5DEDA

Crystal structure of the small alarmone synthethase 1 from bacillus subtilis bound to its product pppgpp
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
198
structure length
196
Chain Sequence
DKQWERFLVPYRQAVEELKVKLKGIRTLYEYEDDHSPIEFVTGRVKPVASILEKARRKSIPLHEIETMQDIAGLRIMCQFVDDIQIVKEMLFARKDFTVVDQRDYIAEHKESGYRSYHLVVLYPLQTVSGEKHVLVEIQIRTLAMNFWATIEHSLNYKYSGNIPEKVKLRLQRASEAASRLDEEMSEIRGEVQEAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords GTP pyrophosphokinase YjbM
publication title Catalytic mechanism and allosteric regulation of an oligomeric (p)ppGpp synthetase by an alarmone.
pubmed doi rcsb
source organism Bacillus subtilis py79
total genus 62
structure length 196
sequence length 198
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.6.5: GTP diphosphokinase.
pdb deposition date 2015-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04607 RelA_SpoT Region found in RelA / SpoT proteins
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.860 Mainly Alpha Orthogonal Bundle Helix Hairpins Nucleotidyltransferase 5dedA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5dedA01
4FHVA 1MQ3A 1KNYA 3H39A 4X4RA 8ICZA 3AQNA 2BPFA 4MFAA 7ICRA 5IIJA 5J2DA 5IIMA 5D4BA 2I9GA 4QZ8A 2O5AA 4QZFA 1ZQKA 4YD1A 4DOCA 1ZQTA 2BCUA 4PGYA 3OUYB 4TURA 4EP7A 8ICAA 4QZGA 3C5GA 4M9NA 8ICYA 4X4PA 4PHAA 4UB4A 4MFFA 4I2GA 3TFRA 3ISCA 2ZH1A 3AUOA 3JZ0A 2ZH7A 4R65A 4NLNA 4RWNA 1OU5A 7ICEA 8ICBA 4QZCA 4NLKA 4MF2A 2ZH9A 3C66A 4NXZA 5J2GA 3RJFA 4LZDA 5J2BA 9ICUA 1Q79A 1UETA 2BE3A 4ATBB 5HRLA 4PGQA 4R63A 3MBYA 8ICOA 4RPYA 4LZGA 3HW8A 4KLGA 5BOMA 3OV7A 4O5EA 9ICNA 3C2MA 3WFOA 4M04A 3JPNA 1BPEA 3H37A 4E7XA 4DOAA 4KLQA 4O9MA 9ICLA 2FMPA 2RFFA 8ICXA 4RWOA 5HC9A 1BPXA 3JPPA 1F5AA 8ICJA 4RQ7A 2PFOA 4QZIA 5DBCA 2M2WA 4WC0A 2ZH5A 4KLLA 4MF8A 4YMMA 1ZJMA 3PMNA 4P4MA 1BPBA 4LT6A 4JWNA 1ZQHA 4F5NA 3RJIA 4K4IA 4F5QA 1FA0A 4AT9A 2BPCA 4ATBA 2DVIA 4XQ7A 1XSLA 4KLHA 9ICXA 5BOLA 2ISOA 2M2UA 5DEDA 1MIYA 4WC7A 1BPYA 1ZQCA 4KLIA 1RPLA 5HR9A 3L9DA 5J0OA 5D46A 5J2JA 1VJ7A 5IIIA 2GWSA 1ZQPA 5HRFA 4I2FA 2PFPA 4KLTA 5HHHA 4M9LA 1HUZA 3OGUA 1VFGA 8ICEA 3AQMA 3RJGA 2DR5A 1TVAA 2NRKA 7ICFA 7ICGA 5CA7A 4UD5A 4RQ6A 2FMQA 4RT2A 5HHIA 4FHWA 4NKTA 4RT3A 9ICRA 2M2VA 5CJ7A 4K4GA 1XSPA 7ICJA 4RQ0A 4PH5A 4F5PA 4UBCA 5BPCA 4TUPA 1ZQVA 5J0WA 2DR8A 2M2TA 5DKWA 3NYBA 5TZVA 4X4NA 9ICPA 4RPXA 4UAZA 2ZH3A 8ICPA 5CB1A 4XUSA 4RQ8A 1ZJNA 9ICKA 4R66A 1ZQEA 4NKUA 4XA5A 3MDCA 4RQ2A 4O5KA 4RQ5A 3V7KA 5J2FA 7ICLA 1PX5A 9ICEA 2PFQA 1ZQGA 3HWTA 5IILA 1BPDA 4TUSA 1TFWA 5DBAA 4M9HA 4Z6FA 4WC2A 5DDMA 8ICSA 1ZQXA 9ICTA 5DB8A 4F5RA 4WCWA 4P4OA 2PXIA 1R8BA 5DECA 2ZH8A 4M2YA 4MFCA 4EBKA 3JPOA 4M0AA 5J0UA 3MGHA 5HRKA 4PPXA 2ISPA 5IIOA 5J0PA 4I2CA 4JWMA 4PHPA 3UPSA 1UEVA 4UAWA 1R8AA 2BCVA 2P66A 4O5CA 8ICRA 4RWPA 1ZQUA 9ICWA 3GDXA 3RJJA 2VANA 4M5DA 5DB9A 4KLDA 1ZQZA 1ZQFA 4KLFA 3C5FA 8ICGA 8ICLA 2HHPA 2W9MA 4QZDA 3OUYA 3V72A 1WOTA 8ICFA 2DRAA 3JPTA 1MIVA 4Z6CA 4FH5A 4WC6A 4WC4A 5HRBA 4AT8B 5IIKA 1ZQAA 1R89A 9ICQA 5J0SA 9ICCA 4RWQA 1TFYA 4KLEA 9ICAA 4YD2A 3JPQA 7ICUA 5J0YA 5HRHA 4PGXA 5CR0A 4X4VA 1HUOA 4QZAA 1UEUA 8ICIA 9ICFA 1ZQRA 4IQVA 3OVBA 5HREA 5EOZA 1YLQA 4EBJA 4X0BA 5IINA 1ZQIA 3AQKA 3RH4A 4IQTA 1BPZA 4UB5A 3C2LA 4M9GA 3WFPA 5J0TA 3V7JA 5HRDA 4WC3A 3V7LA 3RJKA 4UAYA 3RJEA 1ZQNA 7ICPA 3H38A 4AT8A 4S3NA 2IHMA 9ICBA 4GXKA 2PBEA 3RJHA 4I27A 4YMNA 4UB1A 9ICJA 3UXOA 7ICQA 9ICVA 1MQ2A 1ZQDA 8ICKA 4RQ3A 4I2HA 4FH3A 4IG8A 4I2JA 4R64A 8ICCA 4QZEA 1KEJA 2ZH6A 4GXJA 4X4QA 4GXIA 1ZQMA 4YMOA 1KDHA 3C2KA 7ICIA 4NLZA 4KLUA 5J2CA 3B0YA 4Z6DA 8ICMA 4FHXA 1JQRA 8ICTA 5J2KA 5DBBA 3ISBA 4E80A 4XRHA 3WFRE 9ICSA 4X4UA 2ZHAA 3UXPA 2BCSA 3MGIA 4UBBA 4AT7B 4I2EA 7ICMA 3K75D 3AQLA 4X0AA 8ICHA 4I28A 4QZBA 5J2AA 4P2HA 8ICQA 4WBZA 4LVSA 2DR9A 1ZQQA 4I2AA 2PFNA 4KLOA 4WBYA 5J2IA 4AT9B 3UXNA 1RZTA 1ZQBA 9ICMA 3HX0A 4E8FA 4UB2A 4DOBA 4I2DA 4X4SA 4X4OA 1Q78A 3C18A 4UB3A 4RQ4A 4P4PA 3AU2A 5CP2A 4UD4A 3RH5A 1NOMA 3HJ4A 1JAJA 9ICHA 3JPRA 3AU6A 3MDAA 3HJ1A 7ICKA 4PHDA 4NM1A 7ICOA 5J0RA 5J0XA 1NO5A 4PHEA 4AT7A 3WFSC 7ICVA 2BCQA 3JYYA 7ICTA 1V4AA 3B0XA 8ICNA 7ICNA 4Z6EA 5F2VO 1ZQYA 4FHYA 4TUQA 2ZH2A 2O1PA 3UQ0A 7ICHA 9ICGA 3ISDA 3OVAA 5J29A 3UPQA 4RQ1A 4NM2A 3JPSA 7ICSA 9ICIA 9ICOA 4YCXA 4QZ9A 1ZQJA 4IQUA 4DO9A 3HIYA 5DB6A 1JMSA 5J2HA 2ZH4A 1XSNA 4I29A 2DRBA 8ICVA 3LQCB 4QZHA 2BPGA 4WC1A 2FMSA 8ICWA 4RPZA 5CHGA 5DDYA 4M9JA 5CWRA 4NY8A 5J2EA 2Q66A 4M47A 3LK9A 5HRIA 1ZQLA 4I2IA 3PNCA 2ID1A 2DR7A 4KLSA 1ZQSA 2ZHBA 5DB7A 3H3AA 1ZQOA 5HRGA 3OVSA 3RH6A 4KLJA 1ZQWA 1TV9A 4WC5A 2BCRA 3UQ2A 4I2BA 4F5OA 4IQWA 4FHPA 5J0QA 4XQ8A 4YN4A 4K4HA 1MIWA 3PMLA 5D49A 3TFSA 4X5VA 4KLMA 1JN3A 4FO6A 8ICUA 4X4TA 1R8CA 3WFQE
chains in the Genus database with same CATH superfamily
1SESA 1MQ3A 3RYHA 4MKPA 2LO1A 4X65O 1DK1A 1FD9A 3N27A 2XNDG 1N33B 4DOCA 2F66C 4TOIA 4PGYA 4EP7A 1AR1B 4O4HB 5CBFA 2XAJA 4O4IB 1E1RG 4I2GA 3ISCA 2ZH1A 1YF2A 2H8PC 1ZL8A 4R65A 4NLNA 1Z2GA 2Y69B 4RWNA 1FS0G 1KMIZ 2ZQMA 4NLKA 4BIZA 5J2GA 4KP4A 4K3AA 4FM0A 1W0JG 1UETA 4LEVA 4ATBB 5CA1A 2CGOA 5KHKA 4RPYA 5KA6A 3CD6V 4LF6O 3AK3A 5D63A 2GTAA 4UCVA 5BOMA 1H8EG 4UV9A 3FAVB 3LDCA 3MHHC 4X62B 3ETQA 4QE7A 2Y0IA 3BAAA 5H9CA 1AROP 3W7WA 4K9AA 3OEHG 3SJAC 2HP8A 2ZXWC 4O6AA 3CHXA 9ICLA 1BCCH 3OTFA 3CRAA 3ZRXA 4ASUG 4OX9O 5LP6B 1WNSA 1BPXA 1F7YA 2YC0A 1PNKA 1WLEA 2P4KA 4OGQB 2A9HA 8ICJA 1XMQO 4QZIA 5DBCA 4PA3A 4GLXA 4WC0A 2XOKG 4U3JB 4R8CA 5IYZA 1ZJMA 2EILC 2QKAA 1I0HA 4EKWA 4CZZA 3RJIA 2WPDG 5GTIZ 1FA0A 1FFTB 2YS8A 1V55B 5EBMC 5BOLA 3DSQA 4EGWA 1GM9A 2OTLV 5EIBD 4X66O 1MZFA 3FB8C 5D5PA 1Z5VA 1MIYA 4KLIA 1HW7A 1VF7A 5J2JA 1VJ7A 5IIIA 4PJ0Z 5B1BB 3H01A 1EBOA 4LF7O 1HUZA 4O4LB 4H0LB 2AGAA 2E3CA 2XUMA 4NXXA 8ICEA 2DJVA 3AQMA 4DUZO 4EB6A 3ABKC 4FZ1A 1FXKB 3TGUH 1TVAA 5BR8B 1M4UA 2DW4A 2QM8A 3K79A 2VWJA 7ICFA 3E89A 3K58A 4MTGA 1UFIA 1OHHG 3D36A 1JX9A 5HFMA 4RT2A 2P6JA 3A0HZ 1V55C 3LNMB 1SQXH 4FFKA 1IBLB 1SQBH 3IJ4A 2EINC 1MSWD 2F4VB 4QGPA 3K57A 4LWSA 2HEPA 2M2TA 5TZVA 3NYBA 4X88A 5EYPA 9ICPA 4I55B 1S3JA 4UUJC 2ZH3A 2JDIG 3JD4A 5B1BC 4NKUA 3CCRV 4TV9B 4O5KA 5FNVA 2ZD9A 5H2FZ 2NNUA 2JVDA 2WSSG 1SRYA 5L3EA 3JD1A 4CC5A 3J80N 2KG7B 1H2NA 5KAIZ 1BPDA 3FB6C 1NT2B 2RMKB 4JV5B 3N2KB 3SYCA 4Z6FA 3RYIB 3FYEB 1K34A 4YJ3B 2CH7B 4B7EA 2E5LB 3RVYA 3WB2A 2OCCC 3FYIB 3LSUA 4I9QA 5DECA 2FTKA 3GWKC 5B5EZ 4I0XB 2Q7EA 4UV8A 4B3MO 3JPOA 4X1YB 1AILA 1US6A 2DYRB 5HRKA 2GDSA 5CFSA 4J11A 4I2CA 3UO2A 3ZCCA 3JCZA 9ICWA 3GDXA 2BCCH 3RJJA 1KU9A 3LDDA 4M5DA 4KLDA 1ORQC 1XL4A 3SPIA 3C5FA 1JOYA 2BBJA 1IBKO 4IYHA 8ICLA 4IHJA 5KMGA 3V72A 3AG3C 3RFRA 2AXTZ 3QVNA 4QPKA 8ICFA 4LFAO 1J5EO 3CP1A 4PV1B 2B5UA 1GN2A 3ZMTA 1B06A 2VS0A 4B3RB 3C3TA 4FH5A 1NTKH 4AT8B 4LF5O 1K9MW 1TVKB 3ZMSA 9ICQA 1I08A 5L3DA 2OIEA 3SJQC 4K0KB 4JI0O 4UXNA 5EC1C 4FO1A 5D5QA 2QSAA 4PGXA 4X4VA 1MOFA 1K3EA 3DGEA 3W7SA 3CB2A 9ICFA 1NVPB 3ABTA 1HR0O 4DV3B 3JAMN 2Q7HA 5LGNA 4WFEA 1IDSA 1WAZA 3AQKA 4R50A 1MA1A 1TA8A 4MTXA 3BHPA 4IQTA 4NB5A 5B3QA 4MW8A 2QM7A 3N2GB 2CTPA 3HKCB 1K7DA 1FJGO 5LP6A 5LGUA 4LEYA 4M9GA 1VQMV 1H8HG 3L73H 3CWBH 1FXHA 4FM1A 3SYOA 4DK1A 4JI5O 4U3JA 1O9GA 1S72V 1ZQNA 3NR7A 2WWWA 1AB3A 5D62A 4S3NA 4EEBA 3RJHA 4H44B 2LJ2A 4YMNA 9ICJA 7ICQA 9ICVA 2IM9A 2Q73A 1JFFB 2EZOA 1MQ2A 4XDJA 1GH6A 1ZQDA 4IG8A 4I2JA 4QZEA 4X4QA 