFQ E;  1YHQ V;  4RQ8 A;  3RJG A;  1Y74 B;  3ZMZ A;  1EM1 A;  4MW8 A;  2PBE A;  5IIN A;  2M2T A;  2ZIN A;  8ICX A;  3HIY A;  5EOZ A;  2GHY A;  4RWN A;  4CZZ A;  4DW1 A;  1ZQK A;  2EIJ B;  1HR0 B;  9ICI A;  4RQE A;  2X6B A;  1I08 A;  3WFO A;  2VRZ A;  3ZIA G;  2F4V O;  1G8M A;  2Q9L A;  2P06 A;  1R3K C;  5HC9 A;  1N4C A;  3C3T A;  4J9Y B;  3E89 A;  4R8C A;  1FAF A;  5KX5 B;  4JLZ A;  4HX0 A;  5HFM A;  1Y74 A;  3M8A A;  2PY5 A;  1MZF A;  4TWK A;  5CP2 A;  3JAW B;  1Z5V A;  1YIT V;  4O2B A;  2IH1 C;  1P49 A;  3ML0 A;  4DOC A;  3RYF B;  3R65 A;  4J7J A;  4LBE C;  3A0H Z;  2F93 B;  4P2Z A;  4TUY A;  5EC2 C;  8ICJ A;  1XMQ O;  3H1H H;  3SJQ C;  4TUR A;  2ZH7 A;  2O1P A;  4X5V A;  1NTZ H;  3K5L A;  4RQF A;  2OTJ V;  4CS2 A;  2YXY A;  4EED A;  2FMP A;  2IJJ A;  5JH7 B;  4AIL C;  4EGW A;  1R3I C;  3BFR A;  4DV6 O;  2UXB O;  3RJH A;  3K5N A;  7ICI A;  4MF8 A;  4FO6 A;  2FYU H;  1IBM B;  1I0H A;  4PI2 A;  4OAI Z;  3RYC B;  3C5F A;  4G2K A;  5DBA A;  4YY3 B;  5KAI Z;  2ODM A;  1Q6U A;  1GM7 A;  2BCS A;  4AT8 A;  1K97 A;  1N32 O;  1GN3 A;  1DK1 A;  2EIK B;  2PZS A;  9ICF A;  3E22 A;  2PTM A;  3OGC C;  7ICS A;  2LW7 A;  4CC5 A;  3VQW A;  2XND G;  3UXO A;  4LFC B;  4F5Q A;  4J42 A;  5C93 A;  1SA0 A;  3G80 A;  3OGI B;  2RCV A;  2PGG A;  2E5L B;  4OPA A;  3JD1 A;  4O4I B;  1ZQJ A;  1JJO A;  4QZG A;  1BS3 A;  3V7K A;  2P5O A;  2OIG A;  4JI7 B;  4JYA B;  2DQ0 A;  1ZQI A;  3RH4 A;  3RJE A;  3UO2 A;  4KFM A;  5J2C A;  5H5N A;  3KZI Z;  1XNR O;  5HRB A;  4RWU A;  8ICF A;  1Y76 A;  2JS3 A;  2YEV A;  4X64 O;  4DV3 O;  5DB6 A;  4JV5 B;  4F6E A;  2GAF D;  4DV0 O;  4R65 A;  3DXR B;  3ETG A;  3AU6 A;  1ZQF A;  4L8J A;  2XAQ A;  4NY8 A;  3G71 V;  4RPZ A;  5J0O A;  3C66 A;  1F7Y A;  2HJD A;  4FLZ A;  1VIB A;  4DR5 B;  2DVI A;  5LMN O;  4QZC A;  5HRL A;  3OT7 A;  1QLN A;  4K0K B;  4UXN A;  2FB5 A;  3SYP A;  1G6U A;  1SES A;  3ETE A;  5LA6 A;  5J2A A;  3ZN1 A;  2XUM A;  1T5E A;  2CE4 A;  3QO5 A;  1A32 A;  1NQT A;  2OYQ A;  5CHE A;  4XRH A;  4RQ4 A;  2V4D A;  5DDM A;  3T4D A;  3G6E V;  1HW7 A;  1NVP D;  3BAB A;  2ITD C;  3RVZ A;  4NLN A;  1KKC A;  2GWS A;  1XOU A;  4B3T B;  5EIB C;  5LOV A;  1NZ6 A;  1IDS A;  3K59 A;  5JJJ B;  2CH7 A;  1DGS A;  1BQ0 A;  1HR0 O;  1RPR A;  3MHH C;  8ICO A;  4JYC A;  4IYH A;  4MTF A;  5L3F A;  8ICM A;  1SQQ H;  2JS5 A;  3B8M A;  4PDM A;  4ABM A;  2WPD G;  3FYE B;  3NR7 A;  1H2G A;  4JI4 O;  4RPX A;  4FM2 A;  1M90 W;  4IYI A;  9ICT A;  1NJI W;  1PM9 A;  5LHI A;  4J11 A;  5IJ0 B;  4O4J A;  1YTF D;  4DOB A;  3G4S V;  4YMM A;  3E86 A;  1VAR A;  4DR3 B;  4FLW A;  4UBB A;  3MDS A;  4R6Z A;  1AJN A;  4LWS A;  3FB5 C;  2ZXW B;  2VQF B;  1JQ0 A;  4RQ6 A;  2QR4 A;  