5DEDA

Crystal structure of the small alarmone synthethase 1 from bacillus subtilis bound to its product pppgpp
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
198
structure length
196
Chain Sequence
DKQWERFLVPYRQAVEELKVKLKGIRTLYEYEDDHSPIEFVTGRVKPVASILEKARRKSIPLHEIETMQDIAGLRIMCQFVDDIQIVKEMLFARKDFTVVDQRDYIAEHKESGYRSYHLVVLYPLQTVSGEKHVLVEIQIRTLAMNFWATIEHSLNYKYSGNIPEKVKLRLQRASEAASRLDEEMSEIRGEVQEAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP pyrophosphokinase YjbM
publication title Catalytic mechanism and allosteric regulation of an oligomeric (p)ppGpp synthetase by an alarmone.
pubmed doi rcsb
source organism Bacillus subtilis py79
molecule tags Transferase
total genus 62
structure length 196
sequence length 198
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.6.5: GTP diphosphokinase.
pdb deposition date 2015-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04607 RelA_SpoT Region found in RelA / SpoT proteins
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.860 Mainly Alpha Orthogonal Bundle Helix Hairpins Nucleotidyltransferase 5dedA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5dedA01
3B0YA 8ICLA 5TZVA 1OU5A 5HRDA 3LK9A 3UXNA 5J0RA 4WC2A 1KNYA 4NXZA 9ICXA 5J0WA 4ATBA 3JPNA 7ICHA 3ISCA 4X4UA 3UXOA 3V7JA 5J0OA 4UB4A 2GWSA 1UEVA 4I2IA 1ZQLA 4UB2A 7ICEA 4RQ0A 2DR9A 4I2FA 5DEDA 3TFRA 4IQVA 4F5NA 8ICWA 5HRIA 3RJKA 5IIKA 2NRKA 2BE3A 7ICRA 7ICMA 4NM1A 2PFNA 4X5VA 4XQ8A 3HW8A 3ISDA 2BPCA 8ICQA 5DB6A 3UQ0A 4RWQA 4QZDA 3JPSA 4WC7A 4K4GA 3RJEA 2ISPA 4RWOA 4KLDA 4M9HA 7ICQA 4NM2A 1ZQMA 7ICKA 5DB9A 2ZHAA 9ICHA 3GDXA 4RWPA 5IIOA 2BPGA 7ICGA 4XUSA 7ICSA 1HUZA 3HJ1A 3ISBA 4O9MA 2M2UA 4WBZA 9ICPA 1ZQXA 3C66A 4O5EA 5IIMA 3HIYA 4LVSA 4YD1A 7ICTA 4RQ6A 5DB7A 1ZQZA 1ZQGA 1MIVA 5J2IA 2BPFA 4UBBA 3UQ2A 5DBBA 4KLEA 9ICSA 5DBCA 4QZEA 2P66A 5J2CA 4NKUA 4QZHA 4F5QA 5CWRA 5HRKA 5J0XA 4PHPA 3V72A 4M9JA 5HRGA 1XSPA 1JN3A 3WFSC 4M47A 4MFAA 2FMQA 9ICCA 4EBJA 4X0AA 4AT8B 2PBEA 4F5OA 4WC3A 1BPBA 4PGQA 3JZ0A 3RJJA 4PGYA 3AU6A 4KLIA 3RJIA 4DO9A 5D4BA 4AT9B 2I9GA 4EP7A 2M2VA 7ICVA 4LT6A 4FO6A 4UD4A 5CR0A 4TUPA 3MDCA 7ICUA 4R65A 3C18A 4I28A 3RJHA 5J0PA 4UB3A 1ZQCA 4KLSA 9ICVA 4AT8A 5J29A 5CB1A 4FHXA 4IQWA 4XA5A 4WC0A 4NKTA 4UBCA 4R64A 1ZQJA 2IHMA 5IINA 4YN4A 3C2MA 8ICVA 3RH4A 4AT9A 5BOLA 4QZBA 4P4PA 1XSLA 2DR5A 2O5AA 2M2WA 4UD5A 4JWNA 1JAJA 4RT2A 1XSNA 7ICFA 9ICQA 2ISOA 4PH5A 8ICEA 5J0YA 4KLHA 8ICTA 1Q79A 4RWNA 3RJFA 4PHAA 1UETA 4E7XA 4I2EA 3OVSA 8ICYA 1R8AA 4Z6FA 2ZH6A 1TV9A 4WC6A 4WBYA 1UEUA 4M04A 4X4PA 4TUQA 1VFGA 4LZDA 4KLQA 4YMOA 4WCWA 2Q66A 3LQCB 1TFYA 1ZJNA 4QZIA 2M2TA 9ICUA 5HR9A 1NO5A 3H37A 1R8BA 7ICPA 5J0QA 4AT7B 3H39A 1Q78A 4S3NA 4QZAA 1MQ2A 4YMMA 4GXIA 5BOMA 2HHPA 1MIYA 4NLZA 4KLFA 5J2GA 4UAWA 4X4TA 9ICFA 3H38A 4I29A 8ICSA 4IQTA 1KDHA 1WOTA 4I2CA 2VANA 5J2JA 5J2HA 3JYYA 1MIWA 5HC9A 5EOZA 4AT7A 4RQ8A 3RH5A 1JMSA 1HUOA 1TVAA 5CHGA 4I2DA 3WFPA 4X4OA 8ICOA 3JPTA 1ZQQA 5HRBA 4LZGA 5IIIA 2DRBA 2DVIA 5IIJA 2RFFA 4P2HA 5DDMA 3JPRA 4FHVA 1R89A 1BPDA 1V4AA 7ICLA 1YLQA 4M2YA 2FMSA 2ZH7A 3AQMA 8ICAA 5DB8A 4QZCA 4KLJA 2ZH9A 1PX5A 2PXIA 2BCUA 3V7KA 4X4QA 4Z6EA 2ID1A 1ZQEA 9ICMA 4DOCA 3V7LA 4PHEA 9ICJA 2BCQA 9ICKA 1NOMA 5J2BA 8ICZA 9ICNA 1ZQSA 2DR8A 8ICRA 4MFCA 3AUOA 8ICHA 8ICNA 1ZJMA 3C2KA 4PGXA 4NLNA 2ZH1A 4F5RA 5F2VO 3PMLA 2BCSA 4R66A 3JPQA 1MQ3A 9ICIA 4JWMA 5DECA 1ZQVA 4KLGA 4UAZA 9ICOA 9ICRA 3JPPA 1JQRA 1ZQDA 5CP2A 4RQ2A 4DOBA 4KLOA 4M0AA 2PFPA 4O5CA 4ATBB 2FMPA 4E8FA 4RPXA 5J0TA 4X4NA 4YCXA 3JPOA 4GXJA 7ICNA 4NLKA 3MBYA 4F5PA 5J2AA 3HJ4A 1ZQIA 4M9LA 8ICBA 4EBKA 2ZH2A 4I2JA 5DKWA 4RQ5A 2PFQA 4M9GA 1ZQOA 3C5FA 4RQ7A 8ICIA 4I2BA 9ICWA 3B0XA 4Z6CA 2DRAA 4UB5A 1ZQUA 5HRLA 4X4RA 2PFOA 5HHHA 4P4MA 5J2EA 8ICXA 4RT3A 3AQNA 1ZQYA 2ZH3A 1FA0A 4K4IA 4IQUA 5CJ7A 5J2DA 3NYBA 4KLTA 4UB1A 1ZQTA 4NY8A 3OVBA 3PMNA 7ICIA 3C5GA 9ICEA 4X4VA 4UAYA 8ICMA 1RPLA 4FHPA 4Z6DA 3MDAA 4P4OA 8ICKA 3MGHA 4MF8A 4I27A 2DR7A 9ICAA 1TFWA 4FHYA 5HHIA 4K4HA 4I2HA 1ZQAA 2ZH4A 4PHDA 3C2LA 5DDYA 5CA7A 3MGIA 4XQ7A 4GXKA 3AQKA 4IG8A 1ZQPA 4QZGA 4RQ3A 4RPZA 4RQ4A 3H3AA 2O1PA 3K75D 8ICJA 3AQLA 4TUSA 5D46A 3OUYB 1F5AA 5J0UA 5J0SA 3AU2A 4RQ1A 4PPXA 4M5DA 5J2FA 1R8CA 4MFFA 4QZ8A 3UXPA 4FH5A 1ZQBA 3HWTA 5IILA 8ICGA 1VJ7A 2BCRA 3OVAA 5HRFA 5DBAA 9ICGA 2BCVA 3L9DA 1RZTA 9ICLA 4YD2A 4KLLA 3WFQE 3RH6A 1BPZA 4MF2A 4KLUA 7ICOA 4DOAA 3UPQA 5D49A 3HX0A 3OUYA 1ZQWA 1ZQFA 3UPSA 4FHWA 9ICTA 2ZH5A 4I2AA 5HREA 4M9NA 3WFRE 2ZHBA 4XRHA 4I2GA 1KEJA 9ICBA 4YMNA 8ICUA 4O5KA 4TURA 3RJGA 5BPCA 1BPYA 7ICJA 1ZQRA 3PNCA 4WC1A 4KLMA 4QZFA 1BPEA 1ZQNA 4R63A 3WFOA 8ICFA 1ZQHA 4QZ9A 5J2KA 2W9MA 4FH3A 4X4SA 1ZQKA 3OGUA 5HRHA 1BPXA 8ICCA 4E80A 4X0BA 8ICPA 4RPYA 4WC5A 2ZH8A 4WC4A 3TFSA 3OV7A
chains in the Genus database with same CATH superfamily
2OCCB 5LYJA 3K5OA 4DW1A 8ICLA 1HR0B 1O9HA 4YJ3B 1IURA 1OCRB 5J0RA 2XUMA 1KNYA 5J0WA 2N04A 4P2ZA 3JPNA 1MSDA 1R3JC 4TSFG 4HX0A 3OWGA 3V7JA 4DV1B 2Q73A 4O2BA 1VARA 3F7VC 5EIBC 3QVNA 3L75H 5FNVA 1B6QA 1L0NH 1UEVA 3SDLA 1ZQLA 7ICEA 4I2FA 4J7KA 2LJ2A 1VQ9V 2EULA 1U96A 2BE3A 3K5NA 7ICMA 1NH2B 4YJ3A 3OT7A 4E4EA 5CBHA 2Y4UA 5GTHZ 1S77D 4RWQA 3JPSA 4JLZA 4LC1A 4FZ1A 2HJFC 4K4GA 2IJKA 1F23A 1K8AW 3RJEA 2BOBC 2GTAA 4YY3B 2WAMA 4NM2A 2ILMA 3SPHA 1JVMA 3GDXA 4W4LA 3E86A 1YHQV 1B3QA 1Y74B 3HJ1A 4WQLA 2O57A 4KP4A 3C66A 5IIMA 2EILC 4G27B 4YD1A 7ICTA 4K8VA 1VQNV 5DB7A 1ZQGA 4H33A 1MIVA 5J2UB 2DYSC 4DV6B 5J2IA 2BPFA 5KA6A 4UBBA 3AK2A 9ICSA 4QZEA 1TA8A 2IBZH 2GDSA 2JEXA 4NKUA 1Q7YW 3K5LA 3T2MA 4EFBA 3W7SA 4H44B 2ZDIC 1Y74A 2AHYA 1S0VA 4PHPA 4M9JA 1JN3A 1BS3A 3WFSC 2QJ1A 4N21A 1SQVH 3ASNB 3IC9A 3M99B 4UCVA 4AT8B 5J2UA 2JIZG 1BPBA 3FYIB 4NYKA 3VQVA 5IY5B 1JQ0A 4WFBV 4O4JB 3AU6A 2CE4A 4AT9B 2I9GA 2M2VA 1NU1H 4LT6A 1VQOV 4LF6B 2Q67A 4P30A 4PA3A 3I55V 5B1BB 4KFMA 5J0PA 2P67A 4PA7A 4DR1O 4MW8A 2UUBO 1US6A 5EIBD 4AT8A 1AI5A 3F5TA 4D7SA 3O9OA 3CEIA 1RM1C 4FHXA 5CB1A 4XA5A 4WC0A 4NKTA 3B8NA 4R64A 4O4JA 2F4VB 3C2MA 3HKBB 2YIDA 4AT9A 5BOLA 4QZBA 1ZSPA 1XSLA 1FXKA 2DR5A 2O5AA 5J2TB 4JI6O 3QNEA 2ZCEA 2P6JA 3OFNG 2R9IA 4BIOA 1S5JA 4DV4B 1DGSA 1KC8W 4B3SB 3RT3C 7ICFA 2E74B 4B3MO 2YXHA 1Q6UA 4O2AB 1XL6A 3CS5A 3ABMC 5LGNA 3OW2U 5KUKA 3OR7C 1Q79A 3HKBA 4RWNA 3RJFA 1LNQA 1N36O 4PHAA 4H13B 1TVKB 2IW5A 3ZMVA 3OM3B 4GZRB 1MZEA 3AEIA 1ZLZA 4CS4A 3OVSA 1R8AA 4R6ZA 2ZH6A 2K1EA 2N74A 3HKEB 2LGQA 3CE2A 1V55C 4WBYA 3L73H 4WC6A 4RO2A 1IZ3A 4LZDA 4AQYO 3RGBA 