4IGGA 1ZQMA 2DYSB 4FLXA 4XDKA 3RGBA 1PV0A 1KKDA 8ICMA 4DR2O 4CH4A 2EJ7A 4Q6GA 5B3SB 5LBQA 1Y74B 1SQGA 2DE0X 4X64B 4QE9A 3JAWB 4GX0A 4E80A 4XRHA 1M57B 2PI4A 4O4LA 3ZRSA 1RPOA 4X9QA 5IJ9A 2VQEB 3X2QC 4PELA 2ZIOA 5C93A 7ICMA 1MABG 2QWOB 4X0AA 4DR7B 3CRCA 1YIJV 2UXCB 3IFXA 4H13B 5K1PA 4DK0A 4CC6A 3CSXA 4DV4O 2DYSC 2ZE5A 3F5TA 1S76D 1YEWA 1K5SA 1H2GA 2MW2B 4Q20A 1AJPA 4I2AA 1KD1W 1NI8A 3NWIA 3JSNA 4WBYA 2JGUA 4AT9B 4WOYA 1OCRC 1KB9F 9ICMA 1M57C 1Q86W 4GX2A 5JQGB 1GPJA 4RQ4A 4DR3B 4P4PA 2KG7A 4UCUA 4W4KA 1AI7A 1JR9A 1U97A 4D7TA 4OAGA 2Q6AA 3ASOB 4K99A 3K03A 3MDAA 3LSQA 2CH7A 2ATKC 1NO5A 1K33A 2QWQB 5B66Z 3WFSC 4WF9V 1F4NA 1V54C 7ICTA 2GSMB 1GMGA 3AK1A 1TUBA 1NR7A 1S0VA 5C8YB 4TUQA 9ICGA 5JWPA 3P30A 2ARHA 3LSSA 4O2AB 4HAMA 7ICSA 2B9ZA 1HP8A 9ICOA 4NXNO 4DRXB 1F51A 4QZ9A 2NN4A 3ASOC 8ICVA 3WG7C 2Q68A 2DRBA 4TUYA 3BVOA 4WC1A 2FMSA 3W7UA 2G38A 2N04A 4FM2A 3J7AU 3G6BA 3NXSA 1W59A 3JATA 1TAEA 3B77A 3A0BZ 4MVMA 2WLKA 2AZ0A 1OCCC 5L3FA 1B6QA 3SYAA 2DR7A 4AQYO 2IH1C 4JTCB 3HPLC 3TK1A 1TVKA 2CTQA 5L3CA 1AP5A 3C3SA 3CXHF 4B3MB 4DR6B 3CCSV 5LHHA 1J95A 4I7ZB 1XMOO 3OVSA 2YIBD 3JARB 3RH6A 3E8BA 2F95B 2P90A 1TV9A 4LFBO 2GTSA 1SKVA 2N74A 5CMUA 1Q8IA 1PNLA 4Z2WA 2EX3A 4F5OA 4FHPA 3VOUA 5J0QA 1MIWA 1QLEB 3TFSA 5H6QA 4X5VA 4KLMA 4FO6A 2F1MA 3RWRD 4X4TA 5KX5B 2P22C 1TUEB 3H39A 4X4RA 1KP3A 8ICZA 3JD0A 4TV8A 3AQNA 3VQWA 2LW7A 7ICRA 2IJJA 4BR6A 3HKCA 3PN1A 1BHAA 4RQFA 3JD2A 5DM6V 4QZFA 1Y4MA 2HJDA 2EZPA 2JK5C 3EF2A 4BIUA 4TURA 4LF5B 2QTOA 1L1FA 4MFFA 1Z5WA 1Y76B 5IY5C 4U3FH 1TGOA 3E22B 7ICEA 2X6CA 3CCEV 1VQ9V 4K98A 4NXWA 3RJFA 1JFFA 2CE4A 2YSUB 5JH7A 3CRMA 1PL0A 3B8NA 4PGQA 4FLWA 4O67A 5CHEA 4FLUA 4C7UA 4UB6Z 4JI6B 1L8DA 3O65A 1VQ4V 4O5EA 2UXDB 4M04A 1ZX3A 3JPNA 4I9WA 3ZRVA 1BPEA 3EXAA 4OXSA 4L8JA 4DOAA 2EIKB 2UXNA 2FMLA 4O9MA 2FMPA 2ETNA 4DV5O 3VBBA 4GKJO 3JPPA 1F5AA 1OCOB 3S3WA 3TCUA 3AG4B 5EIBC 5L3GA 3T4DA 1DLBA 4MF8A 4KFMA 4DYLA 1XNRB 4LH6A 4Z1MG 3APOA 1UJWB 1F4MA 3K06A 4FK5C 5EYPB 4DXWA 4AT9A 5LL6Y 2HFEC 2UU9O 1R3IC 2DVIA 1AVMA 4XQ7A 3MD0A 1P49A 1URFA 2EIKC 5LMUB 4DV7B 5FNVB 3R66A 4KHPO 5BMVB 4WC7A 1BPYA 1ZQCA 5J0OA 1PP9H 4TQFA 5EK0A 3AG4C 3IAYA 2B1IA 4I2FA 2P06A 1ZAUA 4KLTA 4GT1A 5KLVH 4RUFA 1R6KA 2UUAO 3T1HO 3RJGA 3PJSK 1H2MA 2X6AA 1I94B 4J10A 2NRKA 1AJQA 4P9PA 4DV4B 2YIDA 1N34B 3CE2A 1GM7A 1DGSA 3ZBHA 2WAMA 4FHWA 4NKTA 3DC6A 2HN1A 3ETGA 4PDLA 2EBOA 2M2VA 2QDOA 3F7VC 2CTRA 1S5JA 5FPOA 3VQXA 3LUTB 1Q81W 4MVRA 4MVOA 4RQ0A 4DRXA 4PH5A 4XJEA 5BPCA 4B3TO 2DR8A 4JI4O 4D7SA 4JLZA 2IJKA 2VQFO 5CB1A 4XUSA 1ZJNA 9ICKA 1NQTA 3QO7A 1ZQEA 1HDJA 4XA5A 4DR1B 4RQ5A 1B04A 1FAFA 4IHJB 5J2FA 3OUFA 2OCHA 1I7FA 2V1DA 1M9NA 3DXRB 5KMGB 5EC2C 2V7QG 3HWTA 4MVUA 3K9SA 4CH3A 4LF4O 4TUSA 4CS2A 3H1IH 1TFWA 3PHZA 1CXZB 4K8XA 5DBAA 1WJZA 1WA8A 2ILMA 2ZXWB 4G28B 4FPPA 2QWRB 5KHHA 5DDMA 1BL8A 4DO2A 1N32B 4JAUA 2BOBC 1XBLA 3OMAB 3JARA 1GKFA 3F5WC 4M2YA 3ERCC 3C90A 3T1CA 1VF5B 3TXQA 1N36B 4RWUA 4EBKA 4MFCA 2EILB 1DF5A 3B40A 3SJBC 5J0PA 1XQ8A 2UXBO 3UPSA 3GVMA 4UAWA 5KX5A 4O5CA 8ICRA 3DTUB 1QCEA 2QE7G 2VANA 2V4DA 2R9RB 8ICGA 3CC7V 3T1YO 1PL4A 1UPGA 4PA6A 4FMTA 2HHHB 2ZKOA 4DV2B 4J7KA 4DUYO 1GM8A 2W0FC 1MIVA 4Z6CA 1Y76A 4WC4A 5DN6G 3ABKB 2AZ2A 2KKWA 3D3IA 3KZIZ 3E22A 3L72H 3O9OA 3MCRA 1Q7YW 2DQ0A 1ZQAA 3U11A 1GN4A 1VQKV 1R3KC 5J0SA 9ICCA 4WFGA 1TFYA 4YD2A 3JPQA 3RW0A 1I5XA 3ZN1A 1X59A 2UUBO 3WFVA 4DR4B 7ICUA 5J0YA 5HRHA 1QQCA 2OYQA 1IZ3A 4DW0A 1HUOA 2EINB 4QZAA 2H94A 1UEUA 2D2CB 1ZQRA 3U0ZA 3OVBA 4KXRA 3D3QA 3L71H 5J9PC 2A3QA 1Q6UA 1ENVA 1ZQIA 4NKGB 3OEEG 2JJ1G 1L0NH 2QTSA 4J41A 5IJ9B 1HNXB 4P9OA 2OIGA 2Z5UA 3MAQA 3WFPA 4WFHA 5J0TA 2DQ3A 1NU1H 3V7JA 2ZDIC 1S5LZ 4WC3A 3QNEA 3CC4V 4K9BA 3IGAC 4ZOLA 5CN0A 2OCCB 2IHMA 1AR4A 5BXZA 1AI5A 1YJ9V 1F23A 4JYAO 4UB1A 3CMEV 4JI3B 3SPJA 4NXMO 3AG2C 3T2MA 2M7WA 3A8TA 8ICKA 1VQPV 3OTOB 4FH3A 4FIPC 2RQ6A 5BMVA 4ZBMA 2E74B 3B0YA 4Z6DA 5EBWC 4FHXA 4ABMA 3ABLC 4JI8B 4EEQA 2VWKA 4DV5B 3CC2V 1Y6XA 5DBBA 1YSCA 3JCUZ 4GKJB 2P7TC 4U7OA 3A2FA 1NH2D 4F4LA 3AG3B 3K04A 3UXPA 3MGIA 4UBBA 4H33A 1D2DA 4I2EA 3QO8A 1IURA 2GA9D 3CCQV 3AQLA 3H1KH 1TUBB 2LFSA 3AG7A 4GUNA 1IXBA 3AK2A 4B3SO 3W7XA 8ICQA 2XAFA 1IX9A 4JI7O 2IBZH 3ML0A 2DR9A 1KKCA 1RPRA 1ZQQA 2XAQA 2EJRA 1XILA 1KECA 1KQSU 2PFNA 2F43G 1BQZA 2IU0A 4TUYB 2ZM6O 2JGDA 3JALB 3OGIB 4X89A 1RZTA 3RN4A 4WBNB 4J7ZA 4FFBA 2P67A 3STZC 4I2DA 4X4SA 4PDRA 1FPOA 3DXRA 1VARA 4F6EA 2AW9A 1FFXA 3AU2A 3P32A 3APQA 3JATB 4LC1A 2EIMC 2QKCA 3BFRA 1NR1A 1RM1B 4AI8A 3F7YC 2WLJA 4DW1A 5LGTA 4I50A 1R1BA 2Q0AA 5J0RA 5J0XA 1XNQB 4MTOA 3TETA 2X6BA 5IWAO 1S77D 4PHEA 1WP7A 4AT7A 4LR3A 5LA6B 5CBGA 4NYKA 5JVDB 4LBEC 5EZYB 3K5NA 4FHYA 2EIJC 5K1XA 3ABMC 1QVGU 4X65B 3OVAA 3E35A 5A2QN 5J29A 3UPQA 1YJWV 4RQ1A 1MNGA 3CS5A 4WFBV 2Q8VA 3JPSA 5LYJB 3QO5A 1RM1C 3CCJV 4DO9A 3HIYA 5DB6A 4TV8B 1XSNA 1EZJA 1MSDA 5HFLA 3LQCB 4I4TB 1GK9A 3VQYA 1QNMA 3ZRWB 5DDYA 4M9JA 4MS2A 2K1EA 2RCVA 3OR6C 4AHCA 2BSKB 5KHJA 3BCCH 5J2EA 4ZIBA 4OAFA 2WLHA 1H2SB 4OAIZ 5HRIA 2IHOA 3CCVV 4FVMA 1K4CC 4FLTA 4NTWA 3CCMV 4ICGA 3FB7C 1AI6A 3X2QB 5DB7A 5B1NA 2GBOA 3GB7C 5HRGA 1Q82W 3BRCA 3UQ8A 2ZDIA 4LF6B 1BS3A 5JH7B 4WC5A 2IU3A 4LP8A 2NR5A 4J80A 1E1QG 1QVFU 2ADPA 4IQWA 3K5MA 3G80A 2A79B 1WPXA 4K4HA 3K5LA 3PMLA 4H37A 5KAFZ 5D49A 4OX9B 1KNYA 2L6LA 1OCRB 4G2KA 4O2BB 2QWPB 2QKSA 4MFAA 3HB3B 5GTHZ 5J2DA 4PDVA 2I9GA 1XMQB 2O5AA 1ZQKA 1PM9A 5CFTA 3ZHUA 8ICAA 3K7DA 4DV0O 4QZGA 3C5GA 1LNQA 4J9ZB 3L75H 4LF9O 4UB4A 3ZIAG 5KHIA 3TFRA 1N8RW 3AUOA 2YEVB 3JZ0A 3BY6A 4MVSA 2WLNA 1XHXA 1YZBA 2QA4V 3ICXA 1XDCA 4LCUC 4DV6O 4FLYA 2UUBB 4YY3O 1V54B 8ICBA 4QZCA 1PKXA 4K97A 2ZH9A 4MF2A 3C66A 4NXZA 1P4RA 1SERA 4X66B 4WCEV 1HNZO 9ICUA 1Q79A 4O68A 8ICOA 3KG2A 1SZTA 1QR8A 4UB8Z 1SQQH 4KL1A 4OPHA 3HW8A 4BW5A 4KLGA 4WQKA 4JI1O 4LF7B 4GX1A 3WG7B 3OMNB 4DUZB 3WFOA 4HX0A 2RNBA 3BEHA 1RFYA 4E7XA 3OD4A 5LMNO 1ROPA 1XL6A 8ICXA 3NVOA 4RWOA 5HC9A 4FLVA 3D8CA 1OCCB 2CDYA 2JS5A 4O4JA 5ITZA 3G6EV 2UUCO 4RQ7A 2PFOA 1CPYA 2HVJC 1N33O 4KLLA 2DMXA 3B09A 1Q43A 4YMMA 4NVPA 1VP7A 2KQXA 3PMNA 1BPBA 3SGIA 4JWNA 4J7JA 1ZQHA 3ZX6A 4E2LA 3ER8C 3JALA 2BPCA 1R6NA 4WBNA 2WLLA 3CRRA 1XSLA 5A9GA 3ZHRA 9ICXA 3J81N 1R73A 5GW7A 2DN9A 2ZNIA 4P2ZA 3RBZA 2ZR2A 5DEDA 5HR9A 4OPAA 1FYJA 3L9DA 2BTQB 5B1AC 5D46A 1OZ0A 2EULA 1WA8B 2GWSA 5HHHA 4M9LA 1E79G 1VFGA 2DR5A 4I5SA 4B3SB 5LA6A 3M99B 3ER9B 5JVDA 1OJHA 5EZYA 3SDLA 5IY5B 1JCHA 3HR0A 4YXWG 1COWG 2ADQB 1WN7A 5CJ7A 4K4GA 4Z1VA 7ICJA 2PY5A 5LYJA 1IBKB 4UBCA 4HNAB 3ZMUA 5DKWA 4HBNA 4X4NA 1XEQA 1EM1A 4UAZA 3HKDA 2JIZG 8ICPA 4LFAB 4I4TA 1J5EB 2RJZA 3MDCA 4RQ2A 3ZRWA 2ZT9B 4NTXA 1M93A 2B1GA 2YXYA 1ZQGA 2BSKA 4DV1O 4JYBA 5IILA 1EFRG 3ZHTA 2XAGA 2CTWA 4M9HA 4JZ2A 2RN9A 4X1KB 1NVPD 5J2TB 5FLXN 1ZQXA 1AP6A 4JI0B 5DB8A 4BWAA 4WCWA 2PXIA 4NR1A 1RSOB 1R8BA 4CS3A 4X1IB 3ZEDA 5L3BA 2Y4UA 1HR0B 3ZJZA 3UCSC 5KHGA 1XHZA 4M0AA 1Q6HA 1VQOV 5BR8O 3MGHA 2FL4A 2HVKC 2ISPA 4HZ3A 3BA9A 3K9AA 4PHPA 4GZRB 1UEVA 1QR9A 2F93B 1R8AA 2BCVA 2P66A 4RWPA 1FJGB 1Q3EA 4FLZA 4O2BA 1R3LC 2UXXA 4N21A 5DB9A 2CK3G 1ZQZA 1IBLO 3AG1C 1OV9A 4D6TH 2XHBA 2F4VO 3ABUA 4JI5B 1GAXA 2O57A 4E4EA 2HHPA 4UCSA 2W9MA 4QZDA 1M90W 5IYBO 1P84F 4JASA 4X20A 3B2EE 4K8VA 2DRAA 5J2UB 1WB7A 2IW5A 2YEVA 3CX5F 2PTMA 4ZOLB 4GKKO 1KYOF 2IH3C 2B4VA 2ZIMA 4JV5O 4CH5A 4RWQA 1NKDA 1JA8A 4DR2B 4JTDB 4MSWC 4IL6Z 1AR5A 2E5LO 3RT3C 