3QO7 A;  4UB3 A;  4WFG A;  1SET A;  4PA4 A;  1I5Y A;  3ZHT A;  8ICN A;  5DB7 A;  3WFP A;  1VF6 A;  4OX9 B;  2CTQ A;  5KA6 A;  2EBO A;  4FLV A;  1OCZ C;  4Z1M G;  4NXW A;  4QZI A;  3OV7 A;  5HRE A;  1UET A;  3LSS A;  5KUK A;  1ROP A;  4TUP A;  5J2K A;  4TSF G;  3X2Q C;  1V54 C;  4PA9 A;  9ICQ A;  2FML A;  9ICN A;  1K4C C;  3HKD A;  1N0J A;  3OUF A;  4KL1 A;  5KHI A;  1NVP B;  1GM8 A;  5CBF A;  5LGT A;  1THZ A;  1PNM A;  3VQV A;  4QNH B;  5LBQ A;  4N7R A;  3H3A A;  2WLN A;  5IYC O;  3JD3 A;  4FIP C;  4KUM A;  4DR7 O;  1HNW O;  3N27 A;  1H8E G;  1VFG A;  3IAY A;  2BTO A;  4FJC C;  2VS0 A;  4JWN A;  1ORQ C;  5ITZ A;  3UT5 A;  8ICI A;  1YLQ A;  2E5L O;  4YXW G;  4TQD A;  1P84 F;  1V4A A;  3G67 A;  5B3P A;  3JCF A;  5CR0 A;  3HKD B;  8ICW A;  2FMQ A;  1XBL A;  1S0V A;  4X65 B;  4X1Y A;  1WPB A;  5IJ9 B;  1JQR A;  1JOY A;  4FH5 A;  1ZQQ A;  4P4O A;  4PH5 A;  1VQ9 V;  2GSM B;  1NBM G;  4DYL A;  1W2B U;  1TVK B;  1N36 B;  5J2E A;  2PFN A;  5CA1 B;  1R8C A;  3QNE A;  4J9Z B;  1OU5 A;  5B3S B;  1KBH A;  1WJZ A;  5K1X A;  4O4H B;  3APO A;  1XMO O;  5JVD A;  1PP9 H;  2RQ6 A;  3H9V A;  4K4H A;  2D2C B;  4HNA B;  3BRC A;  4E7X A;  2EJ7 A;  3DC6 A;  3N2K A;  2L35 A;  2B1G A;  1NH2 D;  4O69 A;  2UXD B;  1AI5 A;  4HYO A;  3EF2 A;  2BCU A;  2KG7 A;  5DN6 G;  4NXM O;  4W4K A;  1HNZ B;  4QZ9 A;  1Q6I A;  1ZLZ A;  4GX5 A;  1QHT A;  1ZQY A;  4XA5 A;  4P30 A;  3K06 A;  1HUO A;  9ICM A;  2L6L A;  5KHG A;  2YUA A;  2BPF A;  3I5D A;  3U0Z A;  2DYS B;  4QZD A;  3KCY A;  1YI2 V;  5CFT A;  5BMV B;  3LK9 A;  1M1K W;  5LXT A;  2OTL V;  3SJC C;  8ICZ A;  2A0L A;  1GN4 A;  4PDV A;  2CTR A;  1TGO A;  4GZR B;  1Q8I A;  2KQX A;  2R72 A;  3SYA A;  4OPH A;  5H2F Z;  5D63 A;  4YMN A;  2IJK A;  5C8Y A;  4X66 B;  5FNV A;  5GW7 A;  5CA3 A;  3FYI B;  4EKW A;  3TXS A;  3AEI A;  4PDL A;  1H38 A;  2V1D A;  3JAK A;  5TZV A;  2PI5 A;  2ADQ B;  2WLH A;  4K8X A;  1FS0 G;  1XSN A;  3T1Y O;  4P9P A;  4X4O A;  4I2I A;  4JYA O;  5IWA O;  1M5I A;  4G28 B;  4MVM A;  5BOM A;  8ICG A;  4B08 A;  3TFS A;  3HKB A;  5KA5 A;  3S3X A;  2LW1 A;  2UUC O;  1KNY A;  3CSX A;  2XOK G;  4MTG A;  1E1Q G;  2WLK A;  3V7J A;  1QLE B;  2VQE B;  1K9M W;  1GMG A;  2DRA A;  3CPW U;  1XMO B;  1H2N A;  3JAK B;  4WC4 A;  4UVC A;  3CC7 V;  5J29 A;  1K4D C;  1XNR B;  1PX5 A;  1HNX O;  5BR8 O;  4FM0 A;  1KQS U;  4PJ0 Z;  4XDK A;  1HP8 A;  3FX7 A;  4LF7 B;  1LUV A;  5EBM C;  3CCM V;  8ICT A;  2IHO A;  2ZH9 A;  1Q3E A;  1W0J G;  1VJ7 A;  4YCX A;  1M57 C;  2A3Q A;  2IW5 A;  2RNB A;  4FPP A;  3ABT A;  1EBO A;  2DJV A;  4I0U A;  4LP8 A;  3GWO A;  3ZHS A;  4H13 B;  1SA0 B;  5D46 A;  4X4S A;  1GN6 A;  2WWW A;  2ID1 A;  1VQN V;  4WQK A;  2Q7G A;  