5DM6V 2EIMC 2ADPA 4GX5A 5JJNB 4D6TH 3CC4V 2QKCA 4O2AA 2RN9A 3HKCB 2M2TA 4OAIZ 3IAYA 2VRZA 4AT7B 3ZEDA 2ODMA 2EZOA 2ZKOA 3H39A 4EEBA 1TVKA 1HNZB 3QF7A 2QM7A 1YJNV 2Z0AA 3NR7A 5L3DA 3HKEA 5BR8O 2HHPA 1MIYA 5JTGA 1IBKO 2WLKA 5J2GA 5CA1B 2ATKC 1H8HG 4JYBA 1KDHA 1OCOC 2M7WA 3HKCA 2VWJA 3CRAA 4AT7A 2FMLA 2ZR2A 2ZQMA 3G80A 4MW3A 3E2EA 1HUOA 4O4LB 5CHGA 4X4OA 2ZR3A 3OUFA 1OHHG 1QR8A 4AILC 3EHBB 1NQTA 3BCCH 3U0ZA 2EWRA 3WG7B 3LUTB 2RFFA 4P2HA 5CA1A 1ZX3A 4K99A 4LFAO 4LR3A 4HYOA 1PNMA 2AHZA 3LDEA 3CC2V 4RQEA 2ZH7A 2HN1A 4DR5O 3AQMA 2ITCC 1PP9H 1UPGA 1P7GA 2V7QG 4X65O 1K73W 4O4LA 4I50B 4XBFA 2ID1A 2LW7A 4IL6Z 3MHSC 3B4SA 2XHBA 4PHEA 2PZSA 1F51A 4FLWA 4J7ZA 2R70A 1MZFA 2MK3A 2XAFA 3QTCA 5D5PA 8ICRA 1M56C 1JA8A 3JSNA 4O4IB 4DV2O 8ICNA 1OZ0A 2VQFO 5KA5A 4NLNA 3CMAV 2LO1A 2FYUH 4I50A 5F2VO 2OWOA 3PMLA 4JI5O 3EFFK 1MA1A 4CZZA 5DECA 1Q8IA 1IBLB 4UCRA 1XMOO 1SRYA 4UAZA 1VQLV 1M5IA 2XAGA 2HG5C 1SF9A 2YXLA 4WFGA 4DV5B 3ABLC 1WA8B 3APOA 3JARB 2ZNIA 4O4IA 3CHXA 5LHHA 4LF5B 2PFPA 4H0LB 4ATBB 2FMPA 3G6BA 2LQTA 4YCXA 4QIWF 4ZOLB 4GXJA 3X2QC 2GTSA 3MBYA 5D5QA 3HJ4A 4JYCA 1JX9A 3DC5A 3W7WA 5CFSA 3CB2A 2BBHA 4I0UA 1BCCH 2PFQA 4RQ5A 5LMNO 4NXVA 1VEWA 4RQ7A 1WA8A 3JYCA 4JI0O 3JARA 3B0XA 4DR4O 1CP9A 1K34A 3FYEB 4G28B 3E8FA 1R6KA 5HHHA 2WLJA 2PUSA 4ZOLA 3AQNA 5J2DA 1EN4A 1KECA 4KLTA 1ZQTA 1AILA 4NY8A 2HVKC 4FM2A 2WLMA 2UUCO 4LP8A 1RPLA 1YSCA 4NKGB 1EFRG 2DR7A 4TV8B 3T1YB 5C93A 2JS5A 4K4HA 1SQGA 2JGDB 4I2HA 3CRRA 1ZQAA 4YJ2B 4ZHQB 1NT2B 1PL4A 4DUYO 2R9RB 3K08A 5A2QN 2WWWA 3MGIA 1KUQA 1LUWA 3H1HH 2LFRA 4IG8A 4GUNA 3FD9A 1FS0G 2PF4E 2UU9O 4RPZA 1K7DA 3OMAB 4TV8A 3ZN0A 1SQPH 1I94O 3TGUH 2JGDA 8ICJA 4YJ2A 2HLDG 4ZHQA 5B5EZ 1F5AA 4O4HB 1AR1B 4WF9V 5J0SA 3E8GA 3OMIB 4CH4A 4RQ1A 5EC1C 4JYYA 2UXNA 1PD3A 1EBOA 2FTKA 4PELA 2AZ0A 3G67A 4DR7B 4B3RO 4CH6A 5E1AC 1GK9A 1ZQBA 3HWTA 4WFAV 4RQFA 2FL4A 1THZA 1GM9A 3OVAA 4UVAA 2CK3G 4KUMA 4FFKA 1YJWV 1RZTA 3VOUA 3ICXA 1VQMV 7ICOA 5L3EA 2UUAO 4FM0A 1OCZB 5B1OA 2EIKC 4OGQB 3LSSA 1AJPA 4HZ3A 4MT8A 1FPOA 3RYIB 3GB7C 4HNAB 1PNLA 2EZPA 4C7UA 1QLEC 2HJDA 4I2GA 8ICUA 1RFYA 4YHHB 4H37A 3ER9B 4X88A 5IWAO 7ICJA 2V4DA 1ZQRA 3PNCA 4WC1A 1Y76B 3MHHC 5B66Z 3CCRV 4R63A 3E89A 3BAAA 3H9VA 5B1AC 3WFOA 1GM8A 1N4CA 5BZBA 4JTDB 3RYIA 4HNAA 4X4SA 3F7YC 3MD0A 1H2MA 3WB2A 4DXWA 8ICCA 2EBOA 4EEDA 4RPYA 4PHZA 4WC4A 3OV7A 4MTFA 4UXNA 5TZVA 1OU5A 1Y76A 5FLXN 5HRDA 3LK9A 1QCEA 1RSOB 5LOVB 4WC2A 4NXZA 9ICXA 4X4UA 5J0OA 4DR6B 4I55B 3K03A 4UB4A 2BTQB 3NVOA 4I2IA 5B3SC 4JI6B 2ZM6B 3JATB 3SJCC 1H8EG 3QO5A 1OCCB 1K4DC 3SPIA 5KHJA 7ICRA 4NM1A 2GA9D 1OJHA 4X5VA 1RSOA 1AB3A 3HW8A 4TT3G 1Z5WA 1NZ6A 4UCSA 3LNMB 8ICQA 3FKSG 4QZDA 1GRJA 1VQ5V 3CCUV 4I55A 1KKDA 3D3IA 2BTQA 3MAQA 4X89A 2YUAA 1P49A 2OCCC 3JATA 3L74H 4FFBB 2JEUA 4ICGA 4M9HA 1OCRC 4K0KB 3K7DA 2CUGA 7ICQA 2QKSA 4MVSA 1WNSA 3OTOB 1M4UA 7ICKA 5DB9A 4LF9O 1FFXB 1HUZA 1DLBA 1R3LC 3ISBA 1YI2V 4LF4O 2M2UA 4WBZA 3R66A 9ICPA 1YIJV 3JCFA 4O5EA 4DRXB 4DV0B 1FXHA 3SJAC 4JI4O 4RQ6A 1VP7A 4GX2A 1XNRO 4LCUC 2ETNA 3AG4B 1AROP 1YTFD 4FFBA 4UVBA 2JJ2G 5J2CA 3ABTA 1YEWA 2B1IA 4F5QA 1LR1A 1SS3A 1FFXA 2QWRB 2DQ0A 4DRXA 1V54B 3ML0A 5H5NA 1MSWD 3JD4A 4F5OA 4WC3A 2CTRA 4PGQA 1XMQO 2R9AA 2Z3YA 4N23A 3K79A 2QWQB 4DO9A 5D4BA 4EP7A 4AI8A 7ICVA 4FO6A 3NXSA 3H01A 3MDCA 7ICUA 4L8JA 1FKAO 3C18A 2Y69B 4TQFA 4JZ2A 4DV3B 3RJHA 3WB1A 4KLSA 3U11A 3AG7A 2XOKG 4X66O 4FJCC 1ZQJA 2IHMA 1RP3B 5LMUB 2E5LO 4LEVA 3ETQA 1D2DA 5KMGB 1N34O 3RH4A 4FVMA 3L70H 3CD6V 3ASNC 2XTAA 4EB6B 4GKKB 1XSNA 2NNUA 1K33A 2B4VA 1Q82W 5IY5C 4LFBO 3UM7A 3A8TA 2VQFB 1SA0B 2HFEC 3G6EV 1QVFU 1AP6A 5J0YA 1FXKC 4JI5B 5KMGA 1XMOB 5B1BC 4MVOA 4E7XA 4I2EA 3C90A 2Q8VA 1R3IC 2WA4A 2KQXA 4F4LA 3G71V 1UEUA 4EB6A 1VFGA 1M57B 5FL7G 4YMOA 4WCWA 4WFFA 1SA0A 1TFYA 2H3OA 3UQ8A 5H6QA 9ICUA 1KP2A 5L3BA 3H37A 4NVPA 5HR9A 4CS2A 2IJHA 3U10A 2AGAA 1NH2D 2PI4A 5J0QA 3OR6C 5BXZA 1N33O 4DO2A 3ABKB 3RYHB 4YMMA 5K1PA 4NXTA 4GXIA 1AI4A 3P3PA 3CCMV 5D62A 2F23A 4DR4B 4NLZA 4XJEA 5HFLA 4X4TA 4ZIBA 1WOTA 4I2CA 3VQXA 2VANA 1R6TA 3HPLC 4FMTA 2ITDC 1IVSA 3JYYA 1GMGA 1RPRA 5EOZA 4JYAO 4UV8A 3RH5A 3NKUA 1TVAA 4I2DA 5LBQA 1XBLA 2DMXA 3H1LH 3RYHA 8ICOA 5HRBA 2HHHO 3WB0A 2UUCB 1SC5B 3KKYA 5IIJA 1KMIZ 1DF4A 1M90W 3JPRA 1R89A 1TUEB 5KHGA 4L87A 4UFZA 2Q5ZA 4I9WA 7ICLA 4I0XB 4M2YA 4WFEA 4O69A 8ICAA 2KB1A 3ZRWB 1M9NA 1YZBA 2BCUA 3HB3B 2CTWA 5JCOA 4JI8B 4X4QA 1EN6A 2CTPA 4GT1A 9ICMA 3J7AU 3V7LA 4GKJB 9ICJA 2HR3A 1I5XA 1KU9A 2Y0IA 1DK1A 4I0XA 8ICZA 3ZHVA 5LL6Y 2IM9A 1TUBB 3ZMUA 1ZQSA 1I94B 1YITV 2Q4PA 4QE9A 3AUOA 4MFCA 3ZRWA 4MVRA 4JI2O 4OPAA 3K9AA 4IT5A 2Y0PA 4PGXA 1N32B 2YIBA 5CBFA 1KKCA 3WG7C 3VBBA 9ICIA 2X6BA 1ZQVA 4YIOA 4JASA 4KLGA 1XOUA 3CPWU 4EV6A 4X20B 3JPPA 1JQRA 3OGIB 2RQ6A 1ZQDA 2UXXA 1TUBA 3A0HZ 3T1HO 2QDOA 4RQ2A 4KLOA 3T1CA 4E8FA 4JAVA 5J0TA 2OT5A 3JPOA 7ICNA 2IJIA 1AI6A 1R6NA 8ICBA 1H2LA 2BSKB 1SZTA 2YC0A 2FKXA 1ZAUA 4EBKA 5J2TA 2ZH2A 4X20A 3P3NA 5DKWA 1B06A 5IWAB 3C5FA 3CJHB 3DXRB 4LWSB 3SJBC 4K3AA 1VQKV 4I2BA 3ZN1A 2DRAA 3RN4A 2ZIOA 5HRLA 2PFOA 1IBMO 4P4MA 3KZIZ 1D5AA 1J5EB 2CTQA 2ZH3A 4P9OA 4K4IA 3JD3A 5CMUA 1SQBH 4MSWC 2BSKA 4UCUA 5IYCO 4JGSA 3PMNA 2JS3A 3JASB 3C5GA 4F6EA 3ETDA 4X4VA 2DYRB 3CJHA 3DXRA 3EVKA 4LWSA 5JH7B 5LHGA 1KQSU 2L6LA 1BQZA 2HN2A 4X64O 4P4OA 4NXNB 2PYJA 5AG2A 4I27A 4QGPA 3I56V 5JQGB 2VQEO 5HHIA 1HNWO 1S3JA 5J9PC 4G2KA 4DR2O 4PHDA 3UO2A 3L71H 3AK3A 4WOYA 3C2LA 1I08A 4DV7B 3JASA 1OV9A 3CCSV 3JD2A 3K0GA 4LEYA 5JH7A 3H1KH 5EBWC 2XAQA 3A0BZ 1KD1W 3P32A 4RQ3A 5EZYB 4RQ4A 1GN2A 4FLVA 5JQGA 3MCRA 2UXCO 4PDLA 1ORQC 3UO3A 2Q7HA 3AQLA 4CC5A 3QO8A 2JJ1G 3SYOA 2UXBO 5D46A 5J0UA 1XL4A 1LUVA 4M5DA 2W0FC 4MFFA 4MS2A 3I5DA 1K5SA 2AXTZ 2YSUB 3UXPA 4FH5A 2Y4TA 4JI7B 5EZYA 8ICGA 5FPOA 4LF4B 1XEQA 1VJ7A 2BCRA 4UCTA 9ICGA 2BCVA 3PN1A 9ICLA 4YD2A 4KLLA 1O9GA 3SYCA 3RH6A 4MF2A 4JI4B 4TV9B 3UPQA 2LW1A 5D49A 2IU3A 1FJGB 1VIBA 4FLTA 1I5YA 3OE7G 3UPSA 5CFTA 4FHWA 3STLC 4OX9B 4LEZA 4K35A 5K1XA 1NR7A 4I2AA 2HEPA 1Q6IA 3KCYA 4XRHA 5H2FZ 3AG2B 1SESA 3E22B 4JV5O 1B04A 4GX0A 4KLMA 1HR0O 1BPEA 4XDJA 3SPJA 4CS3A 1X59A 1XMQB 1YVWA 2RMKB 2A06H 4LFCO 3IFXA 4J7JA 1PM9A 5BMVB 4J42A 2EJ7A 4QJFB 3BRCA 4RAIA 4LF8O 1ZQKA 3FX7A 3E8HA 1E1RG 2AW9A 4WC5A 1K9MW 4NXMB 3E22A 1Q90D 4FIPC 4TQDA 3B0YA 1OCZC 4OAHA 1JFFB 5KLVH 3UXNA 3CCJV 1HNXB 4ATBA 4X66B 5L3GA 3ISCA 3AK1A 3UXOA 3CXHF 5IYBO 3ZRSA 1N34B 2GWSA 5BMVA 1EZVH 1N0JA 4UV9A 1U97A 3D36A 4UB2A 4RQ0A 5DEDA 4YY3O 3CCEV 2ZE6A 4IQVA 4F5NA 