2Z3YA 5CR0A 1SZXA 1K92A 1ZTEA 1SC5B 8ICIA 2YXHA 5KUKA 2ITCC 4RAIA 3QF7A 5EOZA 1L0LH 1HNWO 4BW9A 4EBJA 4MVQA 3E8HA 4X0BA 4DV0B 1LUVA 4JI2O 2ITDC 4CS4A 1JJ2U 5CBHA 2YI9A 4UCOA 4UB5A 2JS3A 2E76B 4QJFB 2GAFD 5HRDA 2WA4A 3KCYA 3RJKA 5CA3A 4UAYA 7ICPA 3ZHQA 4WFAV 2Q0OC 3HKBA 2CGNA 2R70A 4GXKA 3UKMA 1G6UA 5IYCO 3JD3A 3JCFA 1Q90D 3UM7A 2JGDB 4RQ3A 4I2HA 2YXLA 1KEJA 4GXJA 4GXIA 1NJIW 4FFBB 4K8ZA 4NXTA 4YMOA 1BSMA 4UFZA 3C2KA 7ICIA 2W0XA 3KKYA 4NLZA 2WLIA 4F6RB 2R72A 2WLMA 1FFXB 4K0KO 3R65A 1OCZC 4FZ0A 3OM3B 4XDLA 2BTQA 8ICTA 1JQRA 5J2KA 1GN6A 4I50B 4JAVA 3E8GA 2D3OW 2P5OA 1DF4A 1JPXA 5B3PA 2IUBA 4DV3O 2K9PA 3WFRE 2DWEC 4X4UA 2UUCB 2GHYA 2BCSA 3FB5C 4LEWA 4AT7B 3EHBB 1FXVA 1BZKA 2PGGA 3G67A 1YITV 1YJNV 1KBHA 3JASB 1EN6A 1VMGA 8ICHA 4NXNB 3ASNB 4ZHQA 4QZBA 5J2AA 4P2HA 4WBZA 3OWGA 1SA0A 2OWOA 2A06H 2FKXA 1IXMA 3G4SV 1BT8A 4HNAA 5LOVB 1YDXA 5KUMA 4UCRA 1NTMH 5J2IA 3UXNA 1YVWA 1R3JC 4I0UA 4LNUA 1ZQBA 1NZ6A 4UB2A 4DOBA 1D5NA 4X4OA 1Q78A 3LNNA 4UB3A 4QIWF 4AQYB 5IJ0A 4L87A 4LF8O 1CP9A 3RH5A 1NOMA 3HJ4A 1JAJA 3AU6A 1XMOB 4X1KA 2LP7A 2DWDC 4EFBA 5J2TA 3ASNC 2OTJV 4PHDA 4NM1A 7ICOA 3I56V 2F23A 4LFBB 1A32A 2BBHA 1RSOA 2Y69C 4X1IA 4N7RA 2XASA 7ICVA 2L35A 1MMMA 4X64O 1VQ8V 3JYYA 4WFFA 1V4AA 3UT5B 4MW3A 1S5HC 7ICNA 3FD9A 1ZQYA 2VQEO 5JJNB 3UQ0A 7ICHA 3SPHA 2FCLA 3DC5A 3ETDA 5JCOC 3ISDA 3ZHSA 1AJNA 1G4YB 3K59A 4NM2A 2PI5A 3AG2B 4DR7O 4YCXA 2UXCO 1G1XB 2W6JG 3K0GA 4DV1B 1JMSA 1K73W 4I29A 1NS1A 4QZHA 2HG5C 3JSLA 8ICWA 2BTOA 3TJTA 5JTGA 4EV6A 5CWRA 4IT5A 1T5EA 2GUZB 2LGWA 3ABLB 1N0NA 1W2BU 3VQVA 4IIJB 4ZI7A 2Q66A 3CCLV 5LP6C 1MZEA 1ZQLA 1IVSA 5J2UA 3CJHB 4I2IA 2ID1A 4DR3O 1YXBA 5AG2A 4MT8A 5CFUA 3UO3A 2ZHBA 1GTOA 1H2KA 3H9VA 2HR3A 3H3AA 1K97A 2PF4E 4J9YB 1YI2V 3FKSG 5GONA 4KLJA 1X4TA 1ZQWA 4TQDA 1WP8A 1H38A 1XI1A 4I2BA 2DOSA 3OAAG 4QPJA 4RQEA 4TWKA 3ZMVA 3IC9A 3THOA 4XQ8A 4YN4A 3FX7A 2LFRA 1LUWA 1JN3A 4KM5A 8ICUA 4FHVA 1JMKC 1SETA 1HWYA 2BPFA 4LH7A 3WU2Z 3ETEA 2PYJA 3K0DA 5IIJA 3L74H 4PI0A 1M1KW 5D4BA 2Q7GA 4QZ8A 5IIMA 5BY1A 4YD1A 1P7BA 1JVMA 1ZQTA 3U10A 2EIMB 2BCUA 3OUYB 4GKKB 1FXKC 2HKOA 4M9NA 8ICYA 4X4PA 4O4JB 4PHAA 2B51A 1VQNV 3HKEA 3P3PA 1QHTA 5ITZB 4UVBA 4LFCO 4J42A 4DR5O 3RYFA 2ZH7A 1H2LA 1BHBA 2UU9B 2Y48A 3KCXA 1OU5A 1GO3F 4RO2A 4BIOA 4KHPB 1WB8A 1VQ7V 4LZDA 5J2BA 2EIJB 4R7CA 1ZSPA 2BE3A 5HRLA 1BGYH 4R63A 3MBYA 3ABMB 3G71V 3CMAV 4GYCB 1KC8W 2WLLB 2ZINA 3SR2C 4DR6O 4LZGA 1HNWB 4F6RA 3BABA 1PPJH 2HN2A 2Q69A 3K3WA 3OV7A 4JI2B 1N0JA 9ICNA 3C2MA 2UUAB 3T1HB 1G8MA 3H37A 3M7MX 4CBCA 4QNHB 4KLQA 4XBFA 2RFFA 3MDSA 1EN5A 5D61A 4PA9A 4GX5A 4O4HA 1PNMA 2W6IG 3EFFK 3K5OA 4IYIA 3JASA 4JZGA 3CXCU 1EZVH 4O4IA 2M2WA 1BE3H 4B3TB 5H6RA 3ZS8C 4JI4B 4EFEA 2ZH5A 2VQFB 4P4MA 4LT6A 2DYRC 4YHHO 2Q5ZA 4F5NA 3AEIA 5LOVA 1CEZA 2ZE6A 4K4IA 4GCZA 1O9HA 4F5QA 3HKDB 4N23A 4ATBA 5IYDO 4LF4B 5JCOA 4KLHA 2XT9A 3OFNG 2ISOA 2M2UA 1M56B 4MVZA 5FL7G 1RPLA 3OMIB 4A5UB 3FAVA 5B1OA 1ZWIC 3ZHVA 1ZQPA 4TT3G 5HRFA 2PFPA 3H1HH 4B7KA 4JI6O 3OGUA 2UXDO 1YHQV 2Y0PA 1XOUA 3UT5A 1NTZH 3SYPA 5CA7A 7ICGA 4UD5A 2CUGA 2X7RB 1I5YA 3B8MA 2UXBB 4RQ6A 2FMQA 2YI8A 5HHIA 3STLC 4RT3A 2QJ1A 9ICRA 1K8AW 3OUSA 1XSPA 4JF3A 1IBMO 1M56C 2FB5A 3T1YB 1PD3A 4F5PA 2OT5A 4RUEA 4TUPA 1ZQVA 5J0WA 5LXTB 1VEWA 1YCIA 5LHGA 3CCUV 1VQ5V 4RPXA 3LDEA 2YDEA 4DUYB 1SQPH 4LF8B 4RQ8A 1Q5OA 1SQVH 3A0RA 4TSFG 4HYOA 5BZBA 1XNRO 4WH5A 4R66A 3V7KA 2GUZA 1YTFB 7ICLA 1PX5A 9ICEA 2PFQA 3SYQA 4NTYA 3JAKB 4IIJA 2MK3A 4X20B 4YIOA 5LMUO 3CJHA 4DV7O 1WPBA 3BA8A 2QM4A 4PI2A 4WC2A 8ICSA 2ODMA 9ICTA 4F5RA 4P4OA 3SPCA 2A7WA 4EEDA 1FXKA 1K5QA 2ZH8A 5IDJA 1DTOA 1MG1A 3I5DA 4PDMA 3GWOA 1I94O 5J0UA 2ZE8A 5CB4B 4PPXA 5IIOA 3S3XA 1N34O 5JJJB 4YJ2B 4JWMA 4W4LA 1ZQUA 3JYCA 4K35A 5B3SC 2Q67A 4I55A 2R9IA 1ZQFA 4KLFA 1U96A 4PHZA 5KA5A 3E83A 2N05A 4TV9A 2JEUA 1V9PA 3OUYA 2ZCEA 1LR1A 5B1AB 1WOTA 3E8FA 5CA0B 1FKAO 2NLJC 4DR1O 3JPTA 3N2KA 1SS3A 4JYAB 3RYIA 2IJHA 1GRJA 4CH6A 4NXMB 4WC6A 4YJ3A 1JJOA 5HRBA 3NKUA 3Q4HB 3RYCB 2EWRA 3HKBB 5IIKA 2A0LA 1R89A 2PZSA 1VF6C 2CAZC 4I0XA 4KLEA 9ICAA 1N32O 1Y67A 3B4SA 4X1YA 3QG5A 4ZKIA 2KB1A 1W0KG 2WLIB 4JYCA 3E2EA 3SJCC 4LEZA 4IQVA 5HREA 1N36O 1YLQA 1P7GA 3RYHB 2YIBA 4MTFA 5IINA 3ZMZA 3CK6A 3RH4A 1BPZA 4X62O 1NBMG 1VQ6V 1D5AA 1QU7A 3M8AA 2Q4PA 4LFCB 3C2LA 4UVAA 4DR5B 4JI7B 2VRZA 4WQLA 4ZHQB 3V7LA 3L70H 2KSDA 3MHSC 2HHHO 3RJEA 3H38A 4DV2O 1SA0B 1ZL8B 4AT8A 2ZM6B 9ICBA 2Q9LA 3P3NA 3CEIA 2PBEA 4OAHA 1ZLZA 4I27A 3W7TA 1VIBA 3UXOA 3OE7G 1R6TA 8ICCA 4R64A 4LNUB 2ZH6A 5CA1B 1KDHA 2HLDG 2HJFC 4KLUA 4KUMA 5J2CA 5E79Z 5IJ0B 4DR4O 3E86A 5IWAB 5IE9A 1GN3A 3AG1B 4JLXA 3ISBA 2LQTA 5EBLC 2ZNJA 4NXVA 3ZN0A 5LHIA 3N2GA 4JAAA 1RP3B 1ZUQA 9ICSA 2ZHAA 3SPGA 3H1LH 2IJIA 1BMFG 3OR7C 4UCTA 2QR4A 3K75D 4PD4F 1M5IA 4YHHB 4I28A 1HNXO 4U7NA 3BPZA 5IYZB 4BAYA 4LVSA 1Q6IA 3T4ZA 1QLNA 3OT7A 2M6YA 2QWNB 1QLEC 2QEXV 5LXTA 5TISZ 4KLOA 2C2AA 2AHYA 3WB0A 3HX0A 4E8FA 4JI3O 1B3QA 3C18A 3FFQA 3JAKA 2LW1A 4JPRA 2FYUH 4ZI7B 5CP2A 3OTOO 4UD4A 3TXSA 1Y74A 2JRIA 1SQFA 9ICHA 2PYLA 4K96A 3JPRA 4NXUA 1XUQA 3JAWA 2PUSA 3HJ1A 2R9AA 7ICKA 1JQ0A 4JTAB 4PA7A 1BQ0A 4JI8O 2JJ2G 1QBZA 2YIAA 4P30A 4EB6B 3RVZA 2BCQA 2QGNA 3CRQA 5GONB 3B0XA 8ICNA 1IBMB 4KB6A 4YIPA 4AILC 4Z6EA 4PA4A 5F2VO 2ZH2A 2O1PA 1YTFD 2JEXA 4B08A 5CB4A 4O69A 4R6ZA 1N4CA 3EVKA 4YJ2A 1VF6A 2H3OA 5IT9N 2AHZA 1NH2B 5E1AC 3CYOA 9ICIA 3K08A 4LWSB 1ZQJA 4IQUA 2BOCC 5J2HA 2ZH4A 2YICA 1AI4A 2BPGA 1KUQA 4LF9B 4UVCA 3IC7A 4RPZA 5CHGA 5JJEB 2Z0AA 2RDCA 5JQGA 1OCZB 4G27B 1K4DC 4JGSA 4JYYA 2GV9A 2YUAA 4NY8A 5CA0A 3OW2U 3CPWU 4DV6B 4M47A 4YY3B 2P4VA 3LK9A 3HKEB 1OCOC 1VQLV 1THZA 1Y66A 3I55V 2WA3A 2X0LA 3PNCA 3H1JH 4X8AA 2B56A 4KLSA 3RYFB 3D36C 3WB1A 2ZE7A 3Q4HA 3RYCA 1HNZB 1ZQSA 1SF9A 2XTAA 2Y4TA 1ZQOA 4B3RO 5H5NA 3QTCA 4JI1B 1XREA 1KP2A 2BCRA 1XNQO 5C8YA 4FJCC 3UQ2A 5FPRA 2XAHA 2E75B 3OGCC 2ZR3A 2LGQA 4O2AA 5LMNB 1EN4A 1R8CA 3WFQE
chains in the Genus database with same CATH topology
4FHVA 1MQ3A 1KNYA 3H39A 4X4RA 8ICZA 3AQNA 2BPFA 4MFAA 7ICRA 5IIJA 5J2DA 5IIMA 5D4BA 2I9GA 4QZ8A 2O5AA 4QZFA 1ZQKA 4YD1A 4DOCA 1ZQTA 2BCUA 4PGYA 3OUYB 4TURA 4EP7A 8ICAA 4QZGA 3C5GA 4M9NA 8ICYA 4X4PA 4PHAA 4UB4A 4MFFA 4I2GA 3TFRA 3ISCA 2ZH1A 3AUOA 3JZ0A 2ZH7A 4R65A 4NLNA 4RWNA 1OU5A 7ICEA 8ICBA 4QZCA 4NLKA 4MF2A 2ZH9A 3C66A 4NXZA 5J2GA 3RJFA 4LZDA 5J2BA 9ICUA 1Q79A 1UETA 2BE3A 4ATBB 5HRLA 4PGQA 4R63A 3MBYA 8ICOA 4RPYA 4LZGA 3HW8A 4KLGA 5BOMA 3OV7A 4O5EA 9ICNA 3C2MA 3WFOA 4M04A 3JPNA 1BPEA 3H37A 4E7XA 4DOAA 4KLQA 4O9MA 9ICLA 2FMPA 2RFFA 8ICXA 4RWOA 5HC9A 1BPXA 3JPPA 1F5AA 8ICJA 4RQ7A 2PFOA 4QZIA 5DBCA 2M2WA 4WC0A 2ZH5A 4KLLA 4MF8A 4YMMA 1ZJMA 3PMNA 4P4MA 1BPBA 4LT6A 4JWNA 1ZQHA 4F5NA 3RJIA 4K4IA 4F5QA 1FA0A 4AT9A 2BPCA 4ATBA 2DVIA 4XQ7A 1XSLA 4KLHA 9ICXA 5BOLA 2ISOA 2M2UA 5DEDA 1MIYA 4WC7A 1BPYA 1ZQCA 4KLIA 1RPLA 5HR9A 3L9DA 5J0OA 5D46A 5J2JA 1VJ7A 5IIIA 2GWSA 1ZQPA 5HRFA 4I2FA 2PFPA 4KLTA 5HHHA 4M9LA 1HUZA 3OGUA 1VFGA 8ICEA 3AQMA 3RJGA 2DR5A 1TVAA 2NRKA 7ICFA 7ICGA 5CA7A 4UD5A 4RQ6A 2FMQA 4RT2A 5HHIA 4FHWA 4NKTA 4RT3A 9ICRA 2M2VA 5CJ7A 4K4GA 1XSPA 7ICJA 4RQ0A 4PH5A 4F5PA 4UBCA 5BPCA 4TUPA 1ZQVA 5J0WA 2DR8A 2M2TA 5DKWA 3NYBA 5TZVA 4X4NA 9ICPA 4RPXA 4UAZA 2ZH3A 8ICPA 5CB1A 4XUSA 4RQ8A 1ZJNA 9ICKA 4R66A 1ZQEA 4NKUA 4XA5A 3MDCA 4RQ2A 4O5KA 4RQ5A 3V7KA 5J2FA 7ICLA 1PX5A 9ICEA 2PFQA 1ZQGA 3HWTA 5IILA 1BPDA 4TUSA 