4TUY B;  5IE9 A;  3WFR E;  3JAR A;  4F6R A;  2WLM A;  2BBJ A;  4P4M A;  2LJ2 A;  3BA9 A;  8ICK A;  5H9C A;  5FLX N;  1N0N A;  2UUA O;  2B56 A;  3ISB A;  4X9Q A;  4NLZ A;  3CME V;  4XQ8 A;  2YEV B;  3CC4 V;  4O68 A;  4EP7 A;  1RSO B;  2X6C A;  4UVA A;  5B1A B;  1M93 A;  5HRF A;  2LGQ A;  1MIY A;  1K34 A;  4FHP A;  3OEE G;  1WB7 A;  1FJG O;  3OD4 A;  7ICT A;  2RMK B;  3IC7 A;  3P3N A;  2UUB O;  1YIJ V;  2BSK A;  1VQ8 V;  3CCV V;  1MSW D;  4ZKI A;  2PYL A;  3MGI A;  3M7M X;  1WB8 A;  5DM6 V;  5J0U A;  4NKU A;  4IQW A;  4GYC B;  2XAJ A;  5LP6 B;  2WAM A;  2UUC B;  4JI4 B;  2Y48 A;  1URF A;  1NR1 A;  3BPZ A;  4PA6 A;  5LHG A;  4PGX A;  1HNZ O;  3B77 A;  3EFF K;  3HPL C;  4XBF A;  4DV7 B;  1XNQ B;  1Q79 A;  5BPC A;  4PGQ A;  2IM9 A;  3ASO B;  9ICK A;  1Y67 A;  4M04 A;  4DR3 O;  9ICW A;  4O4I A;  4K9A A;  3H1J H;  5DBC A;  1EZV H;  1JR9 A;  3FB6 C;  4BAY A;  3OEH G;  1VEW A;  1TA8 A;  4U3J B;  4KLT A;  3T1H B;  1ZQB A;  3R66 A;  4X8A A;  1D2D A;  5LP6 A;  3F5T A;  3L73 H;  4J7K A;  2DE0 X;  4EEQ A;  4LF4 B;  4DO9 A;  3IGA C;  1AI7 A;  1QR8 A;  4R7C A;  2WSS G;  5L3E A;  2NNU A;  1NTK H;  1TUE B;  3NYB A;  1PL0 A;  4IIJ B;  3DXR A;  1NH2 B;  5CN0 A;  4QZB A;  5EBW C;  1BHB A;  5J2D A;  7ICL A;  2HHP A;  1R8A A;  1EZJ A;  3AG3 C;  2A9H A;  4RUE A;  7ICE A;  2DYS C;  4LT6 A;  4BW5 A;  3BCC H;  3IC9 A;  1SZX A;  4DRX A;  1KUQ A;  1HNW B;  3ABM B;  4ICG A;  1CEZ A;  2ZH4 A;  3ZRS A;  5IWA B;  3ZX6 A;  3CRC A;  5CBG A;  1R89 A;  4FHW A;  4GXI A;  1Q5O A;  2PI4 A;  3JPT A;  3JPP A;  2HP8 A;  4LF6 O;  4UCO A;  5BZB A;  3ZMS A;  3ABK C;  3L72 H;  4IIJ A;  1FJG B;  3ISD A;  2RDC A;  5GON B;  2W9M A;  4MVR A;  3CRA A;  2HFE C;  3JAS B;  1K5Q A;  3H01 A;  5J0Q A;  4X1K B;  5LOV B;  1FXK A;  2CH7 B;  3RWR D;  2YIB D;  4UB4 A;  5B1B C;  1HNX B;  1J5E O;  1VQ4 V;  4DRX B;  2QKS A;  5FL7 G;  4K8V A;  4TQF A;  2O57 A;  4PDR A;  3B4S A;  5H6R A;  4X20 A;  2VWJ A;  3RYH A;  3RN4 A;  2EIL B;  5CB1 A;  5IIL A;  1IX9 A;  4K99 A;  3FB7 C;  3EXA A;  5GON A;  4O6A A;  8ICU A;  5H6Q A;  3I56 V;  1MQ2 A;  4DOA A;  2NR5 A;  3JAS A;  4JI6 B;  3SYQ A;  5IIK A;  1TVA A;  4O4J B;  1BPZ A;  4M9N A;  1FA0 A;  4I5S A;  4I9Q A;  2N05 A;  1XDC A;  2HN2 A;  1S76 D;  2ZR3 A;  5FPR A;  3N2G A;  1QU7 A;  3B0X A;  2UUA B;  3DTU B;  2ZE5 A;  1OHH G;  8ICA A;  3ZRX A;  4YD2 A;  4WC3 A;  3WU2 Z;  3HJ1 A;  2ZH5 A;  3W7T A;  2HG5 C;  5CA1 A;  3GDX A;  4DUY O;  2F23 A;  4E4E A;  1VQ5 V;  1MQ3 A;  3ZHU A;  4GT1 A;  4R63 A;  1WP7 A;  3T1C A;  4NXV A;  3PMN A;  5J2J A;  3H39 A;  1EN5 A;  4IHJ B;  3ERC C;  4HNA A;  4O67 A;  1S3J A;  2YXL A;  8ICY A;  4MFF A;  1SZT A;  4LC1 A;  4OAG A;  4LF8 O;  3LNN A;  2ZT9 