8ICWA 5HRIA 3RJKA 5CA3A 4O68A 2NRKA 5IIKA 1WP7A 3FFQA 5IE9A 1VF6A 4X1YB 4X1IB 1JFFA 2GHYA 2PFNA 3K06A 4LFBB 5GONB 4XQ8A 3ISDA 5LXTB 5DB6A 2QEXV 5KX5B 2B56A 5D63A 1NBMG 3O65A 1GM7A 3T4DA 5IJ0B 3ZMTA 3OEEG 4DV6O 1JPXA 3TXSA 2ISPA 4KLDA 3Q4HB 1BZKA 3S3WA 2Y48A 2B51A 4X1YA 4X1IA 4KM5A 2BOCC 4RWPA 5IIOA 4XUSA 2ADQB 5GONA 3ZJZA 1GN3A 2B1GA 5LXTA 1GN6A 1KYOF 4R8CA 5KX5A 1ZQXA 5KAIZ 4PV1B 1Q81W 2F95B 3HIYA 4WCEV 2R72A 1EM1A 1Y67A 4KB6A 2CH7B 1Y66A 4JPRA 5EK0A 4P9PA 5IJ0A 3ERCC 3UQ2A 2WLLB 3JAKB 5DBBA 4KLEA 1OCCC 3CCVV 3Q4HA 4MTXA 2P66A 3CYOA 4QZHA 1NVPB 4EGWA 2ARHA 4LF6O 3P30A 5HRKA 5EYPB 3THOA 1Q6HA 4E2LA 2B5UA 2W0XA 1XSPA 3TJTA 2FMQA 5D61A 2OIEA 2CH7A 4X0AA 3ZHRA 4BAYA 1MABG 4O4HA 2WLLA 2Q7EA 3JAKA 4PGYA 4KLIA 5DN6G 2HHHB 3RJIA 4CBCA 2NLJC 5IYDO 3JCUZ 2QKAA 1BT8A 3BEHA 3CMEV 5CR0A 5EYPA 4R65A 1YXBA 2A3QA 4DV4O 3K04A 4I4TB 4UB3A 1ZQCA 4MVUA 3AG4C 3ZMSA 2QA4V 1PPJH 5CB4B 1S76D 4PJ0Z 2ZXWB 4IQWA 3BHPA 1COWG 4UBCA 2DWDC 2ZIMA 5IINA 4NXUA 8ICVA 4DW0A 2Q0OC 2M6YA 2M2WA 4IYHA 1V54C 3BA9A 1JAJA 1ENVA 2JDIG 4DR1B 1BHBA 4MTGA 2UUBB 4JI2B 1HDJA 1XI1A 3OGCC 1I0HA 4LH7A 5CB4A 2EINB 4PH5A 8ICEA 4FLZA 4KLHA 1QU7A 2BBJA 1HNZO 2Y69C 2BTOA 1UETA 1VQ4V 8ICYA 4Z6FA 1V9PA 1M93A 4X4PA 4TUQA 2BCCH 2XASA 2D3OW 4KLQA 4BIZA 4K97A 1XHXA 2FCLA 4LBEC 4IIJB 4B3MB 2Q66A 4IGGA 3LQCB 5LOVA 3GVMA 5LP6B 1ZJNA 2GV9A 5HFMA 3IC7A 2HVJC 5CN0A 1NO5A 4QPJA 1R73A 3HR0A 4TWKA 1URFA 3ZRVA 4ZI7B 3IGAC 4DR3O 4MVQA 1N36B 2EX3A 1Q78A 4S3NA 4K98A 3R65A 4QZAA 1H2GA 3A0RA 1WPBA 3RYCB 1ZL8B 1NKDA 3N27A 4JAUA 2KKWA 4J80A 5KHKA 5LA6B 1CPYA 3FAVB 4AQYB 4UAWA 4GYCB 9ICFA 8ICSA 4IIJA 2A9HA 5LP6A 2P4KA 3B2EE 1VF5B 4RUEA 5J2HA 4ZBMA 4A5UB 1YDXA 2A0LA 4RUFA 4ZI7A 1KBHA 4RWUA 1W2BU 3APQA 3WFPA 4K96A 3RYCA 1M57C 1ZL8A 3ZRXA 3JPTA 4K9AA 1H2NA 4BW9A 4LZGA 5BR8B 5LA6A 3CXCU 2DRBA 1GTOA 3FAVA 1IBKB 4X64B 2DVIA 5DDMA 4FHVA 2E3CA 3RVZA 3J80N 2JRIA 5KUMA 4OAFA 1YLQA 1JCHA 2FMSA 2PTMA 4AHCA 5DB8A 1UFIA 4QZCA 2V1DA 4LF7O 3ABKC 3RVYA 2PXIA 2QWOB 1KP3A 3JAMN 4X62O 4R7CA 1ZQEA 1SQXH 2C2AA 3ABUA 1GH6A 1XREA 2QE7G 4LFAB 1HWYA 4DUZO 4DV5O 3TETA 3BFRA 4K9BA 3SR2C 9ICNA 2UXCB 4DR5B 5E79Z 2DR8A 5JCOC 2Q0AA 4CH3A 4LF5O 4NXWA 2UXBB 3C2KA 4X65B 2P4VA 4IHJB 3BA8A 4R66A 2BCSA 1MQ3A 3UCSC 1AP5A 4NR1A 3CRQA 5IJ9B 1P4RA 3EXAA 1I7FA 3OAAG 9ICOA 9ICRA 4D7TA 5CBGA 5LYJB 4UB6Z 2F66C 4U7NA 5CP2A 1QQCA 2LFSA 4DV2B 3OEHG 2IH3C 3H1IH 3C3SA 1QNMA 4IHJA 4MKPA 4NLKA 1JJ2U 1ZQIA 4GCZA 1EZJA 5IJ9A 4M9LA 1NJIW 2YXYA 4I7ZB 3SPGA 4JV5B 4M9GA 1EN5A 8ICIA 4UB5A 3FB7C 1M1KW 1ROPA 8ICXA 2ZT9B 4LFCB 3T1YO 3PHZA 1F7YA 3ZHQA 4F6RB 1AR5A 3NYBA 4LF8B 4UB1A 3AG1B 4WBNB 2X6AA 4DK1A 3WFVA 4EEQA 7ICIA 9ICEA 5LMNB 4UAYA 8ICMA 2ZINA 4JI0B 4KHPO 2LP7A 1YJ9V 2DN9A 3SJQC 3TK1A 8ICKA 2Q9LA 2YI8A 2YICA 4MF8A 4MVMA 3B8MA 2LGWA 1R3KC 1QHTA 3K59A 4BIUA 4J9YB 2UXDO 1VQPV 1GO3F 4F6RA 3K3WA 1X4TA 1BSMA 2YI9A 2ZH4A 4JI1O 4WBNA 4R50A 4YXWG 5DDYA 5CA7A 2N05A 3ETGA 2NN4A 1G1XB 3S3XA 3JCZA 1AR4A 2P90A 1AJQA 4DR7O 2Q6AA 3ASOB 1ZQPA 1H38A 1AI7A 2OTJV 1H2SB 1WB7A 4Q20A 1JOYA 1P7BA 2B9ZA 3KG2A 4EKWA 4FLUA 1NS1A 1YF2A 4B3TO 3H3AA 1PKXA 2X0LA 1CEZA 5CA0B 1J95A 3K75D 3N2KB 2PYLA 4TUSA 4U3FH 4DUYB 4FLYA 2YDEA 2DYRC 4Z1VA 5J2FA 2K9PA 1WB8A 1JJOA 3SYPA 2EIJB 1G8MA 3BVOA 1KB9F 5IILA 2UU9B 2YIBD 5B3PA 4YHHO 2IU0A 3ZHTA 5HRFA 3L9DA 3OTFA 3AG3B 4KLUA 4DOAA 3K0DA 2RNBA 1WN7A 5CA0A 5ITZB 3N2KA 3B40A 4QNHB 2E75B 3RFRA 1G6UA 3HX0A 4MVZA 5H9CA 4FO1A 3SGIA 5KHHA 4YIPA 2ZH5A 1Z5VA 5HREA 1FXKB 3WFRE 2ZHBA 4B3RB 1K4CC 2PY5A 1KEJA 4YMNA 1W59A 4N7RA 4TURA 4OXSA 3RJGA 4NTWA 5BPCA 3LDDA 5H6RA 4QZFA 5GTIZ 3G4SV 1VQ6V 3HKDB 1ZQNA 5ITZA 2UUAB 1N0NA 1ZQHA 2P7TC 2Z5UA 5J2KA 3W7TA 2IUBA 2F1MA 2W9MA 4DR6O 4Z1MG 2RJZA 1BL8A 1BPXA 2ZM6O 4X0BA 5EBLC 4ABMA 2D2CB 3F5WC 2QTOA 1MMMA 3HKDA 4QPKA 5L3FA 3GWOA 3JAWB 3ZCCA 1N8RW 4O67A 1SETA 3GWKC 4J11A 7ICHA 5IYZB 3AG2C 1SERA 2Q68A 2EILB 2DR9A 2W6IG 2H94A 3K5MA 3TFRA 2DYSB 4K0KO 3OTOO 4CH5A 1VQ7V 5JJEB 1R1BA 1TGOA 3FB6C 3JAWA 4BW5A 2BPCA 2HP8A 2WSSG 3M7MX 3CC7V 3UQ0A 3JALB 3STZC 3M8AA 3D3QA 1MNGA 3VQWA 5IYZA 2ZE7A 3D36C 4DV0O 3OUSA 1VQ8V 1HP8A 1NTMH 2XNDG 1T5EA 4WC7A 4LNUB 1F4MA 3DSQA 4RWOA 1VF6C 2H8PC 2ZD9A 2QGNA 1XILA 1ZQMA 3RWRD 3LNNA 2A7WA 2F43G 9ICHA 2ZHAA 7ICGA 1L8DA 2BPGA 7ICSA 3K57A 1QLNA 4FK5C 4O9MA 1DF5A 4TUYB 1Q5OA 3JALA 3J81N 4JF3A 5LGTA 2ZDIA 3K9SA 4LVSA 4DR3B 1ZQZA 4LNUA 2IJJA 3BABA 1K5QA 1XNQO 5DBCA 1MOFA 1K92A 4PDVA 2PI5A 1RM1B 2F93B 3CSXA 3CX5F 4BR6A 1ZUQA 4LF9B 5CWRA 5J0XA 4DV3O 3BY6A 3V72A 5HRGA 4TUYA 4M47A 3W7UA 4MFAA 4JAAA 4I5SA 1FYJA 9ICCA 2RCVA 3VQYA 1BGYH 4EBJA 1XNRB 4X9QA 4PDMA 2PBEA 4OPHA 3IJ4A 1VMGA 4B7EA 4LH6A 2OTLV 2GBOA 3JZ0A 3RJJA 5LMUO 4W4KA 3ABMB 1NR1A 5EC2C 4UD4A 4JI3O 4TUPA 4ZKIA 3ZX6A 3MDSA 4I28A 1ZTEA 2ZE5A 4GKKO 2JGUA 3TXQA 2VS0A 3LDCA 4LEWA 4PI0A 3DGEA 1V55B 4LF7B 2IHOA 9ICVA 3D8CA 1MG1A 4TV9A 4UUJC 5J29A 4NTXA 5KAFZ 4X62B 2EIMB 1SKVA 5C8YB 3UKMA 4DV1O 4YN4A 2ZNJA 4CC6A 4B7KA 3ZHUA 4P4PA 4WQKA 1S5HC 4FPPA 2P06A 1TAEA 2QSAA 1E1QG 4GX1A 1SQQH 4UD5A 4JWNA 4DUZB 4RT2A 1XDCA 4HBNA 9ICQA 2ISOA 2XAHA 3DTUB 1IX9A 2DW4A 2WLIB 3SYAA 5L3CA 2CDYA 2NR5A 2EJRA 3N2GB 5C8YA 8ICTA 5LGUA 2A79B 1OCOB 2E5LB 4O6AA 4OAGA 2Q69A 1G4YB 3JD1A 5EBMC 4FLXA 1TV9A 4Z2WA 4M04A 1PNKA 4XDLA 4PA9A 2ZXWC 2WLIA 4U7OA 4QZIA 1Y4MA 3CCLV 2X6CA 3N2GA 1R8BA 7ICPA 4FZ0A 4Q6GA 3FB5C 4UCOA 1NTKH 1MQ2A 2VWKA 2L35A 2CGOA 5BOMA 4GLXA 4KLFA 2EINC 1W0KG 2WLNA 3H38A 4I29A 2G38A 4J9ZB 5JJJB 4JTAB 4IQTA 4PI2A 4BWAA 1SZXA 3RBZA 4U3JB 3CRMA 5J2JA 1MIWA 5IT9N 1QVGU 5HC9A 3CK6A 1RPOA 2OIGA 1AVMA 4RQ8A 1Q43A 1JMSA 4NB5A 1M56B 4JI8O 1N33B 1ZQQA 2QM4A 1Y6XA 4X1KB 1E79G 1P84F 4KHPB 5IIIA 5LP6C 1YCIA 3T4ZA 4GKJO 1BMFG 2GSMB 3CWBH 1CXZB 4PA6A 5B3QA 1BHAA 1BPDA 4KL1A 3K58A 1V4AA 1W0JG 3EF2A 4U3JA 1BQ0A 2UXDB 1QBZA 4QE7A 1NVPD 4KXRA 5JVDB 1FAFA 3ABLB 1PX5A 5JWPA 2YEVB 4JYAB 2ZH9A 4KLJA 1HW7A 3V7KA 3OD4A 4JI1B 1N32O 3QO7A 4TOIA 4Z6EA 2DQ3A 2F4VO 1IXBA 1XHZA 2DOSA 1WP8A 4X1KA 4DOCA 2WPDG 3X2QB 2DE0X 4JLXA 3W7XA 2BCQA 3ER8C 9ICKA 1NOMA 4UVCA 5J2BA 2KG7B 4B3TB 4B3SO 3UT5B 3RW0A 8ICHA 5JVDA 2KSDA 2YEVA 1ZJMA 4JZGA 3ZBHA 2ZH1A 4F5RA 3CCQV 3JPQA 3OMNB 2XT9A 1F4NA 4JWMA 2DJVA 3JSLA 2GUZB 1FD9A 5IDJA 2KG7A 3ZMZA 4I4TA 3UT5A 4DOBA 1FFTB 1WJZA 3E35A 5TISZ 4NTYA 4M0AA 4O5CA 1J5EO 4RPXA 4X4NA 1IXMA 2W6JG 3B77A 4K8XA 1K3EA 4JTCB 1SQFA 4F5PA 2CAZC 1GAXA 5J2AA 1D5NA 4B08A 3TCUA 1PV0A 1L1FA 2GUZA 1NI8A 4I2JA 3E8BA 1S72V 1ZQOA 4PA4A 3NWIA 3A2FA 