1TFWA 5DBAA 4M9HA 4Z6FA 4WC2A 5DDMA 8ICSA 1ZQXA 9ICTA 5DB8A 4F5RA 4WCWA 4P4OA 2PXIA 1R8BA 5DECA 2ZH8A 4M2YA 4MFCA 4EBKA 3JPOA 4M0AA 5J0UA 3MGHA 5HRKA 4PPXA 2ISPA 5IIOA 5J0PA 4I2CA 4JWMA 4PHPA 3UPSA 1UEVA 4UAWA 1R8AA 2BCVA 2P66A 4O5CA 8ICRA 4RWPA 1ZQUA 9ICWA 3GDXA 3RJJA 2VANA 4M5DA 5DB9A 4KLDA 1ZQZA 1ZQFA 4KLFA 3C5FA 8ICGA 8ICLA 2HHPA 2W9MA 4QZDA 3OUYA 3V72A 1WOTA 8ICFA 2DRAA 3JPTA 1MIVA 4Z6CA 4FH5A 4WC6A 4WC4A 5HRBA 4AT8B 5IIKA 1ZQAA 1R89A 9ICQA 5J0SA 9ICCA 4RWQA 1TFYA 4KLEA 9ICAA 4YD2A 3JPQA 7ICUA 5J0YA 5HRHA 4PGXA 5CR0A 4X4VA 1HUOA 4QZAA 1UEUA 8ICIA 9ICFA 1ZQRA 4IQVA 3OVBA 5HREA 5EOZA 1YLQA 4EBJA 4X0BA 5IINA 1ZQIA 3AQKA 3RH4A 4IQTA 1BPZA 4UB5A 3C2LA 4M9GA 3WFPA 5J0TA 3V7JA 5HRDA 4WC3A 3V7LA 3RJKA 4UAYA 3RJEA 1ZQNA 7ICPA 3H38A 4AT8A 4S3NA 2IHMA 9ICBA 4GXKA 2PBEA 3RJHA 4I27A 4YMNA 4UB1A 9ICJA 3UXOA 7ICQA 9ICVA 1MQ2A 1ZQDA 8ICKA 4RQ3A 4I2HA 4FH3A 4IG8A 4I2JA 4R64A 8ICCA 4QZEA 1KEJA 2ZH6A 4GXJA 4X4QA 4GXIA 1ZQMA 4YMOA 1KDHA 3C2KA 7ICIA 4NLZA 4KLUA 5J2CA 3B0YA 4Z6DA 8ICMA 4FHXA 1JQRA 8ICTA 5J2KA 5DBBA 3ISBA 4E80A 4XRHA 3WFRE 9ICSA 4X4UA 2ZHAA 3UXPA 2BCSA 3MGIA 4UBBA 4AT7B 4I2EA 7ICMA 3K75D 3AQLA 4X0AA 8ICHA 4I28A 4QZBA 5J2AA 4P2HA 8ICQA 4WBZA 4LVSA 2DR9A 1ZQQA 4I2AA 2PFNA 4KLOA 4WBYA 5J2IA 4AT9B 3UXNA 1RZTA 1ZQBA 9ICMA 3HX0A 4E8FA 4UB2A 4DOBA 4I2DA 4X4SA 4X4OA 1Q78A 3C18A 4UB3A 4RQ4A 4P4PA 3AU2A 5CP2A 4UD4A 3RH5A 1NOMA 3HJ4A 1JAJA 9ICHA 3JPRA 3AU6A 3MDAA 3HJ1A 7ICKA 4PHDA 4NM1A 7ICOA 5J0RA 5J0XA 1NO5A 4PHEA 4AT7A 3WFSC 7ICVA 2BCQA 3JYYA 7ICTA 1V4AA 3B0XA 8ICNA 7ICNA 4Z6EA 5F2VO 1ZQYA 4FHYA 4TUQA 2ZH2A 2O1PA 3UQ0A 7ICHA 9ICGA 3ISDA 3OVAA 5J29A 3UPQA 4RQ1A 4NM2A 3JPSA 7ICSA 9ICIA 9ICOA 4YCXA 4QZ9A 1ZQJA 4IQUA 4DO9A 3HIYA 5DB6A 1JMSA 5J2HA 2ZH4A 1XSNA 4I29A 2DRBA 8ICVA 3LQCB 4QZHA 2BPGA 4WC1A 2FMSA 8ICWA 4RPZA 5CHGA 5DDYA 4M9JA 5CWRA 4NY8A 5J2EA 2Q66A 4M47A 3LK9A 5HRIA 1ZQLA 4I2IA 3PNCA 2ID1A 2DR7A 4KLSA 1ZQSA 2ZHBA 5DB7A 3H3AA 1ZQOA 5HRGA 3OVSA 3RH6A 4KLJA 1ZQWA 1TV9A 4WC5A 2BCRA 3UQ2A 4I2BA 4F5OA 4IQWA 4FHPA 5J0QA 4XQ8A 4YN4A 4K4HA 1MIWA 3PMLA 5D49A 3TFSA 4X5VA 4KLMA 1JN3A 4FO6A 8ICUA 4X4TA 1R8CA 3WFQE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FHV A;  1MQ3 A;  1KNY A;  3H39 A;  4X4R A;  8ICZ A;  3AQN A;  2BPF A;  4MFA A;  7ICR A;  5IIJ A;  5J2D A;  5IIM A;  5D4B A;  2I9G A;  4QZ8 A;  2O5A A;  4QZF A;  1ZQK A;  4YD1 A;  4DOC A;  1ZQT A;  2BCU A;  4PGY A;  3OUY B;  4TUR A;  4EP7 A;  8ICA A;  4QZG A;  3C5G A;  4M9N A;  8ICY A;  4X4P A;  4PHA A;  4UB4 A;  4MFF A;  4I2G A;  3TFR A;  3ISC A;  2ZH1 A;  3AUO A;  3JZ0 A;  2ZH7 A;  4R65 A;  4NLN A;  4RWN A;  1OU5 A;  7ICE A;  8ICB A;  4QZC A;  4NLK A;  4MF2 A;  2ZH9 A;  3C66 A;  4NXZ A;  5J2G A;  3RJF A;  4LZD A;  5J2B A;  9ICU A;  1Q79 A;  1UET A;  2BE3 A;  4ATB B;  5HRL A;  4PGQ A;  4R63 A;  3MBY A;  8ICO A;  4RPY A;  4LZG A;  3HW8 A;  4KLG A;  5BOM A;  3OV7 A;  4O5E A;  9ICN A;  3C2M A;  3WFO A;  4M04 A;  3JPN A;  1BPE A;  3H37 A;  4E7X A;  4DOA A;  4KLQ A;  4O9M A;  9ICL A;  2FMP A;  2RFF A;  8ICX A;  4RWO A;  5HC9 A;  1BPX A;  3JPP A;  1F5A A;  8ICJ A;  4RQ7 A;  2PFO A;  4QZI A;  5DBC A;  2M2W A;  4WC0 A;  2ZH5 A;  4KLL A;  4MF8 A;  4YMM A;  1ZJM A;  3PMN A;  4P4M A;  1BPB A;  4LT6 A;  4JWN A;  1ZQH A;  4F5N A;  3RJI A;  4K4I A;  4F5Q A;  1FA0 A;  4AT9 A;  2BPC A;  4ATB A;  2DVI A;  4XQ7 A;  1XSL A;  4KLH A;  9ICX A;  5BOL A;  2ISO A;  2M2U A;  5DED A;  1MIY A;  4WC7 A;  1BPY A;  1ZQC A;  4KLI A;  1RPL A;  5HR9 A;  3L9D A;  5J0O A;  5D46 A;  5J2J A;  1VJ7 A;  5III A;  2GWS A;  1ZQP A;  5HRF A;  4I2F A;  2PFP A;  4KLT A;  5HHH A;  4M9L A;  1HUZ A;  3OGU A;  1VFG A;  8ICE A;  3AQM A;  3RJG A;  2DR5 A;  1TVA A;  2NRK A;  7ICF A;  7ICG A;  5CA7 A;  4UD5 A;  4RQ6 A;  2FMQ A;  4RT2 A;  5HHI A;  4FHW A;  4NKT A;  4RT3 A;  9ICR A;  2M2V A;  5CJ7 A;  4K4G A;  1XSP A;  7ICJ A;  4RQ0 A;  4PH5 A;  4F5P A;  4UBC A;  5BPC A;  4TUP A;  1ZQV A;  5J0W A;  2DR8 A;  2M2T A;  5DKW A;  3NYB A;  5TZV A;  4X4N A;  9ICP A;  4RPX A;  4UAZ A;  2ZH3 A;  8ICP A;  5CB1 A;  4XUS A;  4RQ8 A;  1ZJN A;  9ICK A;  4R66 A;  1ZQE A;  4NKU A;  4XA5 A;  3MDC A;  4RQ2 A;  4O5K A;  4RQ5 A;  3V7K A;  5J2F A;  7ICL A;  1PX5 A;  9ICE A;  2PFQ A;  1ZQG A;  3HWT A;  5IIL A;  1BPD A;  4TUS A;  1TFW A;  5DBA A;  4M9H A;  4Z6F A;  4WC2 A;  5DDM A;  8ICS A;  1ZQX A;  9ICT A;  5DB8 A;  4F5R A;  4WCW A;  4P4O A;  2PXI A;  1R8B A;  5DEC A;  2ZH8 A;  4M2Y A;  4MFC A;  4EBK A;  3JPO A;  4M0A A;  5J0U A;  3MGH A;  5HRK A;  4PPX A;  2ISP A;  5IIO A;  5J0P A;  4I2C A;  4JWM A;  4PHP A;  3UPS A;  1UEV A;  4UAW A;  1R8A A;  2BCV A;  2P66 A;  4O5C A;  8ICR A;  4RWP A;  1ZQU A;  9ICW A;  3GDX A;  3RJJ A;  2VAN A;  4M5D A;  5DB9 A;  4KLD A;  1ZQZ A;  1ZQF A;  4KLF A;  3C5F A;  8ICG A;  8ICL A;  2HHP A;  2W9M A;  4QZD A;  3OUY A;  3V72 A;  1WOT A;  8ICF A;  2DRA A;  3JPT A;  1MIV A;  4Z6C A;  4FH5 A;  4WC6 A;  4WC4 A;  5HRB A;  4AT8 B;  5IIK A;  1ZQA A;  1R89 A;  9ICQ A;  5J0S A;  9ICC A;  4RWQ A;  1TFY A;  4KLE A;  9ICA A;  4YD2 A;  3JPQ A;  7ICU A;  5J0Y A;  5HRH A;  4PGX A;  5CR0 A;  4X4V A;  1HUO A;  4QZA A;  1UEU A;  8ICI A;  9ICF A;  1ZQR A;  4IQV A;  3OVB A;  5HRE A;  5EOZ A;  1YLQ A;  4EBJ A;  4X0B A;  5IIN A;  1ZQI A;  3AQK A;  3RH4 A;  4IQT A;  1BPZ A;  4UB5 A;  3C2L A;  4M9G A;  3WFP A;  5J0T A;  3V7J A;  5HRD A;  4WC3 A;  3V7L A;  3RJK A;  4UAY A;  3RJE A;  1ZQN A;  7ICP A;  3H38 A;  4AT8 A;  4S3N A;  2IHM A;  9ICB A;  4GXK A;  2PBE A;  3RJH A;  4I27 A;  4YMN A;  4UB1 A;  9ICJ A;  3UXO A;  7ICQ A;  9ICV A;  1MQ2 A;  1ZQD A;  8ICK A;  4RQ3 A;  4I2H A;  4FH3 A;  4IG8 A;  4I2J A;  4R64 A;  8ICC A;  4QZE A;  1KEJ A;  2ZH6 A;  4GXJ A;  4X4Q A;  4GXI A;  1ZQM A;  4YMO A;  1KDH A;  3C2K A;  7ICI A;  4NLZ A;  4KLU A;  5J2C A;  3B0Y A;  4Z6D A;  8ICM A;  4FHX A;  1JQR A;  8ICT A;  5J2K A;  5DBB A;  3ISB A;  4E80 A;  4XRH A;  3WFR E;  9ICS A;  4X4U A;  2ZHA A;  3UXP A;  2BCS A;  3MGI A;  4UBB A;  4AT7 B;  4I2E A;  7ICM A;  3K75 D;  3AQL A;  4X0A A;  8ICH A;  4I28 A;  4QZB A;  5J2A A;  4P2H A;  8ICQ A;  4WBZ A;  4LVS A;  2DR9 A;  1ZQQ A;  4I2A A;  2PFN A;  4KLO A;  4WBY A;  5J2I A;  4AT9 B;  3UXN A;  1RZT A;  1ZQB A;  9ICM A;  3HX0 A;  4E8F A;  4UB2 A;  4DOB A;  4I2D A;  4X4S A;  4X4O A;  1Q78 A;  3C18 A;  4UB3 A;  4RQ4 A;  4P4P A;  3AU2 A;  5CP2 A;  4UD4 A;  3RH5 A;  1NOM A;  3HJ4 A;  1JAJ A;  9ICH A;  3JPR A;  3AU6 A;  3MDA A;  3HJ1 A;  7ICK A;  4PHD A;  4NM1 A;  7ICO A;  5J0R A;  5J0X A;  1NO5 A;  4PHE A;  4AT7 A;  3WFS C;  7ICV A;  2BCQ A;  3JYY A;  7ICT A;  1V4A A;  3B0X A;  8ICN A;  7ICN A;  4Z6E A;  5F2V O;  1ZQY A;  4FHY A;  4TUQ A;  2ZH2 A;  2O1P A;  3UQ0 A;  7ICH A;  9ICG A;  3ISD A;  3OVA A;  5J29 A;  3UPQ A;  4RQ1 A;  4NM2 A;  3JPS A;  7ICS A;  9ICI A;  9ICO A;  4YCX A;  4QZ9 A;  1ZQJ A;  4IQU A;  4DO9 A;  3HIY A;  5DB6 A;  1JMS A;  5J2H A;  2ZH4 A;  1XSN A;  4I29 A;  2DRB A;  8ICV A;  3LQC B;  4QZH A;  2BPG A;  4WC1 A;  2FMS A;  8ICW A;  4RPZ A;  5CHG A;  5DDY A;  4M9J A;  5CWR A;  4NY8 A;  5J2E A;  2Q66 A;  4M47 A;  3LK9 A;  5HRI A;  1ZQL A;  4I2I A;  3PNC A;  2ID1 A;  2DR7 A;  4KLS A;  1ZQS A;  2ZHB A;  5DB7 A;  3H3A A;  1ZQO A;  5HRG A;  3OVS A;  3RH6 A;  4KLJ A;  1ZQW A;  1TV9 A;  4WC5 A;  2BCR A;  3UQ2 A;  4I2B A;  4F5O A;  4IQW A;  4FHP A;  5J0Q A;  4XQ8 A;  4YN4 A;  4K4H A;  1MIW A;  3PML A;  5D49 A;  3TFS A;  4X5V A;  4KLM A;  1JN3 A;  4FO6 A;  8ICU A;  4X4T A;  1R8C A;  3WFQ E; 