B;  4Z2W A;  2ZH1 A;  3AG7 A;  4UD5 A;  4EFB A;  5LMU B;  2DRB A;  3DC5 A;  4DV7 O;  2YI8 A;  1FXV A;  2QWO B;  1R3J C;  3OE7 G;  1FD9 A;  3ZRV A;  3ICX A;  4K35 A;  4M9L A;  4XDL A;  3OUY B;  3KCX A;  1E79 G;  3ZHQ A;  4Z6F A;  4JI0 B;  1ZJN A;  5LMN B;  1ZJM A;  3AG1 C;  4YJ2 B;  3QO8 A;  4YIO A;  1EN6 A;  2K9P A;  1GH6 A;  3JPQ A;  2VQE O;  1NKD A;  3BEH A;  3ETD A;  1DLB A;  1QNM A;  4LEV A;  5J0R A;  4BR6 A;  4PEL A;  9ICC A;  4M0A A;  2QWP B;  1RM1 B;  2FTK A;  4LFA O;  3FFQ A;  2PFP A;  3JPO A;  4O4H A;  3UQ8 A;  4WQL A;  1GKF A;  3C2M A;  1NU1 H;  4DV6 B;  1HDJ A;  1ZL8 B;  2YID A;  3AUO A;  7ICP A;  3GB7 C;  4D6T H;  1X4T A;  7ICH A;  4GUN A;  2ITC C;  3TXQ A;  1Y4M A;  5D61 A;  8ICP A;  5KX5 A;  1YJN V;  3CXH F;  4FLY A;  4WBN A;  4MVS A;  2FCL A;  3NVO A;  2P90 A;  3RYF A;  1S5J A;  1SQX H;  1U96 A;  4X4V A;  4X62 O;  4UD4 A;  4DV1 O;  3WB2 A;  2QWQ B;  3SPH A;  5BMV A;  2IHM A;  5J0T A;  3W7W A;  5LXT B;  2ZQM A;  3CCU V;  4JI1 B;  1Q81 W;  4MFC A;  3ABU A;  3CJH A;  5CB4 B;  2IJI A;  3U11 A;  4FLU A;  2P4K A;  3V72 A;  1R3L C;  1G1X B;  2PUS A;  4TUS A;  1LNQ A;  2WA3 A;  1IBL B;  4JLX A;  3CP1 A;  4G27 B;  2JRI A;  3IJ4 A;  3AG1 B;  4F6R B;  2Q0A A;  3RFR A;  1MNG A;  3Q4H B;  2DWE C;  4CS4 A;  4QZH A;  4LCU C;  2M2U A;  1F4N A;  1LUW A;  1FPO A;  2K1E A;  4X0B A;  4UAZ A;  3OW2 U;  2IH3 C;  3JAM N;  1OCC B;  5EC1 C;  2DYR B;  3CJH B;  2RN9 A;  1VF5 B;  4UCR A;  5LYJ B;  4DR1 O;  5K1P A;  1BE3 H;  4OAH A;  4DR7 B;  1YZB A;  3B0Y A;  1WOT A;  5DEC A;  1ZAU A;  1GRJ A;  1IBM O;  4LFA B;  2EIM B;  4FHX A;  4NXT A;  5KAF Z;  4F5P A;  1MOF A;  5TIS Z;  4YY3 O;  3W7S A;  2EJR A;  3ABL C;  5DDY A;  4X4T A;  4KLJ A;  3OMN B;  3RYI B;  4O9M A;  1WAZ A;  2DR9 A;  3BAA A;  4B3R B;  1PD3 A;  4UV8 A;  1Y66 A;  4KP4 A;  2EIN C;  4R66 A;  4NR1 A;  1OCO B;  4JYB A;  1R6T A;  1I5X A;  4W4L A;  2UXC O;  1N36 O;  3ZBH A;  2F95 B;  4J10 A;  4RUF A;  4UCT A;  1GTO A;  5EYP A;  4BW9 A;  1R8B A;  2CDY A;  1M9N A;  3ZHR A;  4EFE A;  2OCH A;  3A0R A;  3HR0 A;  1OJH A;  4CBC A;  1B3Q A;  4J7Z A;  5J2T B;  3SPG A;  2Q7H A;  4I4T A;  2VWK A;  4FK5 C;  2RJZ A;  1VF7 A;  4LH7 A;  3MBY A;  3UXP A;  4JI5 B;  4K96 A;  4UB5 A;  2HVK C;  4X64 B;  4DV3 B;  1AI4 A;  4XJE A;  1YVW A;  4JI2 O;  2H94 A;  1AB3 A;  2BPG A;  2P7T C;  4I27 A;  3RJI A;  1B6Q A;  3K9S A;  1NO5 A;  9ICR A;  4NVP A;  4UB2 A;  2QJ1 A;  4I0X B;  4EBK A;  4M9J A;  4I50 B;  4DR2 B;  3JZ0 A;  5HRK A;  2VQF O;  4OXS A;  5CMU A;  3CE2 A;  1Q90 D;  3W7U A;  4UAY A;  2EX3 A;  1TAE A;  2Q5Z A;  2ZHA A;  4ZHQ A;  1QLE C;  2QSA A;  1NS1 A;  5D5Q A;  4DV4 O;  3TJT A;  2X6A A;  3OTF A;  5KUM A;  5KMG B;  4XQ7 A;  4JZG