9ICWA 3T1HB 4Z6CA 4NXNO 4PDRA 1WPXA 3KCXA 1ZQUA 4X4RA 2FB5A 1JR9A 5J2EA 4RT3A 4NXXA 1ZQYA 1GKFA 1FA0A 4IQUA 5CJ7A 1S5LZ 4PD4F 3OVBA 1ZWIC 3BPZA 4I9QA 1Q86W 4DV7O 3CP1A 4MTOA 5LHIA 2AZ2A 3ZHSA 1NTZH 4FHPA 5KHIA 2QM8A 4Z6DA 3MDAA 4WFHA 2GAFD 4FM1A 3MGHA 1IBMB 2PGGA 4IYIA 2OYQA 3QG5A 2ZE8A 2CGNA 9ICAA 1TFWA 4FHYA 1H2KA 1QR9A 4DK0A 1Z2GA 3LSQA 3RYFB 2IH1C 3H1JH 2XAJA 1XQ8A 5BY1A 2EIKB 5CHEA 4XQ7A 4GXKA 1K97A 2E76B 2QTSA 3ZIAG 1GPJA 1WLEA 3AQKA 2MW2B 4JI7O 4K8ZA 4QZGA 2QWPB 4EFEA 1QLEB 1YTFB 3L72H 2VQEB 4J10A 3AG1C 1HNWB 2O1PA 1UJWB 2YS8A 4DR2B 2DWEC 1FJGO 3OUYB 3DC6A 1AJNA 2P5OA 4X8AA 3RYFA 3AU2A 3PJSK 5B1AB 4OX9O 4PPXA 1DTOA 3C3TA 1R8CA 2OCHA 3WU2Z 4WH5A 4QZ8A 1IBLO 1XUQA 4HAMA 5GW7A 2YIAA 1IDSA 1VF7A 3E83A 1L0LH 3JD0A 1GN4A 5FPRA 3CRCA 1A32A 5DBAA 4DYLA 3WFQE 1BPZA 4J41A 2QR4A 3SYQA 3OUYA 1ZQWA 1BE3H 2RDCA 1ZQFA 3FB8C 2X7RB 1FXVA 1XNQB 3ASOC 4XDKA 9ICTA 1JMKC 4UB8Z 2HKOA 4M9NA 5CFUA 9ICBA 1PL0A 4O5KA 5A9GA 2WLHA 4ASUG 4NXMO 5B3SB 1BPYA 3ETEA 1WAZA 2P22C 3ZS8C 3LSUA 2JVDA 3SPCA 8ICFA 1Q3EA 1HNXO 4QZ9A 2QWNB 2EIJC 2WA3A 4O2BB 2Q7GA 4FH3A 5FNVB 3OGUA 5HRHA 3B09A 4JI3B 2JK5C 4E80A 8ICPA 2ZH8A 3AG3C 3TFSA 5B1NA
chains in the Genus database with same CATH topology
3B0YA 8ICLA 5TZVA 1OU5A 5HRDA 3LK9A 3UXNA 5J0RA 4WC2A 1KNYA 4NXZA 9ICXA 5J0WA 4ATBA 3JPNA 7ICHA 3ISCA 4X4UA 3UXOA 3V7JA 5J0OA 4UB4A 2GWSA 1UEVA 4I2IA 1ZQLA 4UB2A 7ICEA 4RQ0A 2DR9A 4I2FA 5DEDA 3TFRA 4IQVA 4F5NA 8ICWA 5HRIA 3RJKA 5IIKA 2NRKA 2BE3A 7ICRA 7ICMA 4NM1A 2PFNA 4X5VA 4XQ8A 3HW8A 3ISDA 2BPCA 8ICQA 5DB6A 3UQ0A 4RWQA 4QZDA 3JPSA 4WC7A 4K4GA 3RJEA 2ISPA 4RWOA 4KLDA 4M9HA 7ICQA 4NM2A 1ZQMA 7ICKA 5DB9A 2ZHAA 9ICHA 3GDXA 4RWPA 5IIOA 2BPGA 7ICGA 4XUSA 7ICSA 1HUZA 3HJ1A 3ISBA 4O9MA 2M2UA 4WBZA 9ICPA 1ZQXA 3C66A 4O5EA 5IIMA 3HIYA 4LVSA 4YD1A 7ICTA 4RQ6A 5DB7A 1ZQZA 1ZQGA 1MIVA 5J2IA 2BPFA 4UBBA 3UQ2A 5DBBA 4KLEA 9ICSA 5DBCA 4QZEA 2P66A 5J2CA 4NKUA 4QZHA 4F5QA 5CWRA 5HRKA 5J0XA 4PHPA 3V72A 4M9JA 5HRGA 1XSPA 1JN3A 3WFSC 4M47A 4MFAA 2FMQA 9ICCA 4EBJA 4X0AA 4AT8B 2PBEA 4F5OA 4WC3A 1BPBA 4PGQA 3JZ0A 3RJJA 4PGYA 3AU6A 4KLIA 3RJIA 4DO9A 5D4BA 4AT9B 2I9GA 4EP7A 2M2VA 7ICVA 4LT6A 4FO6A 4UD4A 5CR0A 4TUPA 3MDCA 7ICUA 4R65A 3C18A 4I28A 3RJHA 5J0PA 4UB3A 1ZQCA 4KLSA 9ICVA 4AT8A 5J29A 5CB1A 4FHXA 4IQWA 4XA5A 4WC0A 4NKTA 4UBCA 4R64A 1ZQJA 2IHMA 5IINA 4YN4A 3C2MA 8ICVA 3RH4A 4AT9A 5BOLA 4QZBA 4P4PA 1XSLA 2DR5A 2O5AA 2M2WA 4UD5A 4JWNA 1JAJA 4RT2A 1XSNA 7ICFA 9ICQA 2ISOA 4PH5A 8ICEA 5J0YA 4KLHA 8ICTA 1Q79A 4RWNA 3RJFA 4PHAA 1UETA 4E7XA 4I2EA 3OVSA 8ICYA 1R8AA 4Z6FA 2ZH6A 1TV9A 4WC6A 4WBYA 1UEUA 4M04A 4X4PA 4TUQA 1VFGA 4LZDA 4KLQA 4YMOA 4WCWA 2Q66A 3LQCB 1TFYA 1ZJNA 4QZIA 2M2TA 9ICUA 5HR9A 1NO5A 3H37A 1R8BA 7ICPA 5J0QA 4AT7B 3H39A 1Q78A 4S3NA 4QZAA 1MQ2A 4YMMA 4GXIA 5BOMA 2HHPA 1MIYA 4NLZA 4KLFA 5J2GA 4UAWA 4X4TA 9ICFA 3H38A 4I29A 8ICSA 4IQTA 1KDHA 1WOTA 4I2CA 2VANA 5J2JA 5J2HA 3JYYA 1MIWA 5HC9A 5EOZA 4AT7A 4RQ8A 3RH5A 1JMSA 1HUOA 1TVAA 5CHGA 4I2DA 3WFPA 4X4OA 8ICOA 3JPTA 1ZQQA 5HRBA 4LZGA 5IIIA 2DRBA 2DVIA 5IIJA 2RFFA 4P2HA 5DDMA 3JPRA 4FHVA 1R89A 1BPDA 1V4AA 7ICLA 1YLQA 4M2YA 2FMSA 2ZH7A 3AQMA 8ICAA 5DB8A 4QZCA 4KLJA 2ZH9A 1PX5A 2PXIA 2BCUA 3V7KA 4X4QA 4Z6EA 2ID1A 1ZQEA 9ICMA 4DOCA 3V7LA 4PHEA 9ICJA 2BCQA 9ICKA 1NOMA 5J2BA 8ICZA 9ICNA 1ZQSA 2DR8A 8ICRA 4MFCA 3AUOA 8ICHA 8ICNA 1ZJMA 3C2KA 4PGXA 4NLNA 2ZH1A 4F5RA 5F2VO 3PMLA 2BCSA 4R66A 3JPQA 1MQ3A 9ICIA 4JWMA 5DECA 1ZQVA 4KLGA 4UAZA 9ICOA 9ICRA 3JPPA 1JQRA 1ZQDA 5CP2A 4RQ2A 4DOBA 4KLOA 4M0AA 2PFPA 4O5CA 4ATBB 2FMPA 4E8FA 4RPXA 5J0TA 4X4NA 4YCXA 3JPOA 4GXJA 7ICNA 4NLKA 3MBYA 4F5PA 5J2AA 3HJ4A 1ZQIA 4M9LA 8ICBA 4EBKA 2ZH2A 4I2JA 5DKWA 4RQ5A 2PFQA 4M9GA 1ZQOA 3C5FA 4RQ7A 8ICIA 4I2BA 9ICWA 3B0XA 4Z6CA 2DRAA 4UB5A 1ZQUA 5HRLA 4X4RA 2PFOA 5HHHA 4P4MA 5J2EA 8ICXA 4RT3A 3AQNA 1ZQYA 2ZH3A 1FA0A 4K4IA 4IQUA 5CJ7A 5J2DA 3NYBA 4KLTA 4UB1A 1ZQTA 4NY8A 3OVBA 3PMNA 7ICIA 3C5GA 9ICEA 4X4VA 4UAYA 8ICMA 1RPLA 4FHPA 4Z6DA 3MDAA 4P4OA 8ICKA 3MGHA 4MF8A 4I27A 2DR7A 9ICAA 1TFWA 4FHYA 5HHIA 4K4HA 4I2HA 1ZQAA 2ZH4A 4PHDA 3C2LA 5DDYA 5CA7A 3MGIA 4XQ7A 4GXKA 3AQKA 4IG8A 1ZQPA 4QZGA 4RQ3A 4RPZA 4RQ4A 3H3AA 2O1PA 3K75D 8ICJA 3AQLA 4TUSA 5D46A 3OUYB 1F5AA 5J0UA 5J0SA 3AU2A 4RQ1A 4PPXA 4M5DA 5J2FA 1R8CA 4MFFA 4QZ8A 3UXPA 4FH5A 1ZQBA 3HWTA 5IILA 8ICGA 1VJ7A 2BCRA 3OVAA 5HRFA 5DBAA 9ICGA 2BCVA 3L9DA 1RZTA 9ICLA 4YD2A 4KLLA 3WFQE 3RH6A 1BPZA 4MF2A 4KLUA 7ICOA 4DOAA 3UPQA 5D49A 3HX0A 3OUYA 1ZQWA 1ZQFA 3UPSA 4FHWA 9ICTA 2ZH5A 4I2AA 5HREA 4M9NA 3WFRE 2ZHBA 4XRHA 4I2GA 1KEJA 9ICBA 4YMNA 8ICUA 4O5KA 4TURA 3RJGA 5BPCA 1BPYA 7ICJA 1ZQRA 3PNCA 4WC1A 4KLMA 4QZFA 1BPEA 1ZQNA 4R63A 3WFOA 8ICFA 1ZQHA 4QZ9A 5J2KA 2W9MA 4FH3A 4X4SA 1ZQKA 3OGUA 5HRHA 1BPXA 8ICCA 4E80A 4X0BA 8ICPA 4RPYA 4WC5A 2ZH8A 4WC4A 3TFSA 3OV7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B0Y A;  8ICL A;  5TZV A;  1OU5 A;  5HRD A;  3LK9 A;  3UXN A;  5J0R A;  4WC2 A;  1KNY A;  4NXZ A;  9ICX A;  5J0W A;  4ATB A;  3JPN A;  7ICH A;  3ISC A;  4X4U A;  3UXO A;  3V7J A;  5J0O A;  4UB4 A;  2GWS A;  1UEV A;  4I2I A;  1ZQL A;  4UB2 A;  7ICE A;  4RQ0 A;  2DR9 A;  4I2F A;  5DED A;  3TFR A;  4IQV A;  4F5N A;  8ICW A;  5HRI A;  3RJK A;  5IIK A;  2NRK A;  2BE3 A;  7ICR A;  7ICM A;  4NM1 A;  2PFN A;  4X5V A;  4XQ8 A;  3HW8 A;  3ISD A;  2BPC A;  8ICQ A;  5DB6 A;  3UQ0 A;  4RWQ A;  4QZD A;  3JPS A;  4WC7 A;  4K4G A;  3RJE A;  2ISP A;  4RWO A;  4KLD A;  4M9H A;  7ICQ A;  4NM2 A;  1ZQM A;  7ICK A;  5DB9 A;  2ZHA A;  9ICH A;  3GDX A;  4RWP A;  5IIO A;  2BPG A;  7ICG A;  4XUS A;  7ICS A;  1HUZ A;  3HJ1 A;  3ISB A;  4O9M A;  2M2U A;  4WBZ A;  9ICP A;  1ZQX A;  3C66 A;  4O5E A;  5IIM A;  3HIY A;  4LVS A;  4YD1 A;  7ICT A;  4RQ6 A;  5DB7 A;  1ZQZ A;  1ZQG A;  1MIV A;  5J2I A;  2BPF A;  4UBB A;  3UQ2 A;  5DBB A;  4KLE A;  9ICS A;  5DBC A;  4QZE A;  2P66 A;  5J2C A;  4NKU A;  4QZH A;  4F5Q A;  5CWR A;  5HRK A;  5J0X A;  4PHP A;  3V72 A;  4M9J A;  5HRG A;  1XSP A;  1JN3 A;  3WFS C;  4M47 A;  4MFA A;  2FMQ A;  9ICC A;  4EBJ A;  4X0A A;  4AT8 B;  2PBE A;  4F5O A;  4WC3 A;  1BPB A;  4PGQ A;  3JZ0 A;  3RJJ A;  4PGY A;  3AU6 A;  4KLI A;  3RJI A;  4DO9 A;  5D4B A;  4AT9 B;  2I9G A;  4EP7 A;  2M2V A;  7ICV A;  4LT6 A;  4FO6 A;  4UD4 A;  5CR0 A;  4TUP A;  3MDC A;  7ICU A;  4R65 A;  3C18 A;  4I28 A;  3RJH A;  5J0P A;  4UB3 A;  1ZQC A;  4KLS A;  9ICV A;  4AT8 A;  5J29 A;  5CB1 A;  4FHX A;  4IQW A;  