#chains in the Genus database with same CATH topology
 1SES A;  1MQ3 A;  3RYH A;  4MKP A;  2LO1 A;  4X65 O;  1DK1 A;  1FD9 A;  3N27 A;  2XND G;  1N33 B;  4DOC A;  2F66 C;  4TOI A;  4PGY A;  4EP7 A;  1AR1 B;  4O4H B;  5CBF A;  2XAJ A;  4O4I B;  1E1R G;  4I2G A;  3ISC A;  2ZH1 A;  1YF2 A;  2H8P C;  1ZL8 A;  4R65 A;  4NLN A;  1Z2G A;  2Y69 B;  4RWN A;  1FS0 G;  1KMI Z;  2ZQM A;  4NLK A;  4BIZ A;  5J2G A;  4KP4 A;  4K3A A;  4FM0 A;  1W0J G;  1UET A;  4LEV A;  4ATB B;  5CA1 A;  2CGO A;  5KHK A;  4RPY A;  5KA6 A;  3CD6 V;  4LF6 O;  3AK3 A;  5D63 A;  2GTA A;  4UCV A;  5BOM A;  1H8E G;  4UV9 A;  3FAV B;  3LDC A;  3MHH C;  4X62 B;  3ETQ A;  4QE7 A;  2Y0I A;  3BAA A;  5H9C A;  1ARO P;  3W7W A;  4K9A A;  3OEH G;  3SJA C;  2HP8 A;  2ZXW C;  4O6A A;  3CHX A;  9ICL A;  1BCC H;  3OTF A;  3CRA A;  3ZRX A;  4ASU G;  4OX9 O;  5LP6 B;  1WNS A;  1BPX A;  1F7Y A;  2YC0 A;  1PNK A;  1WLE A;  2P4K A;  4OGQ B;  2A9H A;  8ICJ A;  1XMQ O;  4QZI A;  5DBC A;  4PA3 A;  4GLX A;  4WC0 A;  2XOK G;  4U3J B;  4R8C A;  5IYZ A;  1ZJM A;  2EIL C;  2QKA A;  1I0H A;  4EKW A;  4CZZ A;  3RJI A;  2WPD G;  5GTI Z;  1FA0 A;  1FFT B;  2YS8 A;  1V55 B;  5EBM C;  5BOL A;  3DSQ A;  4EGW A;  1GM9 A;  2OTL V;  5EIB D;  4X66 O;  1MZF A;  3FB8 C;  5D5P A;  1Z5V A;  1MIY A;  4KLI A;  1HW7 A;  1VF7 A;  5J2J A;  1VJ7 A;  5III A;  4PJ0 Z;  5B1B B;  3H01 A;  1EBO A;  4LF7 O;  1HUZ A;  4O4L B;  4H0L B;  2AGA A;  2E3C A;  2XUM A;  4NXX A;  8ICE A;  2DJV A;  3AQM A;  4DUZ O;  4EB6 A;  3ABK C;  4FZ1 A;  1FXK B;  3TGU H;  1TVA A;  5BR8 B;  1M4U A;  2DW4 A;  2QM8 A;  3K79 A;  2VWJ A;  7ICF A;  3E89 A;  3K58 A;  4MTG A;  1UFI A;  1OHH G;  3D36 A;  1JX9 A;  5HFM A;  4RT2 A;  2P6J A;  3A0H Z;  1V55 C;  3LNM B;  1SQX H;  4FFK A;  1IBL B;  1SQB H;  3IJ4 A;  2EIN C;  1MSW D;  2F4V B;  4QGP A;  3K57 A;  4LWS A;  2HEP A;  2M2T A;  5TZV A;  3NYB A;  4X88 A;  5EYP A;  9ICP A;  4I55 B;  1S3J A;  4UUJ C;  2ZH3 A;  2JDI G;  3JD4 A;  5B1B C;  4NKU A;  3CCR V;  4TV9 B;  4O5K A;  5FNV A;  2ZD9 A;  5H2F Z;  2NNU A;  2JVD A;  2WSS G;  1SRY A;  5L3E A;  3JD1 A;  4CC5 A;  3J80 N;  2KG7 B;  1H2N A;  5KAI Z;  1BPD A;  3FB6 C;  1NT2 B;  2RMK B;  4JV5 B;  3N2K B;  3SYC A;  4Z6F A;  3RYI B;  3FYE B;  1K34 A;  4YJ3 B;  2CH7 B;  4B7E A;  2E5L B;  3RVY A;  3WB2 A;  2OCC C;  3FYI B;  3LSU A;  4I9Q A;  5DEC A;  2FTK A;  3GWK C;  5B5E Z;  4I0X B;  2Q7E A;  4UV8 A;  4B3M O;  3JPO A;  4X1Y B;  1AIL A;  1US6 A;  2DYR B;  5HRK A;  2GDS A;  5CFS A;  4J11 A;  4I2C A;  3UO2 A;  3ZCC A;  3JCZ A;  9ICW A;  3GDX A;  2BCC H;  3RJJ A;  1KU9 A;  3LDD A;  4M5D A;  4KLD A;  1ORQ C;  1XL4 A;  3SPI A;  3C5F A;  1JOY A;  2BBJ A;  1IBK O;  4IYH A;  8ICL A;  4IHJ A;  5KMG A;  3V72 A;  3AG3 C;  3RFR A;  2AXT Z;  3QVN A;  4QPK A;  8ICF A;  4LFA O;  1J5E O;  3CP1 A;  4PV1 B;  2B5U A;  1GN2 A;  3ZMT A;  1B06 A;  2VS0 A;  4B3R B;  3C3T A;  4FH5 A;  1NTK H;  4AT8 B;  4LF5 O;  1K9M W;  1TVK B;  3ZMS A;  9ICQ A;  1I08 A;  5L3D A;  2OIE A;  3SJQ C;  4K0K B;  4JI0 O;  4UXN A;  5EC1 C;  4FO1 A;  5D5Q A;  2QSA A;  4PGX A;  4X4V A;  1MOF A;  1K3E A;  3DGE A;  3W7S A;  3CB2 A;  9ICF A;  1NVP B;  3ABT A;  1HR0 O;  4DV3 B;  3JAM N;  2Q7H A;  5LGN A;  4WFE A;  1IDS A;  1WAZ A;  3AQK A;  4R50 A;  1MA1 A;  1TA8 A;  4MTX A;  3BHP A;  4IQT A;  4NB5 A;  5B3Q A;  4MW8 A;  2QM7 A;  3N2G B;  2CTP A;  3HKC B;  1K7D A;  1FJG O;  5LP6 A;  5LGU A;  4LEY A;  4M9G A;  1VQM V;  1H8H G;  3L73 H;  3CWB H;  1FXH A;  4FM1 A;  3SYO A;  4DK1 A;  4JI5 O;  4U3J A;  1O9G A;  1S72 V;  1ZQN A;  3NR7 A;  2WWW A;  1AB3 A;  5D62 A;  4S3N A;  4EEB A;  3RJH A;  4H44 B;  2LJ2 A;  4YMN A;  9ICJ A;  7ICQ A;  9ICV A;  2IM9 A;  2Q73 A;  1JFF B;  2EZO A;  1MQ2 A;  4XDJ A;  1GH6 A;  1ZQD A;  4IG8 A;  4I2J A;  4QZE A;  4X4Q A;  4IGG A;  1ZQM A;  2DYS B;  4FLX A;  4XDK A;  3RGB A;  1PV0 A;  1KKD A;  8ICM A;  4DR2 O;  4CH4 A;  2EJ7 A;  4Q6G A;  5B3S B;  5LBQ A;  1Y74 B;  1SQG A;  2DE0 X;  4X64 B;  4QE9 A;  3JAW B;  4GX0 A;  4E80 A;  4XRH A;  1M57 B;  2PI4 A;  4O4L A;  3ZRS A;  1RPO A;  4X9Q A;  5IJ9 A;  2VQE B;  3X2Q C;  4PEL A;  2ZIO A;  5C93 A;  7ICM A;  1MAB G;  2QWO B;  4X0A A;  4DR7 B;  3CRC A;  1YIJ V;  2UXC B;  3IFX A;  4H13 B;  5K1P A;  4DK0 A;  4CC6 A;  3CSX A;  4DV4 O;  2DYS C;  2ZE5 A;  3F5T A;  1S76 D;  1YEW A;  1K5S A;  1H2G A;  2MW2 B;  4Q20 A;  1AJP A;  4I2A A;  1KD1 W;  1NI8 A;  3NWI A;  3JSN A;  4WBY A;  2JGU A;  4AT9 B;  4WOY A;  1OCR C;  1KB9 F;  9ICM A;  1M57 C;  1Q86 W;  4GX2 A;  5JQG B;  1GPJ A;  4RQ4 A;  4DR3 B;  4P4P A;  2KG7 A;  4UCU A;  4W4K A;  1AI7 A;  1JR9 A;  1U97 A;  4D7T A;  4OAG A;  2Q6A A;  3ASO B;  4K99 A;  3K03 A;  3MDA A;  3LSQ A;  2CH7 A;  2ATK C;  1NO5 A;  1K33 A;  2QWQ B;  5B66 Z;  3WFS C;  4WF9 V;  1F4N A;  1V54 C;  7ICT A;  2GSM B;  1GMG A;  3AK1 A;  1TUB A;  1NR7 A;  1S0V A;  5C8Y B;  4TUQ A;  9ICG A;  5JWP A;  3P30 A;  2ARH A;  3LSS A;  4O2A B;  4HAM A;  7ICS A;  2B9Z A;  1HP8 A;  9ICO A;  4NXN O;  4DRX B;  1F51 A;  4QZ9 A;  2NN4 A;  3ASO C;  8ICV A;  3WG7 C;  2Q68 A;  2DRB A;  4TUY A;  3BVO A;  4WC1 A;  2FMS A;  3W7U A;  2G38 A;  2N04 A;  4FM2 A;  3J7A U;  3G6B A;  3NXS A;  1W59 A;  3JAT A;  1TAE A;  3B77 A;  3A0B Z;  4MVM A;  2WLK A;  2AZ0 A;  1OCC C;  5L3F A;  1B6Q A;  3SYA A;  2DR7 A;  4AQY O;  2IH1 C;  4JTC B;  3HPL C;  3TK1 A;  1TVK A;  2CTQ A;  5L3C A;  1AP5 A;  3C3S A;  3CXH F;  4B3M B;  4DR6 B;  3CCS V;  5LHH A;  1J95 A;  4I7Z B;  1XMO O;  3OVS A;  2YIB D;  3JAR B;  3RH6 A;  3E8B A;  2F95 B;  2P90 A;  1TV9 A;  4LFB O;  2GTS A;  1SKV A;  2N74 A;  5CMU A;  1Q8I A;  1PNL A;  4Z2W A;  2EX3 A;  4F5O A;  4FHP A;  3VOU A;  5J0Q A;  1MIW A;  1QLE B;  3TFS A;  5H6Q A;  4X5V A;  4KLM A;  4FO6 A;  2F1M A;  3RWR D;  4X4T A;  5KX5 B;  2P22 C;  1TUE B;  3H39 A;  4X4R A;  1KP3 A;  8ICZ A;  3JD0 A;  4TV8 A;  3AQN A;  3VQW A;  2LW7 A;  7ICR A;  2IJJ A;  4BR6 A;  3HKC A;  3PN1 A;  1BHA A;  4RQF A;  3JD2 A;  5DM6 V;  4QZF A;  1Y4M A;  2HJD A;  2EZP A;  2JK5 C;  3EF2 A;  4BIU A;  4TUR A;  4LF5 B;  2QTO A;  1L1F A;  4MFF A;  1Z5W A;  1Y76 B;  5IY5 C;  4U3F H;  1TGO A;  3E22 B;  7ICE A;  2X6C A;  3CCE V;  1VQ9 V;  4K98 A;  4NXW A;  3RJF A;  1JFF A;  2CE4 A;  2YSU B;  5JH7 A;  3CRM A;  1PL0 A;  3B8N A;  4PGQ A;  4FLW A;  4O67 A;  5CHE A;  4FLU A;  4C7U A;  4UB6 Z;  4JI6 B;  1L8D A;  3O65 A;  1VQ4 V;  4O5E A;  2UXD B;  4M04 A;  1ZX3 A;  3JPN A;  4I9W A;  3ZRV A;  1BPE A;  3EXA A;  4OXS A;  4L8J A;  4DOA A;  2EIK B;  2UXN A;  2FML A;  4O9M A;  2FMP A;  2ETN A;  4DV5 O;  3VBB A;  4GKJ O;  3JPP A;  1F5A A;  1OCO B;  3S3W A;  3TCU A;  3AG4 B;  5EIB C;  5L3G A;  3T4D A;  1DLB A;  4MF8 A;  4KFM A;  4DYL A;  1XNR B;  4LH6 A;  4Z1M G;  3APO A;  1UJW B;  1F4M A;  3K06 A;  4FK5 C;  5EYP B;  4DXW A;  4AT9 A;  5LL6 Y;  2HFE C;  2UU9 O;  1R3I C;  2DVI A;  1AVM A;  4XQ7 A;  3MD0 A;  1P49 A;  1URF A;  2EIK C;  5LMU B;  4DV7 B;  5FNV B;  3R66 A;  4KHP O;  5BMV B;  4WC7 A;  1BPY A;  1ZQC A;  5J0O A;  1PP9 H;  4TQF A;  5EK0 A;  3AG4 C;  