A;  2Y0P A;  1US6 A;  4XDJ A;  4NLK A;  1ZQS A;  9ICO A;  3PNC A;  4UFZ A;  2NLJ C;  1AJP A;  1IZ3 A;  2ZKO A;  4I55 A;  1WLE A;  4J80 A;  5BY1 A;  3JYC A;  1VQM V;  1XEQ A;  4B3S B;  4DV1 B;  2UXB B;  1FFT B;  1H8H G;  1SQF A;  1CP9 A;  1WPX A;  2EIN B;  4J41 A;  4U3J A;  1Q7Y W;  3W7X A;  2M2W A;  2IUB A;  1VQO V;  2HN1 A;  3OR7 C;  4TUQ A;  2OIE A;  1VMG A;  1WN7 A;  2ZDI C;  1BHA A;  4DUY B;  3JD2 A;  4IQU A;  4R64 A;  4IT5 A;  5E79 Z;  3LNM B;  1MG1 A;  1VF6 C;  5IY5 C;  4NTW A;  2Y4T A;  3LSU A;  3ZRW A;  1N32 B;  1O9H A;  2JDI G;  2ATK C;  3ZS8 C;  3MGH A;  3L9D A;  5HR9 A;  4TT3 G;  3A2F A;  4FM1 A;  2Q69 A;  4K97 A;  9ICL A;  2Z5U A;  4NXU A;  4KLD A;  1ZQT A;  2Q8V A;  4Z6D A;  1F23 A;  5CWR A;  2A7W A;  4YHH B;  5J2B A;  2OWO A;  3OTO B;  2AZ0 A;  3HWT A;  4FFB A;  2Y0I A;  2R9A A;  4JI0 O;  2UU9 B;  5IIO A;  3OMA B;  3NXS A;  4MS2 A;  4RWO A;  1ENV A;  1XSL A;  3AQL A;  4JI7 O;  3AK2 A;  3JPN A;  2PYJ A;  5ITZ B;  4AT9 B;  4X1K A;  1FXK B;  4I9W A;  4KLU A;  4DK1 A;  4UAW A;  1MIV A;  4JV5 O;  4OAF A;  3E8H A;  3ER8 C;  2O5A A;  1ZQL A;  2RFF A;  3L70 H;  4ATB A;  4IGG A;  2YC0 A;  4WCW A;  5HHH A;  1V9P A;  4D7T A;  5B1A C;  4I7Z B;  4UCV A;  3CYO A;  3K0D A;  4I2F A;  2ZH2 A;  4X20 B;  5JWP A;  1BMF G;  3VBB A;  3RYH B;  3ASN B;  4X1I B;  3C5G A;  5HHI A;  3B8N A;  4PD4 F;  4MKP A;  4RQ7 A;  5J0P A;  1KEC A;  3A0B Z;  1VQP V;  2ILM A;  4JTA B;  4JI3 B;  4YD1 A;  3OUY A;  4NB5 A;  1JN3 A;  3UXN A;  4WC2 A;  3OVS A;  7ICN A;  8ICH A;  1SER A;  4K4I A;  4WFF A;  4UBC A;  8ICR A;  4YJ2 A;  4ASU G;  3OWG A;  2QEX V;  3C2K A;  1BCC H;  1COW G;  3MHS C;  8ICE A;  5JQG B;  4UB8 Z;  4HBN A;  1KDH A;  1H2M A;  3V7L A;  1ZQE A;  5J0W A;  2E3C A;  3P32 A;  4DV5 B;  4AI8 A;  5AG2 A;  1D5A A;  7ICR A;  2ZE7 A;  1EFR G;  1Q43 A;  3CCQ V;  5LGN A;  4ZOL B;  3B2E E;  1Z5W A;  1V55 B;  3QG5 A;  2FMS A;  4ZBM A;  4WBY A;  1DTO A;  2AW9 A;  4GCZ A;  1ZQR A;  3K57 A;  1MSD A;  3RJF A;  1VQ7 V;  4IQT A;  4O5C A;  3CHX A;  8ICC A;  2W6I G;  2ZR2 A;  4MVZ A;  4Q20 A;  3SPC A;  5JQG A;  1K8A W;  1RPO A;  1ZQX A;  3CX5 F;  4LF5 O;  1JAJ A;  2Y69 B;  1QVG U;  4NXM B;  2DYR C;  1YJW V;  4Z6C A;  4F5O A;  2GV9 A;  2YIB A;  5FNV B;  4B7E A;  2M6Y A;  5BR8 B;  3QF7 A;  4WC5 A;  1RM1 C;  4GKK O;  3VQY A;  2XAG A;  1ZQO A;  2WLL A;  1R1B A;  4X4R A;  2GUZ B;  4B3S O;  5HFL A;  3K58 A;  3T4Z A;  4XUS A;  9ICG A;  3AG2 B;  1K3E A;  2ZNJ A;  1F51 A;  5CB4 A;  3HKB B;  2AHZ A;  1MZE A;  3RBZ A;  4QE9 A;  4RQ0 A;  3AK1 A;  3EVK A;  1GPJ A;  4X66 O;  1V54 B;  4QIW F;  5CHG A;  2BE3 A;  5JCO A;  1HUZ A;  4DXW A;  1AP5 A;  4H0L B;  4WFH A;  5B66 Z;  4KLS A;  2R9R B;  4JTD B;  3SR2 