4XA5 A;  4WC0 A;  4NKT A;  4UBC A;  4R64 A;  1ZQJ A;  2IHM A;  5IIN A;  4YN4 A;  3C2M A;  8ICV A;  3RH4 A;  4AT9 A;  5BOL A;  4QZB A;  4P4P A;  1XSL A;  2DR5 A;  2O5A A;  2M2W A;  4UD5 A;  4JWN A;  1JAJ A;  4RT2 A;  1XSN A;  7ICF A;  9ICQ A;  2ISO A;  4PH5 A;  8ICE A;  5J0Y A;  4KLH A;  8ICT A;  1Q79 A;  4RWN A;  3RJF A;  4PHA A;  1UET A;  4E7X A;  4I2E A;  3OVS A;  8ICY A;  1R8A A;  4Z6F A;  2ZH6 A;  1TV9 A;  4WC6 A;  4WBY A;  1UEU A;  4M04 A;  4X4P A;  4TUQ A;  1VFG A;  4LZD A;  4KLQ A;  4YMO A;  4WCW A;  2Q66 A;  3LQC B;  1TFY A;  1ZJN A;  4QZI A;  2M2T A;  9ICU A;  5HR9 A;  1NO5 A;  3H37 A;  1R8B A;  7ICP A;  5J0Q A;  4AT7 B;  3H39 A;  1Q78 A;  4S3N A;  4QZA A;  1MQ2 A;  4YMM A;  4GXI A;  5BOM A;  2HHP A;  1MIY A;  4NLZ A;  4KLF A;  5J2G A;  4UAW A;  4X4T A;  9ICF A;  3H38 A;  4I29 A;  8ICS A;  4IQT A;  1KDH A;  1WOT A;  4I2C A;  2VAN A;  5J2J A;  5J2H A;  3JYY A;  1MIW A;  5HC9 A;  5EOZ A;  4AT7 A;  4RQ8 A;  3RH5 A;  1JMS A;  1HUO A;  1TVA A;  5CHG A;  4I2D A;  3WFP A;  4X4O A;  8ICO A;  3JPT A;  1ZQQ A;  5HRB A;  4LZG A;  5III A;  2DRB A;  2DVI A;  5IIJ A;  2RFF A;  4P2H A;  5DDM A;  3JPR A;  4FHV A;  1R89 A;  1BPD A;  1V4A A;  7ICL A;  1YLQ A;  4M2Y A;  2FMS A;  2ZH7 A;  3AQM A;  8ICA A;  5DB8 A;  4QZC A;  4KLJ A;  2ZH9 A;  1PX5 A;  2PXI A;  2BCU A;  3V7K A;  4X4Q A;  4Z6E A;  2ID1 A;  1ZQE A;  9ICM A;  4DOC A;  3V7L A;  4PHE A;  9ICJ A;  2BCQ A;  9ICK A;  1NOM A;  5J2B A;  8ICZ A;  9ICN A;  1ZQS A;  2DR8 A;  8ICR A;  4MFC A;  3AUO A;  8ICH A;  8ICN A;  1ZJM A;  3C2K A;  4PGX A;  4NLN A;  2ZH1 A;  4F5R A;  5F2V O;  3PML A;  2BCS A;  4R66 A;  3JPQ A;  1MQ3 A;  9ICI A;  4JWM A;  5DEC A;  1ZQV A;  4KLG A;  4UAZ A;  9ICO A;  9ICR A;  3JPP A;  1JQR A;  1ZQD A;  5CP2 A;  4RQ2 A;  4DOB A;  4KLO A;  4M0A A;  2PFP A;  4O5C A;  4ATB B;  2FMP A;  4E8F A;  4RPX A;  5J0T A;  4X4N A;  4YCX A;  3JPO A;  4GXJ A;  7ICN A;  4NLK A;  3MBY A;  4F5P A;  5J2A A;  3HJ4 A;  1ZQI A;  4M9L A;  8ICB A;  4EBK A;  2ZH2 A;  4I2J A;  5DKW A;  4RQ5 A;  2PFQ A;  4M9G A;  1ZQO A;  3C5F A;  4RQ7 A;  8ICI A;  4I2B A;  9ICW A;  3B0X A;  4Z6C A;  2DRA A;  4UB5 A;  1ZQU A;  5HRL A;  4X4R A;  2PFO A;  5HHH A;  4P4M A;  5J2E A;  8ICX A;  4RT3 A;  3AQN A;  1ZQY A;  2ZH3 A;  1FA0 A;  4K4I A;  4IQU A;  5CJ7 A;  5J2D A;  3NYB A;  4KLT A;  4UB1 A;  1ZQT A;  4NY8 A;  3OVB A;  3PMN A;  7ICI A;  3C5G A;  9ICE A;  4X4V A;  4UAY A;  8ICM A;  1RPL A;  4FHP A;  4Z6D A;  3MDA A;  4P4O A;  8ICK A;  3MGH A;  4MF8 A;  4I27 A;  2DR7 A;  9ICA A;  1TFW A;  4FHY A;  5HHI A;  4K4H A;  4I2H A;  1ZQA A;  2ZH4 A;  4PHD A;  3C2L A;  5DDY A;  5CA7 A;  3MGI A;  4XQ7 A;  4GXK A;  3AQK A;  4IG8 A;  1ZQP A;  4QZG A;  4RQ3 A;  4RPZ A;  4RQ4 A;  3H3A A;  2O1P A;  3K75 D;  8ICJ A;  3AQL A;  4TUS A;  5D46 A;  3OUY B;  1F5A A;  5J0U A;  5J0S A;  3AU2 A;  4RQ1 A;  4PPX A;  4M5D A;  5J2F A;  1R8C A;  4MFF A;  4QZ8 A;  3UXP A;  4FH5 A;  1ZQB A;  3HWT A;  5IIL A;  8ICG A;  1VJ7 A;  2BCR A;  3OVA A;  5HRF A;  5DBA A;  9ICG A;  2BCV A;  3L9D A;  1RZT A;  9ICL A;  4YD2 A;  4KLL A;  3WFQ E;  3RH6 A;  1BPZ A;  4MF2 A;  4KLU A;  7ICO A;  4DOA A;  3UPQ A;  5D49 A;  3HX0 A;  3OUY A;  1ZQW A;  1ZQF A;  3UPS A;  4FHW A;  9ICT A;  2ZH5 A;  4I2A A;  5HRE A;  4M9N A;  3WFR E;  2ZHB A;  4XRH A;  4I2G A;  1KEJ A;  9ICB A;  4YMN A;  8ICU A;  4O5K A;  4TUR A;  3RJG A;  5BPC A;  1BPY A;  7ICJ A;  1ZQR A;  3PNC A;  4WC1 A;  4KLM A;  4QZF A;  1BPE A;  1ZQN A;  4R63 A;  3WFO A;  8ICF A;  1ZQH A;  4QZ9 A;  5J2K A;  2W9M A;  4FH3 A;  4X4S A;  1ZQK A;  3OGU A;  5HRH A;  1BPX A;  8ICC A;  4E80 A;  4X0B A;  8ICP A;  4RPY A;  4WC5 A;  2ZH8 A;  4WC4 A;  3TFS A;  3OV7 A; 
#chains in the Genus database with same CATH topology
 2OCC B;  5LYJ A;  3K5O A;  4DW1 A;  8ICL A;  1HR0 B;  1O9H A;  4YJ3 B;  1IUR A;  1OCR B;  5J0R A;  2XUM A;  1KNY A;  5J0W A;  2N04 A;  4P2Z A;  3JPN A;  1MSD A;  1R3J C;  4TSF G;  4HX0 A;  3OWG A;  3V7J A;  4DV1 B;  2Q73 A;  4O2B A;  1VAR A;  3F7V C;  5EIB C;  3QVN A;  3L75 H;  5FNV A;  1B6Q A;  1L0N H;  1UEV A;  3SDL A;  1ZQL A;  7ICE A;  4I2F A;  4J7K A;  2LJ2 A;  1VQ9 V;  2EUL A;  1U96 A;  2BE3 A;  3K5N A;  7ICM A;  1NH2 B;  4YJ3 A;  3OT7 A;  4E4E A;  5CBH A;  2Y4U A;  5GTH Z;  1S77 D;  4RWQ A;  3JPS A;  4JLZ A;  4LC1 A;  4FZ1 A;  2HJF C;  4K4G A;  2IJK A;  1F23 A;  1K8A W;  3RJE A;  2BOB C;  2GTA A;  4YY3 B;  2WAM A;  4NM2 A;  2ILM A;  3SPH A;  1JVM A;  3GDX A;  4W4L A;  3E86 A;  1YHQ V;  1B3Q A;  1Y74 B;  3HJ1 A;  4WQL A;  2O57 A;  4KP4 A;  3C66 A;  5IIM A;  2EIL C;  4G27 B;  4YD1 A;  7ICT A;  4K8V A;  1VQN V;  5DB7 A;  1ZQG A;  4H33 A;  1MIV A;  5J2U B;  2DYS C;  4DV6 B;  5J2I A;  2BPF A;  5KA6 A;  4UBB A;  3AK2 A;  9ICS A;  4QZE A;  1TA8 A;  2IBZ H;  2GDS A;  2JEX A;  4NKU A;  1Q7Y W;  3K5L A;  3T2M A;  4EFB A;  3W7S A;  4H44 B;  2ZDI C;  1Y74 A;  2AHY A;  1S0V A;  4PHP A;  4M9J A;  1JN3 A;  1BS3 A;  3WFS C;  2QJ1 A;  4N21 A;  1SQV H;  3ASN B;  3IC9 A;  3M99 B;  4UCV A;  4AT8 B;  5J2U A;  2JIZ G;  1BPB A;  3FYI B;  4NYK A;  3VQV A;  5IY5 B;  1JQ0 A;  4WFB V;  4O4J B;  3AU6 A;  2CE4 A;  4AT9 B;  2I9G A;  2M2V A;  1NU1 H;  4LT6 A;  1VQO V;  4LF6 B;  2Q67 A;  4P30 A;  4PA3 A;  3I55 V;  5B1B B;  4KFM A;  5J0P A;  2P67 A;  4PA7 A;  4DR1 O;  4MW8 A;  2UUB O;  1US6 A;  5EIB D;  4AT8 A;  1AI5 A;  3F5T A;  4D7S A;  3O9O A;  3CEI A;  1RM1 C;  4FHX A;  5CB1 A;  4XA5 A;  4WC0 A;  4NKT A;  3B8N A;  4R64 A;  4O4J A;  2F4V B;  3C2M A;  3HKB B;  2YID A;  4AT9 A;  5BOL A;  4QZB A;  1ZSP A;  1XSL A;  1FXK A;  2DR5 A;  2O5A A;  5J2T B;  4JI6 O;  3QNE A;  2ZCE A;  2P6J A;  3OFN G;  2R9I A;  4BIO A;  1S5J A;  4DV4 B;  1DGS A;  1KC8 W;  4B3S B;  3RT3 C;  7ICF A;  2E74 B;  4B3M O;  2YXH A;  1Q6U A;  4O2A B;  1XL6 A;  3CS5 A;  3ABM C;  5LGN A;  3OW2 U;  5KUK A;  3OR7 C;  1Q79 A;  3HKB A;  4RWN A;  3RJF A;  1LNQ A;  1N36 O;  4PHA A;  4H13 B;  1TVK B;  2IW5 A;  3ZMV A;  3OM3 B;  4GZR B;  1MZE A;  3AEI A;  1ZLZ A;  4CS4 A;  3OVS A;  1R8A A;  4R6Z A;  2ZH6 A;  2K1E A;  2N74 A;  3HKE B;  2LGQ A;  3CE2 A;  1V55 C;  4WBY A;  3L73 H;  4WC6 A;  4RO2 A;  1IZ3 A;  4LZD A;  4AQY O;  3RGB A;  5DM6 V;  2EIM C;  2ADP A;  4GX5 A;  5JJN B;  4D6T H;  3CC4 V;  2QKC A;  4O2A A;  2RN9 A;  3HKC B;  2M2T A;  4OAI Z;  3IAY A;  2VRZ A;  4AT7 B;  3ZED A;  2ODM A;  2EZO A;  2ZKO A;  3H39 A;  4EEB