3IAY A;  2B1I A;  4I2F A;  2P06 A;  1ZAU A;  4KLT A;  4GT1 A;  5KLV H;  4RUF A;  1R6K A;  2UUA O;  3T1H O;  3RJG A;  3PJS K;  1H2M A;  2X6A A;  1I94 B;  4J10 A;  2NRK A;  1AJQ A;  4P9P A;  4DV4 B;  2YID A;  1N34 B;  3CE2 A;  1GM7 A;  1DGS A;  3ZBH A;  2WAM A;  4FHW A;  4NKT A;  3DC6 A;  2HN1 A;  3ETG A;  4PDL A;  2EBO A;  2M2V A;  2QDO A;  3F7V C;  2CTR A;  1S5J A;  5FPO A;  3VQX A;  3LUT B;  1Q81 W;  4MVR A;  4MVO A;  4RQ0 A;  4DRX A;  4PH5 A;  4XJE A;  5BPC A;  4B3T O;  2DR8 A;  4JI4 O;  4D7S A;  4JLZ A;  2IJK A;  2VQF O;  5CB1 A;  4XUS A;  1ZJN A;  9ICK A;  1NQT A;  3QO7 A;  1ZQE A;  1HDJ A;  4XA5 A;  4DR1 B;  4RQ5 A;  1B04 A;  1FAF A;  4IHJ B;  5J2F A;  3OUF A;  2OCH A;  1I7F A;  2V1D A;  1M9N A;  3DXR B;  5KMG B;  5EC2 C;  2V7Q G;  3HWT A;  4MVU A;  3K9S A;  4CH3 A;  4LF4 O;  4TUS A;  4CS2 A;  3H1I H;  1TFW A;  3PHZ A;  1CXZ B;  4K8X A;  5DBA A;  1WJZ A;  1WA8 A;  2ILM A;  2ZXW B;  4G28 B;  4FPP A;  2QWR B;  5KHH A;  5DDM A;  1BL8 A;  4DO2 A;  1N32 B;  4JAU A;  2BOB C;  1XBL A;  3OMA B;  3JAR A;  1GKF A;  3F5W C;  4M2Y A;  3ERC C;  3C90 A;  3T1C A;  1VF5 B;  3TXQ A;  1N36 B;  4RWU A;  4EBK A;  4MFC A;  2EIL B;  1DF5 A;  3B40 A;  3SJB C;  5J0P A;  1XQ8 A;  2UXB O;  3UPS A;  3GVM A;  4UAW A;  5KX5 A;  4O5C A;  8ICR A;  3DTU B;  1QCE A;  2QE7 G;  2VAN A;  2V4D A;  2R9R B;  8ICG A;  3CC7 V;  3T1Y O;  1PL4 A;  1UPG A;  4PA6 A;  4FMT A;  2HHH B;  2ZKO A;  4DV2 B;  4J7K A;  4DUY O;  1GM8 A;  2W0F C;  1MIV A;  4Z6C A;  1Y76 A;  4WC4 A;  5DN6 G;  3ABK B;  2AZ2 A;  2KKW A;  3D3I A;  3KZI Z;  3E22 A;  3L72 H;  3O9O A;  3MCR A;  1Q7Y W;  2DQ0 A;  1ZQA A;  3U11 A;  1GN4 A;  1VQK V;  1R3K C;  5J0S A;  9ICC A;  4WFG A;  1TFY A;  4YD2 A;  3JPQ A;  3RW0 A;  1I5X A;  3ZN1 A;  1X59 A;  2UUB O;  3WFV A;  4DR4 B;  7ICU A;  5J0Y A;  5HRH A;  1QQC A;  2OYQ A;  1IZ3 A;  4DW0 A;  1HUO A;  2EIN B;  4QZA A;  2H94 A;  1UEU A;  2D2C B;  1ZQR A;  3U0Z A;  3OVB A;  4KXR A;  3D3Q A;  3L71 H;  5J9P C;  2A3Q A;  1Q6U A;  1ENV A;  1ZQI A;  4NKG B;  3OEE G;  2JJ1 G;  1L0N H;  2QTS A;  4J41 A;  5IJ9 B;  1HNX B;  4P9O A;  2OIG A;  2Z5U A;  3MAQ A;  3WFP A;  4WFH A;  5J0T A;  2DQ3 A;  1NU1 H;  3V7J A;  2ZDI C;  1S5L Z;  4WC3 A;  3QNE A;  3CC4 V;  4K9B A;  3IGA C;  4ZOL A;  5CN0 A;  2OCC B;  2IHM A;  1AR4 A;  5BXZ A;  1AI5 A;  1YJ9 V;  1F23 A;  4JYA O;  4UB1 A;  3CME V;  4JI3 B;  3SPJ A;  4NXM O;  3AG2 C;  3T2M A;  2M7W A;  3A8T A;  8ICK A;  1VQP V;  3OTO B;  4FH3 A;  4FIP C;  2RQ6 A;  5BMV A;  4ZBM A;  2E74 B;  3B0Y A;  4Z6D A;  5EBW C;  4FHX A;  4ABM A;  3ABL C;  4JI8 B;  4EEQ A;  2VWK A;  4DV5 B;  3CC2 V;  1Y6X A;  5DBB A;  1YSC A;  3JCU Z;  4GKJ B;  2P7T C;  4U7O A;  3A2F A;  1NH2 D;  4F4L A;  3AG3 B;  3K04 A;  3UXP A;  3MGI A;  4UBB A;  4H33 A;  1D2D A;  4I2E A;  3QO8 A;  1IUR A;  2GA9 D;  3CCQ V;  3AQL A;  3H1K H;  1TUB B;  2LFS A;  3AG7 A;  4GUN A;  1IXB A;  3AK2 A;  4B3S O;  3W7X A;  8ICQ A;  2XAF A;  1IX9 A;  4JI7 O;  2IBZ H;  3ML0 A;  2DR9 A;  1KKC A;  1RPR A;  1ZQQ A;  2XAQ A;  2EJR A;  1XIL A;  1KEC A;  1KQS U;  2PFN A;  2F43 G;  1BQZ A;  2IU0 A;  4TUY B;  2ZM6 O;  2JGD A;  3JAL B;  3OGI B;  4X89 A;  1RZT A;  3RN4 A;  4WBN B;  4J7Z A;  4FFB A;  2P67 A;  3STZ C;  4I2D A;  4X4S A;  4PDR A;  1FPO A;  3DXR A;  1VAR A;  4F6E A;  2AW9 A;  1FFX A;  3AU2 A;  3P32 A;  3APQ A;  3JAT B;  4LC1 A;  2EIM C;  2QKC A;  3BFR A;  1NR1 A;  1RM1 B;  4AI8 A;  3F7Y C;  2WLJ A;  4DW1 A;  5LGT A;  4I50 A;  1R1B A;  2Q0A A;  5J0R A;  5J0X A;  1XNQ B;  4MTO A;  3TET A;  2X6B A;  5IWA O;  1S77 D;  4PHE A;  1WP7 A;  4AT7 A;  4LR3 A;  5LA6 B;  5CBG A;  4NYK A;  5JVD B;  4LBE C;  5EZY B;  3K5N A;  4FHY A;  2EIJ C;  5K1X A;  3ABM C;  1QVG U;  4X65 B;  3OVA A;  3E35 A;  5A2Q N;  5J29 A;  3UPQ A;  1YJW V;  4RQ1 A;  1MNG A;  3CS5 A;  4WFB V;  2Q8V A;  3JPS A;  5LYJ B;  3QO5 A;  1RM1 C;  3CCJ V;  4DO9 A;  3HIY A;  5DB6 A;  4TV8 B;  1XSN A;  1EZJ A;  1MSD A;  5HFL A;  3LQC B;  4I4T B;  1GK9 A;  3VQY A;  1QNM A;  3ZRW B;  5DDY A;  4M9J A;  4MS2 A;  2K1E A;  2RCV A;  3OR6 C;  4AHC A;  2BSK B;  5KHJ A;  3BCC H;  5J2E A;  4ZIB A;  4OAF A;  2WLH A;  1H2S B;  4OAI Z;  5HRI A;  2IHO A;  3CCV V;  4FVM A;  1K4C C;  4FLT A;  4NTW A;  3CCM V;  4ICG A;  3FB7 C;  1AI6 A;  3X2Q B;  5DB7 A;  5B1N A;  2GBO A;  3GB7 C;  5HRG A;  1Q82 W;  3BRC A;  3UQ8 A;  2ZDI A;  4LF6 B;  1BS3 A;  5JH7 B;  4WC5 A;  2IU3 A;  4LP8 A;  2NR5 A;  4J80 A;  1E1Q G;  1QVF U;  2ADP A;  4IQW A;  3K5M A;  3G80 A;  2A79 B;  1WPX A;  4K4H A;  3K5L A;  3PML A;  4H37 A;  5KAF Z;  5D49 A;  4OX9 B;  1KNY A;  2L6L A;  1OCR B;  4G2K A;  4O2B B;  2QWP B;  2QKS A;  4MFA A;  3HB3 B;  5GTH Z;  5J2D A;  4PDV A;  2I9G A;  1XMQ B;  2O5A A;  1ZQK A;  1PM9 A;  5CFT A;  3ZHU A;  8ICA A;  3K7D A;  4DV0 O;  4QZG A;  3C5G A;  1LNQ A;  4J9Z B;  3L75 H;  4LF9 O;  4UB4 A;  3ZIA G;  5KHI A;  3TFR A;  1N8R W;  3AUO A;  2YEV B;  3JZ0 A;  3BY6 A;  4MVS A;  2WLN A;  1XHX A;  1YZB A;  2QA4 V;  3ICX A;  1XDC A;  4LCU C;  4DV6 O;  4FLY A;  2UUB B;  4YY3 O;  1V54 B;  8ICB A;  4QZC A;  1PKX A;  4K97 A;  2ZH9 A;  4MF2 A;  3C66 A;  4NXZ A;  1P4R A;  1SER A;  4X66 B;  4WCE V;  1HNZ O;  9ICU A;  1Q79 A;  4O68 A;  8ICO A;  3KG2 A;  1SZT A;  1QR8 A;  4UB8 Z;  1SQQ H;  4KL1 A;  4OPH A;  3HW8 A;  4BW5 A;  4KLG A;  4WQK A;  4JI1 O;  4LF7 B;  4GX1 A;  3WG7 B;  3OMN B;  4DUZ B;  3WFO A;  4HX0 A;  2RNB A;  3BEH A;  1RFY A;  4E7X A;  3OD4 A;  5LMN O;  1ROP A;  1XL6 A;  8ICX A;  3NVO A;  4RWO A;  5HC9 A;  4FLV A;  3D8C A;  1OCC B;  2CDY A;  2JS5 A;  4O4J A;  5ITZ A;  3G6E V;  2UUC O;  4RQ7 A;  2PFO A;  1CPY A;  2HVJ C;  1N33 O;  4KLL A;  2DMX A;  3B09 A;  1Q43 A;  4YMM A;  4NVP A;  1VP7 A;  2KQX A;  3PMN A;  1BPB A;  3SGI A;  4JWN A;  4J7J A;  1ZQH A;  3ZX6 A;  4E2L A;  3ER8 C;  3JAL A;  2BPC A;  1R6N A;  4WBN A;  2WLL A;  3CRR A;  1XSL A;  5A9G A;  3ZHR A;  9ICX A;  3J81 N;  1R73 A;  5GW7 A;  2DN9 A;  2ZNI A;  4P2Z A;  3RBZ A;  2ZR2 A;  5DED A;  5HR9 A;  4OPA A;  1FYJ A;  3L9D A;  2BTQ B;  5B1A C;  5D46 A;  1OZ0 A;  2EUL A;  1WA8 B;  2GWS A;  5HHH A;  4M9L A;  1E79 G;  1VFG A;  2DR5 A;  4I5S A;  4B3S B;  5LA6 A;  3M99 B;  3ER9 B;  5JVD A;  1OJH A;  5EZY A;  3SDL A;  5IY5 B;  1JCH A;  3HR0 A;  4YXW G;  1COW G;  2ADQ B;  1WN7 A;  5CJ7 A;  4K4G A;  4Z1V A;  7ICJ A;  2PY5 A;  5LYJ A;  1IBK B;  4UBC A;  4HNA B;  3ZMU A;  5DKW A;  4HBN A;  4X4N A;  1XEQ A;  1EM1 A;  4UAZ A;  3HKD A;  2JIZ G;  8ICP A;  4LFA B;  4I4T A;  1J5E B;  2RJZ A;  3MDC A;  4RQ2 A;  3ZRW A;  2ZT9 B;  4NTX A;  1M93 A;  2B1G A;  2YXY A;  1ZQG A;  2BSK A;  4DV1 O;  4JYB A;  5IIL A;  1EFR G;  3ZHT A;  2XAG A;  2CTW A;  4M9H A;  4JZ2 A;  2RN9 A;  4X1K B;  1NVP D;  5J2T B;  5FLX N;  1ZQX A;  1AP6 A;  4JI0 B;  5DB8 A;  4BWA A;  4WCW A;  2PXI A;  4NR1 A;  1RSO B;  1R8B A;  4CS3 A;  4X1I B;  3ZED A;  5L3B A;  2Y4U A;  1HR0 B;  3ZJZ A;  3UCS C;  5KHG A;  1XHZ A;  4M0A A;  1Q6H A;  1VQO V;  5BR8 O;  3MGH A;  2FL4 A;  2HVK C;  2ISP A;  4HZ3 A;  3BA9 A;  3K9A A;  4PHP A;  4GZR B;  1UEV A;  1QR9 A;  2F93 B;  1R8A A;  2BCV A;  2P66 A;  4RWP A;  1FJG B;  1Q3E A;  4FLZ A;  4O2B A;  1R3L C;  2UXX A;  4N21 A;  5DB9 A;  2CK3 G;  1ZQZ A;  1IBL O;  3AG1 C;  1OV9 A;  4D6T H;  2XHB A;  2F4V