C;  1ZL8 A;  1TFW A;  1P7B A;  3HKC B;  2YS8 A;  4QPJ A;  1M4U A;  4O4L A;  1K73 W;  3AU2 A;  5CBH A;  3OTO O;  2Q4P A;  4LF9 O;  4NXN O;  4WC7 A;  3E2E A;  1TUB B;  2Q66 A;  1TFY A;  4WBN B;  1AVM A;  2ZE6 A;  1ZQV A;  3WG7 C;  1ZX3 A;  3C3S A;  2PF4 E;  1YSC A;  1XHX A;  2BTQ A;  1JX9 A;  1XMQ B;  2BBH A;  4LFB B;  2ZXW C;  4DR2 O;  1UEU A;  2DR7 A;  4YMO A;  2QWN B;  5B3S C;  2LFS A;  4JI2 B;  1Q6H A;  1KC8 W;  3BHP A;  5EIB D;  4RQ5 A;  5L3D A;  2KKW A;  7ICJ A;  2QWR B;  2B9Z A;  4HZ3 A;  1MMM A;  3JAL A;  2B51 A;  2P22 C;  4YIP A;  2ZM6 B;  1XL6 A;  3APQ A;  4FHV A;  3Q4H A;  5B1B B;  2ZNI A;  2BSK B;  2YSU B;  4MT8 A;  2DMX A;  4FLX A;  2UXD O;  1YJ9 V;  1I94 B;  4QZE A;  5J2T A;  3CS5 A;  4O2A B;  4X0A A;  4I29 A;  3MCR A;  4WC6 A;  2EIK C;  2ZH6 A;  3CD6 V;  4Q6G A;  4EB6 A;  4N21 A;  3WFV A;  4WC0 A;  4KHP B;  5B1O A;  2I9G A;  1AJQ A;  2YI9 A;  4GX2 A;  4LF8 B;  4TV9 A;  3RVY A;  2UXX A;  2P67 A;  2CUG A;  2QKA A;  3FKS G;  3A8T A;  4NTY A;  3SDL A;  5DB9 A;  3D3I A;  1NOM A;  1DF4 A;  4I2H A;  2P6J A;  2UUB B;  4PV1 B;  4CS3 A;  1AR4 A;  1P4R A;  3AG3 B;  4S3N A;  4BIO A;  4ZHQ B;  1SQB H;  2JIZ G;  3LDD A;  4TOI A;  3AK3 A;  4KLO A;  1L8D A;  4JWM A;  3MDA A;  2B5U A;  3JCU Z;  4ZI7 A;  5L3G A;  4TV9 B;  4GXK A;  2EZO A;  2ZH3 A;  2G38 A;  2JGD B;  3T1Y B;  3H38 A;  1BQZ A;  4NYK A;  3NKU A;  4RQ2 A;  1JPX A;  3ASO C;  4PHP A;  1NT2 B;  5EYP B;  5J2F A;  4HAM A;  3K79 A;  1XI1 A;  8ICB A;  2BCQ A;  1GN2 A;  2QDO A;  4DR4 B;  5JJE B;  1ZQP A;  4QZ8 A;  3RJK A;  2DR8 A;  5HRI A;  2ZH8 A;  2ZD9 A;  1PKX A;  4NTX A;  1CXZ B;  4LF4 O;  2JEU A;  8ICV A;  2N74 A;  2Y69 C;  5D5P A;  1XQ8 A;  1M56 B;  5J9P C;  2ZM6 O;  5KHJ A;  3UPQ A;  1Y6X A;  2JGD A;  4I0X A;  2EIL C;  2BCV A;  4LF7 O;  4WFE A;  3MD0 A;  1GM9 A;  1I94 O;  2CTW A;  1L0L H;  4X62 B;  3ZJZ A;  4CH6 A;  5KLV H;  5EK0 A;  4P9O A;  1H2L A;  1WA8 A;  4LZG A;  2DOS A;  4KB6 A;  2LO1 A;  5DBB A;  1N34 O;  1F5A A;  4A5U B;  1KD1 W;  3AQN A;  2E76 B;  2E74 B;  9ICU A;  1BPY A;  9ICA A;  1UJW B;  3OVB A;  3H1K H;  7ICK A;  1XHZ A;  4LEY A;  3OGU A;  5JJN B;  1D5N A;  3SJA C;  4EEB A;  2JGU A;  4I55 B;  2YDE A;  4O5E A;  5JH7 A;  4MW3 A;  1AR5 A;  1QCE A;  5CA0 A;  2F1M A;  4F4L A;  1MA1 A;  3WB1 A;  2P4V A;  5LL6 Y;  1J5E B;  3LQC B;  4KLM A;  3H1I H;  4ATB B;  1W59 A;  4E80 A;  4QJF B;  1OZ0 A;  1KP2 A;  1PNL A;  4WOY A;  3KG2 A;  4DV5 O;  2HR3 A;  5D4B A;  4R50 A;  4JYY A;  5LMU O;  1ZQM A;  1JVM A;  4B3M B;  1SRY A;  2QGN A;  4GLX A;  4X1I A;  2XAF A;  1HWY A;  1BPB A;  1KEJ A;  1BPX A;  4AT8 B;  2EIJ C;  4YJ3 B;  4I2E A;  3ZED A;  4FFK A;  3TK1 A;  3L71 H;  5A2Q N;  4JZ2 A;  1YTF B;  4P2H A;  4MTX A;  4NXX A;  2WLJ A;  4IHJ A;  5KHK A; 
#chains in the Genus database with same CATH homology
 2BPG A;  4I27 A;  3RJI A;  5DED A;  5TZV A;  1NO5 A;  5J0Y A;  9ICR A;  1RPL A;  4UB2 A;  4EBK A;  1XSN A;  4KLE A;  5J2H A;  4KLH A;  4M9J A;  4FHY A;  4X4O A;  5J2I A;  4I2I A;  3JZ0 A;  4X4Q A;  4RQ3 A;  5HRK A;  5BOM A;  8ICG A;  4UB1 A;  3TFS A;  4I2J A;  4UAY A;  2ZHA A;  1KNY A;  3MDC A;  3V7J A;  4Z6E A;  1Q78 A;  4I2A A;  4XQ7 A;  2DRA A;  4NLK A;  4WC4 A;  5J29 A;  3JPR A;  1ZQS A;  4WBZ A;  9ICJ A;  9ICO A;  1PX5 A;  4RT2 A;  4NM2 A;  3PNC A;  4I28 A;  1ZQW A;  1XSP A;  4I2C A;  5IIM A;  5HRD A;  3HJ4 A;  8ICT A;  2ZH9 A;  3HX0 A;  1VJ7 A;  2VAN A;  4YCX A;  7ICG A;  5F2V O;  2M2W A;  5D46 A;  4X4S A;  4TUQ A;  2ID1 A;  9ICV A;  4KLF A;  7ICO A;  5HRG A;  8ICQ A;  3WFR E;  2ISP A;  4IQU A;  4R64 A;  4P4M A;  2P66 A;  4RT3 A;  8ICK A;  4RQ1 A;  3MGH A;  2ZHB A;  3L9D A;  2BPC A;  3C18 A;  5HR9 A;  3K75 D;  1ZQH A;  5J2G A;  3ISB A;  4NLZ A;  9ICL A;  4XQ8 A;  4KLD A;  1ZQT A;  4Z6D A;  5CWR A;  4EP7 A;  5J2B A;  9ICX A;  9ICE A;  3HWT A;  2M2V A;  5HRF A;  5IIO A;  1MIY A;  4X4N A;  4FHP A;  1TV9 A;  4RWO A;  4NM1 A;  1XSL A;  3ISC A;  7ICT A;  3AQL A;  2ISO A;  4NKT A;  4LZD A;  3JPN A;  3UQ0 A;  5III A;  4WC1 A;  4LVS A;  3MGI A;  3WFQ E;  4RQ8 A;  2PFO A;  3RJG A;  4AT9 B;  4FH3 A;  5J0U A;  4NKU A;  4IQW A;  4KLU A;  4UAW A;  1MIV A;  2PBE A;  5IIN A;  2M2T A;  2O5A A;  1ZQL A;  8ICX A;  2RFF A;  3HIY A;  5EOZ A;  8ICS A;  4RWN A;  4ATB A;  1ZQK A;  9ICI A;  4PGX A;  1Q79 A;  4WCW A;  4F5N A;  5HHH A;  4PGQ A;  5BPC A;  3WFO A;  9ICK A;  3RH6 A;  4M04 A;  4I2F A;  2ZH2 A;  4K4G A;  4M9H A;  9ICW A;  5J0X A;  5HC9 A;  3C5G A;  5DBC A;  5HHI A;  4RQ7 A;  5J0P A;  4NXZ A;  5CP2 A;  4KLT A;  1ZQB A;  4YD1 A;  3OUY A;  1ZQN A;  1JN3 A;  3UXN A;  4KLI A;  4WC2 A;  3OVS A;  4DO9 A;  4DOC A;  7ICN A;  4PPX A;  8ICH A;  3NYB A;  4K4I A;  8ICJ A;  4UBC A;  8ICR A;  8ICL A;  3C2K A;  4TUR A;  2ZH7 A;  4X5V A;  2O1P A;  4QZB A;  8ICE A;  4X4P A;  4M47 A;  4QZF A;  5CJ7 A;  1KDH A;  3V7L A;  5J2D A;  1ZQE A;  5J0W A;  4IG8 A;  7ICL A;  3AQK A;  2HHP A;  2FMP A;  1R8A A;  5J0S A;  7ICE A;  7ICR A;  4LT6 A;  3RJH A;  7ICU A;  7ICI A;  4MF8 A;  4FO6 A;  2FMS A;  4WBY A;  2ZH4 A;  3RJJ A;  1R89 A;  4FHW A;  4GXI A;  3C5F A;  1ZQR A;  3JPT A;  3JPP A;  5DBA A;  3RJF A;  4M9G A;  4IQT A;  4O5C A;  8ICC A;  3ISD A;  1ZQG A;  2BCS A;  2W9M A;  4AT8 A;  1ZQX A;  4MF2 A;  1JAJ A;  4P4P A;  9ICF A;  5J0Q A;  7ICS A;  4Z6C A;  4F5O A;  4UB4 A;  3UXO A;  3JPS A;  4F5Q A;  4WC5 A;  1ZQO A;  4EBJ A;  3WFS C;  4X4R A;  4I2D A;  1ZQZ A;  1RZT A;  9ICS A;  1ZQJ A;  