A;  1TVK A;  1HNZ B;  3QF7 A;  2QM7 A;  1YJN V;  2Z0A A;  3NR7 A;  5L3D A;  3HKE A;  5BR8 O;  2HHP A;  1MIY A;  5JTG A;  1IBK O;  2WLK A;  5J2G A;  5CA1 B;  2ATK C;  1H8H G;  4JYB A;  1KDH A;  1OCO C;  2M7W A;  3HKC A;  2VWJ A;  3CRA A;  4AT7 A;  2FML A;  2ZR2 A;  2ZQM A;  3G80 A;  4MW3 A;  3E2E A;  1HUO A;  4O4L B;  5CHG A;  4X4O A;  2ZR3 A;  3OUF A;  1OHH G;  1QR8 A;  4AIL C;  3EHB B;  1NQT A;  3BCC H;  3U0Z A;  2EWR A;  3WG7 B;  3LUT B;  2RFF A;  4P2H A;  5CA1 A;  1ZX3 A;  4K99 A;  4LFA O;  4LR3 A;  4HYO A;  1PNM A;  2AHZ A;  3LDE A;  3CC2 V;  4RQE A;  2ZH7 A;  2HN1 A;  4DR5 O;  3AQM A;  2ITC C;  1PP9 H;  1UPG A;  1P7G A;  2V7Q G;  4X65 O;  1K73 W;  4O4L A;  4I50 B;  4XBF A;  2ID1 A;  2LW7 A;  4IL6 Z;  3MHS C;  3B4S A;  2XHB A;  4PHE A;  2PZS A;  1F51 A;  4FLW A;  4J7Z A;  2R70 A;  1MZF A;  2MK3 A;  2XAF A;  3QTC A;  5D5P A;  8ICR A;  1M56 C;  1JA8 A;  3JSN A;  4O4I B;  4DV2 O;  8ICN A;  1OZ0 A;  2VQF O;  5KA5 A;  4NLN A;  3CMA V;  2LO1 A;  2FYU H;  4I50 A;  5F2V O;  2OWO A;  3PML A;  4JI5 O;  3EFF K;  1MA1 A;  4CZZ A;  5DEC A;  1Q8I A;  1IBL B;  4UCR A;  1XMO O;  1SRY A;  4UAZ A;  1VQL V;  1M5I A;  2XAG A;  2HG5 C;  1SF9 A;  2YXL A;  4WFG A;  4DV5 B;  3ABL C;  1WA8 B;  3APO A;  3JAR B;  2ZNI A;  4O4I A;  3CHX A;  5LHH A;  4LF5 B;  2PFP A;  4H0L B;  4ATB B;  2FMP A;  3G6B A;  2LQT A;  4YCX A;  4QIW F;  4ZOL B;  4GXJ A;  3X2Q C;  2GTS A;  3MBY A;  5D5Q A;  3HJ4 A;  4JYC A;  1JX9 A;  3DC5 A;  3W7W A;  5CFS A;  3CB2 A;  2BBH A;  4I0U A;  1BCC H;  2PFQ A;  4RQ5 A;  5LMN O;  4NXV A;  1VEW A;  4RQ7 A;  1WA8 A;  3JYC A;  4JI0 O;  3JAR A;  3B0X A;  4DR4 O;  1CP9 A;  1K34 A;  3FYE B;  4G28 B;  3E8F A;  1R6K A;  5HHH A;  2WLJ A;  2PUS A;  4ZOL A;  3AQN A;  5J2D A;  1EN4 A;  1KEC A;  4KLT A;  1ZQT A;  1AIL A;  4NY8 A;  2HVK C;  4FM2 A;  2WLM A;  2UUC O;  4LP8 A;  1RPL A;  1YSC A;  4NKG B;  1EFR G;  2DR7 A;  4TV8 B;  3T1Y B;  5C93 A;  2JS5 A;  4K4H A;  1SQG A;  2JGD B;  4I2H A;  3CRR A;  1ZQA A;  4YJ2 B;  4ZHQ B;  1NT2 B;  1PL4 A;  4DUY O;  2R9R B;  3K08 A;  5A2Q N;  2WWW A;  3MGI A;  1KUQ A;  1LUW A;  3H1H H;  2LFR A;  4IG8 A;  4GUN A;  3FD9 A;  1FS0 G;  2PF4 E;  2UU9 O;  4RPZ A;  1K7D A;  3OMA B;  4TV8 A;  3ZN0 A;  1SQP H;  1I94 O;  3TGU H;  2JGD A;  8ICJ A;  4YJ2 A;  2HLD G;  4ZHQ A;  5B5E Z;  1F5A A;  4O4H B;  1AR1 B;  4WF9 V;  5J0S A;  3E8G A;  3OMI B;  4CH4 A;  4RQ1 A;  5EC1 C;  4JYY A;  2UXN A;  1PD3 A;  1EBO A;  2FTK A;  4PEL A;  2AZ0 A;  3G67 A;  4DR7 B;  4B3R O;  4CH6 A;  5E1A C;  1GK9 A;  1ZQB A;  3HWT A;  4WFA V;  4RQF A;  2FL4 A;  1THZ A;  1GM9 A;  3OVA A;  4UVA A;  2CK3 G;  4KUM A;  4FFK A;  1YJW V;  1RZT A;  3VOU A;  3ICX A;  1VQM V;  7ICO A;  5L3E A;  2UUA O;  4FM0 A;  1OCZ B;  5B1O A;  2EIK C;  4OGQ B;  3LSS A;  1AJP A;  4HZ3 A;  4MT8 A;  1FPO A;  3RYI B;  3GB7 C;  4HNA B;  1PNL A;  2EZP A;  4C7U A;  1QLE C;  2HJD A;  4I2G A;  8ICU A;  1RFY A;  4YHH B;  4H37 A;  3ER9 B;  4X88 A;  5IWA O;  7ICJ A;  2V4D A;  1ZQR A;  3PNC A;  4WC1 A;  1Y76 B;  3MHH C;  5B66 Z;  3CCR V;  4R63 A;  3E89 A;  3BAA A;  3H9V A;  5B1A C;  3WFO A;  1GM8 A;  1N4C A;  5BZB A;  4JTD B;  3RYI A;  4HNA A;  4X4S A;  3F7Y C;  3MD0 A;  1H2M A;  3WB2 A;  4DXW A;  8ICC A;  2EBO A;  4EED A;  4RPY A;  4PHZ A;  4WC4 A;  3OV7 A;  4MTF A;  4UXN A;  5TZV A;  1OU5 A;  1Y76 A;  5FLX N;  5HRD A;  3LK9 A;  1QCE A;  1RSO B;  5LOV B;  4WC2 A;  4NXZ A;  9ICX A;  4X4U A;  5J0O A;  4DR6 B;  4I55 B;  3K03 A;  4UB4 A;  2BTQ B;  3NVO A;  4I2I A;  5B3S C;  4JI6 B;  2ZM6 B;  3JAT B;  3SJC C;  1H8E G;  3QO5 A;  1OCC B;  1K4D C;  3SPI A;  5KHJ A;  7ICR A;  4NM1 A;  2GA9 D;  1OJH A;  4X5V A;  1RSO A;  1AB3 A;  3HW8 A;  4TT3 G;  1Z5W A;  1NZ6 A;  4UCS A;  3LNM B;  8ICQ A;  3FKS G;  4QZD A;  1GRJ A;  1VQ5 V;  3CCU V;  4I55 A;  1KKD A;  3D3I A;  2BTQ A;  3MAQ A;  4X89 A;  2YUA A;  1P49 A;  2OCC C;  3JAT A;  3L74 H;  4FFB B;  2JEU A;  4ICG A;  4M9H A;  1OCR C;  4K0K B;  3K7D A;  2CUG A;  7ICQ A;  2QKS A;  4MVS A;  1WNS A;  3OTO B;  1M4U A;  7ICK A;  5DB9 A;  4LF9 O;  1FFX B;  1HUZ A;  1DLB A;  1R3L C;  3ISB A;  1YI2 V;  4LF4 O;  2M2U A;  4WBZ A;  3R66 A;  9ICP A;  1YIJ V;  3JCF A;  4O5E A;  4DRX B;  4DV0 B;  1FXH A;  3SJA C;  4JI4 O;  4RQ6 A;  1VP7 A;  4GX2 A;  1XNR O;  4LCU C;  2ETN A;  3AG4 B;  1ARO P;  1YTF D;  4FFB A;  4UVB A;  2JJ2 G;  5J2C A;  3ABT A;  1YEW A;  2B1I A;  4F5Q A;  1LR1 A;  1SS3 A;  1FFX A;  2QWR B;  2DQ0 A;  4DRX A;  1V54 B;  3ML0 A;  5H5N A;  1MSW D;  3JD4 A;  4F5O A;  4WC3 A;  2CTR A;  4PGQ A;  1XMQ O;  2R9A A;  2Z3Y A;  4N23 A;  3K79 A;  2QWQ B;  4DO9 A;  5D4B A;  4EP7 A;  4AI8 A;  7ICV A;  4FO6 A;  3NXS A;  3H01 A;  3MDC A;  7ICU A;  4L8J A;  1FKA O;  3C18 A;  2Y69 B;  4TQF A;  4JZ2 A;  4DV3 B;  3RJH A;  3WB1 A;  4KLS A;  3U11 A;  3AG7 A;  2XOK G;  4X66 O;  4FJC C;  1ZQJ A;  2IHM A;  1RP3 B;  5LMU B;  2E5L O;  4LEV A;  3ETQ A;  1D2D A;  5KMG B;  1N34 O;  3RH4 A;  4FVM A;  3L70 H;  3CD6 V;  3ASN C;  2XTA A;  4EB6 B;  4GKK B;  1XSN A;  2NNU A;  1K33 A;  2B4V A;  1Q82 W;  5IY5 C;  4LFB O;  3UM7 A;  3A8T A;  2VQF B;  1SA0 B;  2HFE C;  3G6E V;  1QVF U;  1AP6 A;  5J0Y A;  1FXK C;  4JI5 B;  5KMG A;  1XMO B;  5B1B C;  4MVO A;  4E7X A;  4I2E A;  3C90 A;  2Q8V A;  1R3I C;  2WA4 A;  2KQX A;  4F4L A;  3G71 V;  1UEU A;  4EB6 A;  1VFG A;  1M57 B;  5FL7 G;  4YMO A;  4WCW A;  4WFF A;  1SA0 A;  1TFY A;  2H3O A;  3UQ8 A;  5H6Q A;  9ICU A;  1KP2 A;  5L3B A;  3H37 A;  4NVP A;  5HR9 A;  4CS2 A;  2IJH A;  3U10 A;  2AGA A;  1NH2 D;  2PI4 A;  5J0Q A;  3OR6 C;  5BXZ A;  1N33 O;  4DO2 A;  3ABK B;  3RYH B;  4YMM A;  5K1P A;  4NXT A;  4GXI A;  1AI4 A;  3P3P A;  3CCM V;  5D62 A;  2F23 A;  4DR4 B;  4NLZ A;  4XJE A;  5HFL A;  4X4T A;  4ZIB A;  1WOT A;  4I2C A;  3VQX A;  2VAN A;  1R6T A;  3HPL C;  4FMT A;  2ITD C;  1IVS A;  3JYY A;  1GMG A;  1RPR A;  5EOZ A;  4JYA O;  4UV8 A;  3RH5 A;  3NKU A;  1TVA A;  4I2D A;  5LBQ A;  1XBL A;  2DMX A;  3H1L H;  3RYH A;  8ICO A;  5HRB A;  2HHH O;  3WB0 A;  2UUC B;  1SC5 B;  3KKY A;  5IIJ A;  1KMI Z;  1DF4 A;  1M90 W;  3JPR A;  1R89 A;  1TUE B;  5KHG A;  4L87 A;  4UFZ A;  2Q5Z A;  4I9W A;  7ICL A;  4I0X B;  4M2Y A;  4WFE A;  4O69 A;  8ICA A;  2KB1 A;  3ZRW B;  1M9N A;  1YZB A;  2BCU A;  3HB3 B;  2CTW A;  5JCO A;  4JI8 B;  4X4Q A;  1EN6 A;  2CTP A;  4GT1 A;  9ICM A;  3J7A U;  3V7L A;  4GKJ B;  9ICJ A;  