O;  3ABU A;  4JI5 B;  1GAX A;  2O57 A;  4E4E A;  2HHP A;  4UCS A;  2W9M A;  4QZD A;  1M90 W;  5IYB O;  1P84 F;  4JAS A;  4X20 A;  3B2E E;  4K8V A;  2DRA A;  5J2U B;  1WB7 A;  2IW5 A;  2YEV A;  3CX5 F;  2PTM A;  4ZOL B;  4GKK O;  1KYO F;  2IH3 C;  2B4V A;  2ZIM A;  4JV5 O;  4CH5 A;  4RWQ A;  1NKD A;  1JA8 A;  4DR2 B;  4JTD B;  4MSW C;  4IL6 Z;  1AR5 A;  2E5L O;  3RT3 C;  2Z3Y A;  5CR0 A;  1SZX A;  1K92 A;  1ZTE A;  1SC5 B;  8ICI A;  2YXH A;  5KUK A;  2ITC C;  4RAI A;  3QF7 A;  5EOZ A;  1L0L H;  1HNW O;  4BW9 A;  4EBJ A;  4MVQ A;  3E8H A;  4X0B A;  4DV0 B;  1LUV A;  4JI2 O;  2ITD C;  4CS4 A;  1JJ2 U;  5CBH A;  2YI9 A;  4UCO A;  4UB5 A;  2JS3 A;  2E76 B;  4QJF B;  2GAF D;  5HRD A;  2WA4 A;  3KCY A;  3RJK A;  5CA3 A;  4UAY A;  7ICP A;  3ZHQ A;  4WFA V;  2Q0O C;  3HKB A;  2CGN A;  2R70 A;  4GXK A;  3UKM A;  1G6U A;  5IYC O;  3JD3 A;  3JCF A;  1Q90 D;  3UM7 A;  2JGD B;  4RQ3 A;  4I2H A;  2YXL A;  1KEJ A;  4GXJ A;  4GXI A;  1NJI W;  4FFB B;  4K8Z A;  4NXT A;  4YMO A;  1BSM A;  4UFZ A;  3C2K A;  7ICI A;  2W0X A;  3KKY A;  4NLZ A;  2WLI A;  4F6R B;  2R72 A;  2WLM A;  1FFX B;  4K0K O;  3R65 A;  1OCZ C;  4FZ0 A;  3OM3 B;  4XDL A;  2BTQ A;  8ICT A;  1JQR A;  5J2K A;  1GN6 A;  4I50 B;  4JAV A;  3E8G A;  2D3O W;  2P5O A;  1DF4 A;  1JPX A;  5B3P A;  2IUB A;  4DV3 O;  2K9P A;  3WFR E;  2DWE C;  4X4U A;  2UUC B;  2GHY A;  2BCS A;  3FB5 C;  4LEW A;  4AT7 B;  3EHB B;  1FXV A;  1BZK A;  2PGG A;  3G67 A;  1YIT V;  1YJN V;  1KBH A;  3JAS B;  1EN6 A;  1VMG A;  8ICH A;  4NXN B;  3ASN B;  4ZHQ A;  4QZB A;  5J2A A;  4P2H A;  4WBZ A;  3OWG A;  1SA0 A;  2OWO A;  2A06 H;  2FKX A;  1IXM A;  3G4S V;  1BT8 A;  4HNA A;  5LOV B;  1YDX A;  5KUM A;  4UCR A;  1NTM H;  5J2I A;  3UXN A;  1YVW A;  1R3J C;  4I0U A;  4LNU A;  1ZQB A;  1NZ6 A;  4UB2 A;  4DOB A;  1D5N A;  4X4O A;  1Q78 A;  3LNN A;  4UB3 A;  4QIW F;  4AQY B;  5IJ0 A;  4L87 A;  4LF8 O;  1CP9 A;  3RH5 A;  1NOM A;  3HJ4 A;  1JAJ A;  3AU6 A;  1XMO B;  4X1K A;  2LP7 A;  2DWD C;  4EFB A;  5J2T A;  3ASN C;  2OTJ V;  4PHD A;  4NM1 A;  7ICO A;  3I56 V;  2F23 A;  4LFB B;  1A32 A;  2BBH A;  1RSO A;  2Y69 C;  4X1I A;  4N7R A;  2XAS A;  7ICV A;  2L35 A;  1MMM A;  4X64 O;  1VQ8 V;  3JYY A;  4WFF A;  1V4A A;  3UT5 B;  4MW3 A;  1S5H C;  7ICN A;  3FD9 A;  1ZQY A;  2VQE O;  5JJN B;  3UQ0 A;  7ICH A;  3SPH A;  2FCL A;  3DC5 A;  3ETD A;  5JCO C;  3ISD A;  3ZHS A;  1AJN A;  1G4Y B;  3K59 A;  4NM2 A;  2PI5 A;  3AG2 B;  4DR7 O;  4YCX A;  2UXC O;  1G1X B;  2W6J G;  3K0G A;  4DV1 B;  1JMS A;  1K73 W;  4I29 A;  1NS1 A;  4QZH A;  2HG5 C;  3JSL A;  8ICW A;  2BTO A;  3TJT A;  5JTG A;  4EV6 A;  5CWR A;  4IT5 A;  1T5E A;  2GUZ B;  2LGW A;  3ABL B;  1N0N A;  1W2B U;  3VQV A;  4IIJ B;  4ZI7 A;  2Q66 A;  3CCL V;  5LP6 C;  1MZE A;  1ZQL A;  1IVS A;  5J2U A;  3CJH B;  4I2I A;  2ID1 A;  4DR3 O;  1YXB A;  5AG2 A;  4MT8 A;  5CFU A;  3UO3 A;  2ZHB A;  1GTO A;  1H2K A;  3H9V A;  2HR3 A;  3H3A A;  1K97 A;  2PF4 E;  4J9Y B;  1YI2 V;  3FKS G;  5GON A;  4KLJ A;  1X4T A;  1ZQW A;  4TQD A;  1WP8 A;  1H38 A;  1XI1 A;  4I2B A;  2DOS A;  3OAA G;  4QPJ A;  4RQE A;  4TWK A;  3ZMV A;  3IC9 A;  3THO A;  4XQ8 A;  4YN4 A;  3FX7 A;  2LFR A;  1LUW A;  1JN3 A;  4KM5 A;  8ICU A;  4FHV A;  1JMK C;  1SET A;  1HWY A;  2BPF A;  4LH7 A;  3WU2 Z;  3ETE A;  2PYJ A;  3K0D A;  5IIJ A;  3L74 H;  4PI0 A;  1M1K W;  5D4B A;  2Q7G A;  4QZ8 A;  5IIM A;  5BY1 A;  4YD1 A;  1P7B A;  1JVM A;  1ZQT A;  3U10 A;  2EIM B;  2BCU A;  3OUY B;  4GKK B;  1FXK C;  2HKO A;  4M9N A;  8ICY A;  4X4P A;  4O4J B;  4PHA A;  2B51 A;  1VQN V;  3HKE A;  3P3P A;  1QHT A;  5ITZ B;  4UVB A;  4LFC O;  4J42 A;  4DR5 O;  3RYF A;  2ZH7 A;  1H2L A;  1BHB A;  2UU9 B;  2Y48 A;  3KCX A;  1OU5 A;  1GO3 F;  4RO2 A;  4BIO A;  4KHP B;  1WB8 A;  1VQ7 V;  4LZD A;  5J2B A;  2EIJ B;  4R7C A;  1ZSP A;  2BE3 A;  5HRL A;  1BGY H;  4R63 A;  3MBY A;  3ABM B;  3G71 V;  3CMA V;  4GYC B;  1KC8 W;  2WLL B;  2ZIN A;  3SR2 C;  4DR6 O;  4LZG A;  1HNW B;  4F6R A;  3BAB A;  1PPJ H;  2HN2 A;  2Q69 A;  3K3W A;  3OV7 A;  4JI2 B;  1N0J A;  9ICN A;  3C2M A;  2UUA B;  3T1H B;  1G8M A;  3H37 A;  3M7M X;  4CBC A;  4QNH B;  4KLQ A;  4XBF A;  2RFF A;  3MDS A;  1EN5 A;  5D61 A;  4PA9 A;  4GX5 A;  4O4H A;  1PNM A;  2W6I G;  3EFF K;  3K5O A;  4IYI A;  3JAS A;  4JZG A;  3CXC U;  1EZV H;  4O4I A;  2M2W A;  1BE3 H;  4B3T B;  5H6R A;  3ZS8 C;  4JI4 B;  4EFE A;  2ZH5 A;  2VQF B;  4P4M A;  4LT6 A;  2DYR C;  4YHH O;  2Q5Z A;  4F5N A;  3AEI A;  5LOV A;  1CEZ A;  2ZE6 A;  4K4I A;  4GCZ A;  1O9H A;  4F5Q A;  3HKD B;  4N23 A;  4ATB A;  5IYD O;  4LF4 B;  5JCO A;  4KLH A;  2XT9 A;  3OFN G;  2ISO A;  2M2U A;  1M56 B;  4MVZ A;  5FL7 G;  1RPL A;  3OMI B;  4A5U B;  3FAV A;  5B1O A;  1ZWI C;  3ZHV A;  1ZQP A;  4TT3 G;  5HRF A;  2PFP A;  3H1H H;  4B7K A;  4JI6 O;  3OGU A;  2UXD O;  1YHQ V;  2Y0P A;  1XOU A;  3UT5 A;  1NTZ H;  3SYP A;  5CA7 A;  7ICG A;  4UD5 A;  2CUG A;  2X7R B;  1I5Y A;  3B8M A;  2UXB B;  4RQ6 A;  2FMQ A;  2YI8 A;  5HHI A;  3STL C;  4RT3 A;  2QJ1 A;  9ICR A;  1K8A W;  3OUS A;  1XSP A;  4JF3 A;  1IBM O;  1M56 C;  2FB5 A;  3T1Y B;  1PD3 A;  4F5P A;  2OT5 A;  4RUE A;  4TUP A;  1ZQV A;  5J0W A;  5LXT B;  1VEW A;  1YCI A;  5LHG A;  3CCU V;  1VQ5 V;  4RPX A;  3LDE A;  2YDE A;  4DUY B;  1SQP H;  4LF8 B;  4RQ8 A;  1Q5O A;  1SQV H;  3A0R A;  4TSF G;  4HYO A;  5BZB A;  1XNR O;  4WH5 A;  4R66 A;  3V7K A;  2GUZ A;  1YTF B;  7ICL A;  1PX5 A;  9ICE A;  2PFQ A;  3SYQ A;  4NTY A;  3JAK B;  4IIJ A;  2MK3 A;  4X20 B;  4YIO A;  5LMU O;  3CJH A;  4DV7 O;  1WPB A;  3BA8 A;  2QM4 A;  4PI2 A;  4WC2 A;  8ICS A;  2ODM A;  9ICT A;  4F5R A;  4P4O A;  3SPC A;  2A7W A;  4EED A;  1FXK A;  1K5Q A;  2ZH8 A;  5IDJ A;  1DTO A;  1MG1 A;  3I5D A;  4PDM A;  3GWO A;  1I94 O;  5J0U A;  2ZE8 A;  5CB4 B;  4PPX A;  5IIO A;  3S3X A;  1N34 O;  5JJJ B;  4YJ2 B;  4JWM A;  4W4L A;  1ZQU A;  3JYC A;  4K35 A;  5B3S C;  2Q67 A;  4I55 A;  2R9I A;  1ZQF A;  4KLF A;  1U96 A;  4PHZ A;  5KA5 A;  3E83 A;  2N05 A;  4TV9 A;  2JEU A;  1V9P A;  3OUY A;  2ZCE A;  1LR1 A;  5B1A B;  1WOT A;  3E8F A;  5CA0 B;  1FKA O;  2NLJ C;  4DR1 O;  3JPT A;  3N2K A;  1SS3 A;  4JYA B;  3RYI A;  2IJH A;  1GRJ A;  4CH6 A;  4NXM B;  4WC6 A;  4YJ3 A;  1JJO A;  5HRB A;  3NKU A;  3Q4H B;  3RYC B;  2EWR A;  3HKB B;  5IIK A;  2A0L A;  1R89 A;  2PZS A;  1VF6 C;  2CAZ C;  4I0X A;  4KLE A;  9ICA A;  1N32 O;  1Y67 A;  3B4S A;  4X1Y A;  3QG5 A;  4ZKI A;  2KB1 A;  1W0K G;  2WLI B;  4JYC A;  3E2E A;  3SJC C;  4LEZ A;  4IQV A;  5HRE A;  1N36 O;  1YLQ A;  1P7G A;  3RYH B;  2YIB A;  4MTF A;  5IIN A;  3ZMZ A;  3CK6 A;  3RH4 A;  1BPZ A;  4X62 O;  1NBM G;  1VQ6 V;  1D5A A;  1QU7 A;  3M8A A;  2Q4P A;  4LFC B;  3C2L A;  4UVA A;  4DR5 B;  4JI7 B;  2VRZ A;  4WQL A;  4ZHQ B;  3V7L A;  3L70 H;  2KSD A;  3MHS C;  2HHH O;  3RJE A;  3H38 A;  4DV2 O;  1SA0 B;  1ZL8 B;  4AT8 A;  2ZM6 B;  9ICB A;  2Q9L A;  3P3N A;  3CEI A;  2PBE A;  4OAH A;  1ZLZ A;  4I27 A;  3W7T A;  1VIB A;  3UXO A;  3OE7 G;  1R6T A;  8ICC A;  4R64 A;  4LNU B;  2ZH6 A;  5CA1 B;  1KDH A;  2HLD G;  2HJF C;  4KLU A;  4KUM A;  5J2C A;  5E79 Z;  5IJ0 B;  4DR4 O;  3E86 A;  5IWA B;  5IE9 A;  1GN3 A;  3AG1 B;  4JLX A;  3ISB A;  2LQT A;  5EBL C;  2ZNJ A;  4NXV A;  3ZN0 A;  5LHI A;  3N2G A;  4JAA A;  1RP3 B;  1ZUQ A;  9ICS A;  2ZHA A;  3SPG A;  3H1L H;  2IJI A;  1BMF G;  3OR7 C;  4UCT A;  2QR4 A;  3K75 D;  4PD4 F;  1M5I A;  4YHH B;  4I28 A;  1HNX O;  4U7N A;  3BPZ A;  5IYZ B;  4BAY A;  4LVS A;  1Q6I A;  3T4Z A;  1QLN A;  3OT7 A;  2M6Y A;  2QWN B;  1QLE C;  2QEX V;  5LXT A;  5TIS Z;  4KLO A;  2C2A A;  2AHY A;  3WB0 A;  3HX0 A;  4E8F A;  4JI3 O;  1B3Q A;  3C18 A;  3FFQ A;  3JAK A;  2LW1 A;  4JPR A;  2FYU H;  4ZI7 B;  5CP2 A;  3OTO O;  4UD4 A;  3TXS A;  1Y74 A;  2JRI A;  1SQF A;  9ICH A;  2PYL A;  4K96 A;  3JPR A;  4NXU A;  1XUQ A;  3JAW A;  2PUS A;  3HJ1 A;  2R9A A;  7ICK A;  1JQ0 A;  4JTA B;  4PA7 A;  1BQ0 A;  4JI8 O;  2JJ2 G;  1QBZ A;  2YIA A;  4P30 A;  4EB6 B;  3RVZ A;  2BCQ A;  2QGN A;  3CRQ A;  5GON B;  3B0X A;  8ICN A;  1IBM B;  4KB6 A;  4YIP A;  4AIL C;  4Z6E A;  4PA4 A;  5F2V O;  2ZH2 A;  2O1P A;  1YTF D;  2JEX A;  4B08 A;  5CB4 A;  4O69 A;  4R6Z A;  1N4C A;  3EVK A;  4YJ2 A;  1VF6 A;  2H3O A;  5IT9 N;  2AHZ A;  1NH2 B;  5E1A C;  3CYO A;  9ICI A;  3K08 A;  4LWS B;  1ZQJ A;  4IQU A;  2BOC C;  5J2H A;  2ZH4 A;  2YIC A;  1AI4 A;  2BPG A;  1KUQ A;  4LF9 B;  4UVC A;  3IC7 A;  4RPZ A;  5CHG A;  5JJE B;  2Z0A A;  2RDC A;  5JQG A;  1OCZ B;  4G27 B;  1K4D C;  4JGS A;  4JYY A;  2GV9 A;  2YUA A;  4NY8 A;  5CA0 A;  3OW2 U;  3CPW U;  4DV6 B;  4M47 A;  4YY3 B;  2P4V A;  3LK9 A;  3HKE B;  1OCO C;  1VQL V;  1THZ A;  1Y66 A;  3I55 V;  2WA3 A;  2X0L A;  3PNC A;  3H1J H;  4X8A A;  2B56 A;  4KLS A;  3RYF B;  3D36 C;  3WB1 A;  2ZE7 A;  3Q4H A;  3RYC A;  1HNZ B;  1ZQS A;  1SF9 A;  2XTA A;  2Y4T A;  1ZQO A;  4B3R O;  5H5N A;  3QTC A;  4JI1 B;  1XRE A;  1KP2 A;  2BCR A;  1XNQ O;  5C8Y A;  4FJC C;  3UQ2 A;  5FPR A;  2XAH A;  2E75 B;  3OGC C;  2ZR3 A;  2LGQ A;  4O2A A;  5LMN B;  1EN4 A;  1R8C A;  3WFQ E; 
#chains in the Genus database with same CATH homology
 4FHV A;  1MQ3 A;  1KNY A;  3H39 A;  4X4R A;  8ICZ A;  3AQN A;  2BPF A;  4MFA A;  7ICR A;  5IIJ A;  5J2D A;  5IIM A;  5D4B A;  2I9G A;  4QZ8 A;  2O5A A;  4QZF A;  1ZQK A;  4YD1 A;  4DOC A;  1ZQT A;  2BCU A;  4PGY A;  3OUY B;  4TUR A;  4EP7 A;  8ICA A;  4QZG A;  3C5G A;  4M9N A;  8ICY A;  4X4P A;  4PHA A;  4UB4 A;  4MFF A;  4I2G A;  3TFR A;  3ISC A;  2ZH1 A;  3AUO A;  3JZ0 A;  2ZH7 A;  4R65 A;  4NLN A;  4RWN A;  1OU5 A;  7ICE A;  8ICB A;  4QZC A;  4NLK A;  4MF2 A;  2ZH9 A;  3C66 A;  4NXZ A;  5J2G A;  3RJF A;  4LZD A;  5J2B A;  9ICU A;  1Q79 A;  1UET A;  2BE3 A;  4ATB B;  5HRL A;  4PGQ A;  4R63 A;  3MBY A;  8ICO A;  4RPY A;  4LZG A;  3HW8 A;  4KLG A;  5BOM A;  3OV7 A;  4O5E A;  9ICN A;  3C2M A;  3WFO A;  4M04 A;  3JPN A;  1BPE A;  3H37 A;  4E7X A;  4DOA A;  4KLQ A;  4O9M A;  9ICL A;  2FMP A;  2RFF A;  8ICX A;  4RWO A;  5HC9 A;  1BPX A;  3JPP A;  1F5A A;  8ICJ A;  4RQ7 A;  2PFO A;  4QZI A;  5DBC A;  2M2W A;  4WC0 A;  2ZH5 A;  4KLL A;  4MF8 A;  4YMM A;  1ZJM A;  3PMN A;  4P4M A;  1BPB A;  4LT6 A;  4JWN A;  1ZQH A;  4F5N A;  3RJI A;  4K4I A;  4F5Q A;  1FA0 A;  4AT9 A;  2BPC A;  4ATB A;  2DVI A;  4XQ7 A;  1XSL A;  4KLH A;  9ICX A;  5BOL A;  2ISO A;  2M2U A;  5DED A;  1MIY A;  4WC7 A;  1BPY A;  1ZQC A;  4KLI A;  1RPL A;  5HR9 A;  3L9D A;  5J0O A;  5D46 A;  5J2J A;  1VJ7 A;  5III A;  2GWS A;  1ZQP A;  5HRF A;  4I2F A;  2PFP A;  4KLT A;  5HHH A;  4M9L A;  1HUZ A;  3OGU A;  1VFG A;  8ICE A;  3AQM A;  3RJG A;  2DR5 A;  1TVA A;  2NRK A;  7ICF A;  7ICG A;  5CA7 A;  4UD5 A;  4RQ6 A;  2FMQ A;  4RT2 A;  5HHI A;  4FHW A;  4NKT A;  4RT3 A;  9ICR A;  2M2V A;  5CJ7 A;  4K4G A;  1XSP A;  7ICJ A;  4RQ0 A;  4PH5 A;  4F5P A;  4UBC A;  5BPC A;  4TUP A;  1ZQV A;  5J0W A;  2DR8 A;  2M2T A;  5DKW A;  3NYB A;  5TZV A;  4X4N A;  9ICP A;  4RPX A;  4UAZ A;  2ZH3 A;  8ICP A;  5CB1 A;  4XUS A;  4RQ8 A;  1ZJN A;  9ICK A;  4R66 A;  1ZQE A;  4NKU A;  4XA5 A;  3MDC A;  4RQ2 A;  4O5K A;  4RQ5 A;  3V7K A;  5J2F A;  7ICL A;  1PX5 A;  9ICE A;  2PFQ A;  1ZQG A;  3HWT A;  5IIL A;  1BPD A;  4TUS A;  1TFW A;  5DBA A;  4M9H A;  4Z6F A;  4WC2 A;  5DDM A;  8ICS A;  1ZQX A;  9ICT A;  5DB8 A;  4F5R A;  4WCW A;  4P4O A;  2PXI A;  1R8B A;  5DEC A;  2ZH8 A;  4M2Y A;  4MFC A;  4EBK A;  3JPO A;  4M0A A;  5J0U A;  3MGH A;  5HRK A;  4PPX A;  2ISP A;  5IIO A;  5J0P A;  4I2C A;  4JWM A;  4PHP A;  3UPS A;  1UEV A;  4UAW A;  1R8A A;  2BCV A;  2P66 A;  4O5C A;  8ICR A;  4RWP A;  1ZQU A;  9ICW A;  3GDX A;  3RJJ A;  2VAN A;  4M5D A;  5DB9 A;  4KLD A;  1ZQZ A;  1ZQF A;  4KLF A;  3C5F A;  8ICG A;  8ICL A;  2HHP A;  2W9M A;  4QZD A;  3OUY A;  3V72 A;  1WOT A;  8ICF A;  2DRA A;  3JPT A;  1MIV A;  4Z6C A;  4FH5 A;  4WC6 A;  4WC4 A;  5HRB A;  4AT8 B;  5IIK A;  1ZQA A;  1R89 A;  9ICQ A;  5J0S A;  9ICC A;  4RWQ A;  1TFY A;  4KLE A;  9ICA A;  4YD2 A;  3JPQ A;  7ICU A;  5J0Y A;  5HRH A;  4PGX A;  5CR0 A;  4X4V A;  1HUO A;  4QZA A;  1UEU A;  8ICI A;  9ICF A;  1ZQR A;  4IQV A;  3OVB A;  5HRE A;  5EOZ A;  1YLQ A;  4EBJ A;  4X0B A;  5IIN A;  1ZQI A;  3AQK A;  3RH4 A;  4IQT A;  1BPZ A;  4UB5 A;  3C2L A;  4M9G A;  3WFP A;  5J0T A;  3V7J A;  5HRD A;  4WC3 A;  3V7L A;  3RJK A;  4UAY A;  3RJE A;  1ZQN A;  7ICP A;  3H38 A;  4AT8 A;  4S3N A;  2IHM A;  9ICB A;  4GXK A;  2PBE A;  3RJH A;  4I27 A;  4YMN A;  4UB1 A;  9ICJ A;  3UXO A;  7ICQ A;  9ICV A;  1MQ2 A;  1ZQD A;  8ICK A;  4RQ3 A;  4I2H A;  4FH3 A;  4IG8 A;  4I2J A;  4R64 A;  8ICC A;  4QZE A;  1KEJ A;  2ZH6 A;  4GXJ A;  4X4Q A;  4GXI A;  1ZQM A;  4YMO A;  1KDH A;  3C2K A;  7ICI A;  4NLZ A;  4KLU A;  5J2C A;  3B0Y A;  4Z6D A;  8ICM A;  4FHX A;  1JQR A;  8ICT A;  5J2K A;  5DBB A;  3ISB A;  4E80 A;  4XRH A;  3WFR E;  9ICS A;  4X4U A;  2ZHA A;  3UXP A;  2BCS A;  3MGI A;  4UBB A;  4AT7 B;  4I2E A;  7ICM A;  3K75 D;  3AQL A;  4X0A A;  8ICH A;  4I28 A;  4QZB A;  5J2A A;  4P2H A;  8ICQ A;  4WBZ A;  4LVS A;  2DR9 A;  1ZQQ A;  4I2A A;  2PFN A;  4KLO A;  4WBY A;  5J2I A;  4AT9 B;  3UXN A;  1RZT A;  1ZQB A;  9ICM A;  3HX0 A;  4E8F A;  4UB2 A;  4DOB A;  4I2D A;  4X4S A;  4X4O A;  1Q78 A;  3C18 A;  4UB3 A;  4RQ4 A;  4P4P A;  3AU2 A;  5CP2 A;  4UD4 A;  3RH5 A;  1NOM A;  3HJ4 A;  1JAJ A;  9ICH A;  3JPR A;  3AU6 A;  3MDA A;  3HJ1 A;  7ICK A;  4PHD A;  4NM1 A;  7ICO A;  5J0R A;  5J0X A;  1NO5 A;  4PHE A;  4AT7 A;  3WFS C;  7ICV A;  2BCQ A;  3JYY A;  7ICT A;  1V4A A;  3B0X A;  8ICN A;  7ICN A;  4Z6E A;  5F2V O;  1ZQY A;  4FHY A;  4TUQ A;  2ZH2 A;  2O1P A;  3UQ0 A;  7ICH A;  9ICG A;  3ISD A;  3OVA A;  5J29 A;  3UPQ A;  4RQ1 A;  4NM2 A;  3JPS A;  7ICS A;  9ICI A;  9ICO A;  4YCX A;  4QZ9 A;  1ZQJ A;  4IQU A;  4DO9 A;  3HIY A;  5DB6 A;  1JMS A;  5J2H A;  2ZH4 A;  1XSN A;  4I29 A;  2DRB A;  8ICV A;  3LQC B;  4QZH A;  2BPG A;  4WC1 A;  2FMS A;  8ICW A;  4RPZ A;  5CHG A;  5DDY A;  4M9J A;  5CWR A;  4NY8 A;  5J2E A;  2Q66 A;  4M47 A;  3LK9 A;  5HRI A;  1ZQL A;  4I2I A;  3PNC A;  2ID1 A;  2DR7 A;  4KLS A;  1ZQS A;  2ZHB A;  5DB7 A;  3H3A A;  1ZQO A;  5HRG A;  3OVS A;  3RH6 A;  4KLJ A;  1ZQW A;  1TV9 A;  4WC5 A;  2BCR A;  3UQ2 A;  4I2B A;  4F5O A;  4IQW A;  4FHP A;  5J0Q A;  4XQ8 A;  4YN4 A;  4K4H A;  1MIW A;  3PML A;  5D49 A;  3TFS A;  4X5V A;  4KLM A;  1JN3 A;  4FO6 A;  8ICU A;  4X4T A;  1R8C A;  3WFQ E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...