4QZG A;  4XUS A;  9ICG A;  3V7K A;  5CB1 A;  5IIL A;  8ICU A;  1ZQI A;  3RH4 A;  3RJE A;  1MQ2 A;  4DOA A;  5J2C A;  5IIK A;  2DR5 A;  1TVA A;  4RQ0 A;  5HRB A;  1BPZ A;  8ICF A;  4M9N A;  1FA0 A;  5DB6 A;  5CHG A;  2BE3 A;  1HUZ A;  9ICH A;  9ICB A;  4RWP A;  4R65 A;  5D49 A;  3B0X A;  5BOL A;  3AU6 A;  1ZQF A;  4KLS A;  4NY8 A;  8ICA A;  4F5R A;  4RPZ A;  4YD2 A;  4WC3 A;  5J0O A;  1TFW A;  3C66 A;  3HJ1 A;  2ZH5 A;  3AU2 A;  4YN4 A;  3GDX A;  2DVI A;  4QZC A;  5HRL A;  4WC7 A;  3TFR A;  4I2G A;  1MQ3 A;  5J2A A;  2Q66 A;  4R63 A;  1TFY A;  3PMN A;  4XRH A;  4RQ4 A;  5J2J A;  1ZQV A;  3H39 A;  4RPY A;  5DDM A;  1UEV A;  1JMS A;  3C2L A;  8ICY A;  4MFF A;  4AT7 A;  1UEU A;  2DR7 A;  4NLN A;  7ICV A;  4YMO A;  2GWS A;  5DB8 A;  2ZH1 A;  4UD5 A;  2PXI A;  2DRB A;  8ICO A;  4RQ5 A;  4M9L A;  3OUY B;  5CA7 A;  7ICJ A;  7ICQ A;  8ICM A;  7ICM A;  4QZA A;  4Z6F A;  1ZJN A;  1ZJM A;  3RH5 A;  4FHV A;  4AT7 B;  4RPX A;  3JPQ A;  9ICT A;  4QZE A;  4AT9 A;  4X0A A;  4I29 A;  4DOB A;  4WC6 A;  2ZH6 A;  4YMM A;  4UBB A;  5J0R A;  4WC0 A;  4M0A A;  9ICC A;  2I9G A;  3UQ2 A;  2PFP A;  3AQM A;  3JPO A;  4RWQ A;  4RQ6 A;  4E8F A;  4UB3 A;  3C2M A;  9ICP A;  4KLQ A;  5DB9 A;  3AUO A;  8ICN A;  5DB7 A;  1NOM A;  7ICP A;  3WFP A;  4I2H A;  7ICH A;  3OV7 A;  4QZI A;  4S3N A;  5HRE A;  8ICP A;  1UET A;  4TUP A;  4PHE A;  5J2K A;  9ICQ A;  4KLO A;  9ICN A;  4JWM A;  3MDA A;  4X4V A;  5DKW A;  4UD4 A;  4GXK A;  3H3A A;  2ZH3 A;  3H38 A;  2IHM A;  1VFG A;  5J0T A;  4RQ2 A;  4PHP A;  5J2F A;  4JWN A;  4MFC A;  8ICB A;  2BCQ A;  4I2B A;  7ICF A;  1ZQP A;  4QZ8 A;  3RJK A;  4PHA A;  8ICI A;  3V72 A;  1YLQ A;  2DR8 A;  2NRK A;  3H37 A;  5HRI A;  4TUS A;  2ZH8 A;  1V4A A;  5IIJ A;  1BPD A;  1MIW A;  5CR0 A;  8ICV A;  1BPE A;  8ICW A;  2FMQ A;  4KLG A;  1JQR A;  1ZQD A;  4FH5 A;  4QZH A;  4P4O A;  2M2U A;  4PH5 A;  1ZQQ A;  3UPQ A;  4KLL A;  2BCV A;  4X0B A;  1ZQU A;  4UAZ A;  5J2E A;  2PFN A;  2BCR A;  1ZQC A;  1R8C A;  4IQV A;  1OU5 A;  2PFQ A;  3B0Y A;  1WOT A;  5DEC A;  4LZG A;  4FHX A;  4MFA A;  5DBB A;  4M5D A;  4K4H A;  1F5A A;  4F5P A;  3AQN A;  4E7X A;  5HRH A;  9ICU A;  1BPY A;  9ICA A;  3OVB A;  5DDY A;  4X4T A;  7ICK A;  3OGU A;  2BCU A;  4KLJ A;  4O9M A;  4QZ9 A;  4O5E A;  1ZQA A;  4O5K A;  2DR9 A;  1ZQY A;  4XA5 A;  4R66 A;  1HUO A;  9ICM A;  3HW8 A;  3LQC B;  4GXJ A;  4KLM A;  4ATB B;  4E80 A;  2BPF A;  4PHD A;  4QZD A;  5D4B A;  3LK9 A;  1ZQM A;  4M2Y A;  8ICZ A;  1R8B A;  1KEJ A;  1BPX A;  1BPB A;  3OVA A;  3JYY A;  4AT8 B;  3UPS A;  4YMN A;  4I2E A;  4PGY A;  4X4U A;  4P2H A;  3MBY A;  3UXP A;  3PML A;  4UB5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...