2HR3 A;  1I5X A;  1KU9 A;  2Y0I A;  1DK1 A;  4I0X A;  8ICZ A;  3ZHV A;  5LL6 Y;  2IM9 A;  1TUB B;  3ZMU A;  1ZQS A;  1I94 B;  1YIT V;  2Q4P A;  4QE9 A;  3AUO A;  4MFC A;  3ZRW A;  4MVR A;  4JI2 O;  4OPA A;  3K9A A;  4IT5 A;  2Y0P A;  4PGX A;  1N32 B;  2YIB A;  5CBF A;  1KKC A;  3WG7 C;  3VBB A;  9ICI A;  2X6B A;  1ZQV A;  4YIO A;  4JAS A;  4KLG A;  1XOU A;  3CPW U;  4EV6 A;  4X20 B;  3JPP A;  1JQR A;  3OGI B;  2RQ6 A;  1ZQD A;  2UXX A;  1TUB A;  3A0H Z;  3T1H O;  2QDO A;  4RQ2 A;  4KLO A;  3T1C A;  4E8F A;  4JAV A;  5J0T A;  2OT5 A;  3JPO A;  7ICN A;  2IJI A;  1AI6 A;  1R6N A;  8ICB A;  1H2L A;  2BSK B;  1SZT A;  2YC0 A;  2FKX A;  1ZAU A;  4EBK A;  5J2T A;  2ZH2 A;  4X20 A;  3P3N A;  5DKW A;  1B06 A;  5IWA B;  3C5F A;  3CJH B;  3DXR B;  4LWS B;  3SJB C;  4K3A A;  1VQK V;  4I2B A;  3ZN1 A;  2DRA A;  3RN4 A;  2ZIO A;  5HRL A;  2PFO A;  1IBM O;  4P4M A;  3KZI Z;  1D5A A;  1J5E B;  2CTQ A;  2ZH3 A;  4P9O A;  4K4I A;  3JD3 A;  5CMU A;  1SQB H;  4MSW C;  2BSK A;  4UCU A;  5IYC O;  4JGS A;  3PMN A;  2JS3 A;  3JAS B;  3C5G A;  4F6E A;  3ETD A;  4X4V A;  2DYR B;  3CJH A;  3DXR A;  3EVK A;  4LWS A;  5JH7 B;  5LHG A;  1KQS U;  2L6L A;  1BQZ A;  2HN2 A;  4X64 O;  4P4O A;  4NXN B;  2PYJ A;  5AG2 A;  4I27 A;  4QGP A;  3I56 V;  5JQG B;  2VQE O;  5HHI A;  1HNW O;  1S3J A;  5J9P C;  4G2K A;  4DR2 O;  4PHD A;  3UO2 A;  3L71 H;  3AK3 A;  4WOY A;  3C2L A;  1I08 A;  4DV7 B;  3JAS A;  1OV9 A;  3CCS V;  3JD2 A;  3K0G A;  4LEY A;  5JH7 A;  3H1K H;  5EBW C;  2XAQ A;  3A0B Z;  1KD1 W;  3P32 A;  4RQ3 A;  5EZY B;  4RQ4 A;  1GN2 A;  4FLV A;  5JQG A;  3MCR A;  2UXC O;  4PDL A;  1ORQ C;  3UO3 A;  2Q7H A;  3AQL A;  4CC5 A;  3QO8 A;  2JJ1 G;  3SYO A;  2UXB O;  5D46 A;  5J0U A;  1XL4 A;  1LUV A;  4M5D A;  2W0F C;  4MFF A;  4MS2 A;  3I5D A;  1K5S A;  2AXT Z;  2YSU B;  3UXP A;  4FH5 A;  2Y4T A;  4JI7 B;  5EZY A;  8ICG A;  5FPO A;  4LF4 B;  1XEQ A;  1VJ7 A;  2BCR A;  4UCT A;  9ICG A;  2BCV A;  3PN1 A;  9ICL A;  4YD2 A;  4KLL A;  1O9G A;  3SYC A;  3RH6 A;  4MF2 A;  4JI4 B;  4TV9 B;  3UPQ A;  2LW1 A;  5D49 A;  2IU3 A;  1FJG B;  1VIB A;  4FLT A;  1I5Y A;  3OE7 G;  3UPS A;  5CFT A;  4FHW A;  3STL C;  4OX9 B;  4LEZ A;  4K35 A;  5K1X A;  1NR7 A;  4I2A A;  2HEP A;  1Q6I A;  3KCY A;  4XRH A;  5H2F Z;  3AG2 B;  1SES A;  3E22 B;  4JV5 O;  1B04 A;  4GX0 A;  4KLM A;  1HR0 O;  1BPE A;  4XDJ A;  3SPJ A;  4CS3 A;  1X59 A;  1XMQ B;  1YVW A;  2RMK B;  2A06 H;  4LFC O;  3IFX A;  4J7J A;  1PM9 A;  5BMV B;  4J42 A;  2EJ7 A;  4QJF B;  3BRC A;  4RAI A;  4LF8 O;  1ZQK A;  3FX7 A;  3E8H A;  1E1R G;  2AW9 A;  4WC5 A;  1K9M W;  4NXM B;  3E22 A;  1Q90 D;  4FIP C;  4TQD A;  3B0Y A;  1OCZ C;  4OAH A;  1JFF B;  5KLV H;  3UXN A;  3CCJ V;  1HNX B;  4ATB A;  4X66 B;  5L3G A;  3ISC A;  3AK1 A;  3UXO A;  3CXH F;  5IYB O;  3ZRS A;  1N34 B;  2GWS A;  5BMV A;  1EZV H;  1N0J A;  4UV9 A;  1U97 A;  3D36 A;  4UB2 A;  4RQ0 A;  5DED A;  4YY3 O;  3CCE V;  2ZE6 A;  4IQV A;  4F5N A;  8ICW A;  5HRI A;  3RJK A;  5CA3 A;  4O68 A;  2NRK A;  5IIK A;  1WP7 A;  3FFQ A;  5IE9 A;  1VF6 A;  4X1Y B;  4X1I B;  1JFF A;  2GHY A;  2PFN A;  3K06 A;  4LFB B;  5GON B;  4XQ8 A;  3ISD A;  5LXT B;  5DB6 A;  2QEX V;  5KX5 B;  2B56 A;  5D63 A;  1NBM G;  3O65 A;  1GM7 A;  3T4D A;  5IJ0 B;  3ZMT A;  3OEE G;  4DV6 O;  1JPX A;  3TXS A;  2ISP A;  4KLD A;  3Q4H B;  1BZK A;  3S3W A;  2Y48 A;  2B51 A;  4X1Y A;  4X1I A;  4KM5 A;  2BOC C;  4RWP A;  5IIO A;  4XUS A;  2ADQ B;  5GON A;  3ZJZ A;  1GN3 A;  2B1G A;  5LXT A;  1GN6 A;  1KYO F;  4R8C A;  5KX5 A;  1ZQX A;  5KAI Z;  4PV1 B;  1Q81 W;  2F95 B;  3HIY A;  4WCE V;  2R72 A;  1EM1 A;  1Y67 A;  4KB6 A;  2CH7 B;  1Y66 A;  4JPR A;  5EK0 A;  4P9P A;  5IJ0 A;  3ERC C;  3UQ2 A;  2WLL B;  3JAK B;  5DBB A;  4KLE A;  1OCC C;  3CCV V;  3Q4H A;  4MTX A;  2P66 A;  3CYO A;  4QZH A;  1NVP B;  4EGW A;  2ARH A;  4LF6 O;  3P30 A;  5HRK A;  5EYP B;  3THO A;  1Q6H A;  4E2L A;  2B5U A;  2W0X A;  1XSP A;  3TJT A;  2FMQ A;  5D61 A;  2OIE A;  2CH7 A;  4X0A A;  3ZHR A;  4BAY A;  1MAB G;  4O4H A;  2WLL A;  2Q7E A;  3JAK A;  4PGY A;  4KLI A;  5DN6 G;  2HHH B;  3RJI A;  4CBC A;  2NLJ C;  5IYD O;  3JCU Z;  2QKA A;  1BT8 A;  3BEH A;  3CME V;  5CR0 A;  5EYP A;  4R65 A;  1YXB A;  2A3Q A;  4DV4 O;  3K04 A;  4I4T B;  4UB3 A;  1ZQC A;  4MVU A;  3AG4 C;  3ZMS A;  2QA4 V;  1PPJ H;  5CB4 B;  1S76 D;  4PJ0 Z;  2ZXW B;  4IQW A;  3BHP A;  1COW G;  4UBC A;  2DWD C;  2ZIM A;  5IIN A;  4NXU A;  8ICV A;  4DW0 A;  2Q0O C;  2M6Y A;  2M2W A;  4IYH A;  1V54 C;  3BA9 A;  1JAJ A;  1ENV A;  2JDI G;  4DR1 B;  1BHB A;  4MTG A;  2UUB B;  4JI2 B;  1HDJ A;  1XI1 A;  3OGC C;  1I0H A;  4LH7 A;  5CB4 A;  2EIN B;  4PH5 A;  8ICE A;  4FLZ A;  4KLH A;  1QU7 A;  2BBJ A;  1HNZ O;  2Y69 C;  2BTO A;  1UET A;  1VQ4 V;  8ICY A;  4Z6F A;  1V9P A;  1M93 A;  4X4P A;  4TUQ A;  2BCC H;  2XAS A;  2D3O W;  4KLQ A;  4BIZ A;  4K97 A;  1XHX A;  2FCL A;  4LBE C;  4IIJ B;  4B3M B;  2Q66 A;  4IGG A;  3LQC B;  5LOV A;  3GVM A;  5LP6 B;  1ZJN A;  2GV9 A;  5HFM A;  3IC7 A;  2HVJ C;  5CN0 A;  1NO5 A;  4QPJ A;  1R73 A;  3HR0 A;  4TWK A;  1URF A;  3ZRV A;  4ZI7 B;  3IGA C;  4DR3 O;  4MVQ A;  1N36 B;  2EX3 A;  1Q78 A;  4S3N A;  4K98 A;  3R65 A;  4QZA A;  1H2G A;  3A0R A;  1WPB A;  3RYC B;  1ZL8 B;  1NKD A;  3N27 A;  4JAU A;  2KKW A;  4J80 A;  5KHK A;  5LA6 B;  1CPY A;  3FAV B;  4AQY B;  4UAW A;  4GYC B;  9ICF A;  8ICS A;  4IIJ A;  2A9H A;  5LP6 A;  2P4K A;  3B2E E;  1VF5 B;  4RUE A;  5J2H A;  4ZBM A;  4A5U B;  1YDX A;  2A0L A;  4RUF A;  4ZI7 A;  1KBH A;  4RWU A;  1W2B U;  3APQ A;  3WFP A;  4K96 A;  3RYC A;  1M57 C;  1ZL8 A;  3ZRX A;  3JPT A;  4K9A A;  1H2N A;  4BW9 A;  4LZG A;  5BR8 B;  5LA6 A;  3CXC U;  2DRB A;  1GTO A;  3FAV A;  1IBK B;  4X64 B;  2DVI A;  5DDM A;  4FHV A;  2E3C A;  3RVZ A;  3J80 N;  2JRI A;  5KUM A;  4OAF A;  1YLQ A;  1JCH A;  2FMS A;  2PTM A;  4AHC A;  5DB8 A;  1UFI A;  4QZC A;  2V1D A;  4LF7 O;  3ABK C;  3RVY A;  2PXI A;  2QWO B;  1KP3 A;  3JAM N;  4X62 O;  4R7C A;  1ZQE A;  1SQX H;  2C2A A;  3ABU A;  1GH6 A;  1XRE A;  2QE7 G;  4LFA B;  1HWY A;  4DUZ O;  4DV5 O;  3TET A;  3BFR A;  4K9B A;  3SR2 C;  9ICN A;  2UXC B;  4DR5 B;  5E79 Z;  2DR8 A;  5JCO C;  2Q0A A;  4CH3 A;  4LF5 O;  4NXW A;  2UXB B;  3C2K A;  4X65 B;  2P4V A;  4IHJ B;  3BA8 A;  4R66 A;  2BCS A;  1MQ3 A;  3UCS C;  1AP5 A;  4NR1 A;  3CRQ A;  5IJ9 B;  1P4R A;  3EXA A;  1I7F A;  3OAA G;  9ICO A;  9ICR A;  4D7T A;  5CBG A;  5LYJ B;  4UB6 Z;  2F66 C;  4U7N A;  5CP2 A;  1QQC A;  2LFS A;  4DV2 B;  3OEH G;  2IH3 C;  3H1I H;  3C3S A;  1QNM A;  4IHJ A;  4MKP A;  4NLK A;  1JJ2 U;  1ZQI A;  4GCZ A;  1EZJ A;  5IJ9 A;  4M9L A;  1NJI W;  2YXY A;  4I7Z B;  3SPG A;  4JV5 B;  4M9G A;  1EN5 A;  8ICI A;  4UB5 A;  3FB7 C;  1M1K W;  1ROP A;  8ICX A;  2ZT9 B;  4LFC B;  3T1Y O;  3PHZ A;  1F7Y A;  3ZHQ A;  4F6R B;  1AR5 A;  3NYB A;  4LF8 B;  4UB1 A;  3AG1 B;  4WBN B;  2X6A A;  4DK1 A;  3WFV A;  4EEQ A;  7ICI A;  9ICE A;  5LMN B;  4UAY A;  8ICM A;  2ZIN A;  4JI0 B;  4KHP O;  2LP7 A;  1YJ9 V;  2DN9 A;  3SJQ C;  3TK1 A;  8ICK A;  2Q9L A;  2YI8 A;  2YIC A;  4MF8 A;  4MVM A;  3B8M A;  2LGW A;  1R3K C;  1QHT A;  3K59 A;  4BIU A;  4J9Y B;  2UXD O;  1VQP V;  1GO3 F;  4F6R A;  3K3W A;  1X4T A;  1BSM A;  2YI9 A;  2ZH4 A;  4JI1 O;  4WBN A;  4R50 A;  4YXW G;  5DDY A;  5CA7 A;  2N05 A;  3ETG A;  2NN4 A;  1G1X B;  3S3X A;  3JCZ A;  1AR4 A;  2P90 A;  1AJQ A;  4DR7 O;  2Q6A A;  3ASO B;  1ZQP A;  1H38 A;  1AI7 A;  2OTJ V;  1H2S B;  1WB7 A;  4Q20 A;  1JOY A;  1P7B A;  2B9Z A;  3KG2 A;  4EKW A;  4FLU A;  1NS1 A;  1YF2 A;  4B3T O;  3H3A A;  1PKX A;  2X0L A;  1CEZ A;  5CA0 B;  1J95 A;  3K75 D;  3N2K B;  2PYL A;  4TUS A;  4U3F H;  4DUY B;  4FLY A;  2YDE A;  2DYR C;  4Z1V A;  5J2F A;  2K9P A;  1WB8 A;  1JJO A;  3SYP A;  2EIJ B;  1G8M A;  3BVO A;  1KB9 F;  5IIL A;  2UU9 B;  2YIB D;  5B3P A;  4YHH O;  2IU0 A;  3ZHT A;  5HRF A;  3L9D A;  3OTF A;  3AG3 B;  4KLU A;  4DOA A;  3K0D A;  2RNB A;  1WN7 A;  5CA0 A;  5ITZ B;  3N2K A;  3B40 A;  4QNH B;  2E75 B;  3RFR A;  1G6U A;  3HX0 A;  4MVZ A;  5H9C A;  4FO1 A;  3SGI A;  5KHH A;  4YIP A;  2ZH5 A;  1Z5V A;  5HRE A;  1FXK B;  3WFR E;  2ZHB A;  4B3R B;  1K4C C;  2PY5 A;  1KEJ A;  4YMN A;  1W59 A;  4N7R A;  4TUR A;  4OXS A;  3RJG A;  4NTW A;  5BPC A;  3LDD A;  5H6R A;  4QZF A;  5GTI Z;  3G4S V;  1VQ6 V;  3HKD B;  1ZQN A;  5ITZ A;  2UUA B;  1N0N A;  1ZQH A;  2P7T C;  2Z5U A;  5J2K A;  3W7T A;  2IUB A;  2F1M A;  2W9M A;  4DR6 O;  4Z1M G;  2RJZ A;  1BL8 A;  1BPX A;  2ZM6 O;  4X0B A;  5EBL C;  4ABM A;  2D2C B;  3F5W C;  2QTO A;  1MMM A;  3HKD A;  4QPK A;  5L3F A;  3GWO A;  3JAW B;  3ZCC A;  1N8R W;  4O67 A;  1SET A;  3GWK C;  4J11 A;  7ICH A;  5IYZ B;  3AG2 C;  1SER A;  2Q68 A;  2EIL B;  2DR9 A;  2W6I G;  2H94 A;  3K5M A;  3TFR A;  2DYS B;  4K0K O;  3OTO O;  4CH5 A;  1VQ7 V;  5JJE B;  1R1B A;  1TGO A;  3FB6 C;  3JAW A;  4BW5 A;  2BPC A;  2HP8 A;  2WSS G;  3M7M X;  3CC7 V;  3UQ0 A;  3JAL B;  3STZ C;  3M8A A;  3D3Q A;  1MNG A;  3VQW A;  5IYZ A;  2ZE7 A;  3D36 C;  4DV0 O;  3OUS A;  1VQ8 V;  1HP8 A;  1NTM H;  2XND G;  1T5E A;  4WC7 A;  4LNU B;  1F4M A;  3DSQ A;  4RWO A;  1VF6 C;  2H8P C;  2ZD9 A;  2QGN A;  1XIL A;  1ZQM A;  3RWR D;  3LNN A;  2A7W A;  2F43 G;  9ICH A;  2ZHA A;  7ICG A;  1L8D A;  2BPG A;  7ICS A;  3K57 A;  1QLN A;  4FK5 C;  4O9M A;  1DF5 A;  4TUY B;  1Q5O A;  3JAL A;  3J81 N;  4JF3 A;  5LGT A;  2ZDI A;  3K9S A;  4LVS A;  4DR3 B;  1ZQZ A;  4LNU A;  2IJJ A;  3BAB A;  1K5Q A;  1XNQ O;  5DBC A;  1MOF A;  1K92 A;  4PDV A;  2PI5 A;  1RM1 B;  2F93 B;  3CSX A;  3CX5 F;  4BR6 A;  1ZUQ A;  4LF9 B;  5CWR A;  5J0X A;  4DV3 O;  3BY6 A;  3V72 A;  5HRG A;  4TUY A;  4M47 A;  3W7U A;  4MFA A;  4JAA A;  4I5S A;  1FYJ A;  9ICC A;  2RCV A;  3VQY A;  1BGY H;  4EBJ A;  1XNR B;  4X9Q A;  4PDM A;  2PBE A;  4OPH A;  3IJ4 A;  1VMG A;  4B7E A;  4LH6 A;  2OTL V;  2GBO A;  3JZ0 A;  3RJJ A;  5LMU O;  4W4K A;  3ABM B;  1NR1 A;  5EC2 C;  4UD4 A;  4JI3 O;  4TUP A;  4ZKI A;  3ZX6 A;  3MDS A;  4I28 A;  1ZTE A;  2ZE5 A;  4GKK O;  2JGU A;  3TXQ A;  2VS0 A;  3LDC A;  4LEW A;  4PI0 A;  3DGE A;  1V55 B;  4LF7 B;  2IHO A;  9ICV A;  3D8C A;  1MG1 A;  4TV9 A;  4UUJ C;  5J29 A;  4NTX A;  5KAF Z;  4X62 B;  2EIM B;  1SKV A;  5C8Y B;  3UKM A;  4DV1 O;  4YN4 A;  2ZNJ A;  4CC6 A;  4B7K A;  3ZHU A;  4P4P A;  4WQK A;  1S5H C;  4FPP A;  2P06 A;  1TAE A;  2QSA A;  1E1Q G;  4GX1 A;  1SQQ H;  4UD5 A;  4JWN A;  4DUZ B;  4RT2 A;  1XDC A;  4HBN A;  9ICQ A;  2ISO A;  2XAH A;  3DTU B;  1IX9 A;  2DW4 A;  2WLI B;  3SYA A;  5L3C A;  2CDY A;  2NR5 A;  2EJR A;  3N2G B;  5C8Y A;  8ICT A;  5LGU A;  2A79 B;  1OCO B;  2E5L B;  4O6A A;  4OAG A;  2Q69 A;  1G4Y B;  3JD1 A;  5EBM C;  4FLX A;  1TV9 A;  4Z2W A;  4M04 A;  1PNK A;  4XDL A;  4PA9 A;  2ZXW C;  2WLI A;  4U7O A;  4QZI A;  1Y4M A;  3CCL V;  2X6C A;  3N2G A;  1R8B A;  7ICP A;  4FZ0 A;  4Q6G A;  3FB5 C;  4UCO A;  1NTK H;  1MQ2 A;  2VWK A;  2L35 A;  2CGO A;  5BOM A;  4GLX A;  4KLF A;  2EIN C;  1W0K G;  2WLN A;  3H38 A;  4I29 A;  2G38 A;  4J9Z B;  5JJJ B;  4JTA B;  4IQT A;  4PI2 A;  4BWA A;  1SZX A;  3RBZ A;  4U3J B;  3CRM A;  5J2J A;  1MIW A;  5IT9 N;  1QVG U;  5HC9 A;  3CK6 A;  1RPO A;  2OIG A;  1AVM A;  4RQ8 A;  1Q43 A;  1JMS A;  4NB5 A;  1M56 B;  4JI8 O;  1N33 B;  1ZQQ A;  2QM4 A;  1Y6X A;  4X1K B;  1E79 G;  1P84 F;  4KHP B;  5III A;  5LP6 C;  1YCI A;  3T4Z A;  4GKJ O;  1BMF G;  2GSM B;  3CWB H;  1CXZ B;  4PA6 A;  5B3Q A;  1BHA A;  1BPD A;  4KL1 A;  3K58 A;  1V4A A;  1W0J G;  3EF2 A;  4U3J A;  1BQ0 A;  2UXD B;  1QBZ A;  4QE7 A;  1NVP D;  4KXR A;  5JVD B;  1FAF A;  3ABL B;  1PX5 A;  5JWP A;  2YEV B;  4JYA B;  2ZH9 A;  4KLJ A;  1HW7 A;  3V7K A;  3OD4 A;  4JI1 B;  1N32 O;  3QO7 A;  4TOI A;  4Z6E A;  2DQ3 A;  2F4V O;  1IXB A;  1XHZ A;  2DOS A;  1WP8 A;  4X1K A;  4DOC A;  2WPD G;  3X2Q B;  2DE0 X;  4JLX A;  3W7X A;  2BCQ A;  3ER8 C;  9ICK A;  1NOM A;  4UVC A;  5J2B A;  2KG7 B;  4B3T B;  4B3S O;  3UT5 B;  3RW0 A;  8ICH A;  5JVD A;  2KSD A;  2YEV A;  1ZJM A;  4JZG A;  3ZBH A;  2ZH1 A;  4F5R A;  3CCQ V;  3JPQ A;  3OMN B;  2XT9 A;  1F4N A;  4JWM A;  2DJV A;  3JSL A;  2GUZ B;  1FD9 A;  5IDJ A;  2KG7 A;  3ZMZ A;  4I4T A;  3UT5 A;  4DOB A;  1FFT B;  1WJZ A;  3E35 A;  5TIS Z;  4NTY A;  4M0A A;  4O5C A;  1J5E O;  4RPX A;  4X4N A;  1IXM A;  2W6J G;  3B77 A;  4K8X A;  1K3E A;  4JTC B;  1SQF A;  4F5P A;  2CAZ C;  1GAX A;  5J2A A;  1D5N A;  4B08 A;  3TCU A;  1PV0 A;  1L1F A;  2GUZ A;  1NI8 A;  4I2J A;  3E8B A;  1S72 V;  1ZQO A;  4PA4 A;  3NWI A;  3A2F A;  9ICW A;  3T1H B;  4Z6C A;  4NXN O;  4PDR A;  1WPX A;  3KCX A;  1ZQU A;  4X4R A;  2FB5 A;  1JR9 A;  5J2E A;  4RT3 A;  4NXX A;  1ZQY A;  1GKF A;  1FA0 A;  4IQU A;  5CJ7 A;  1S5L Z;  4PD4 F;  3OVB A;  1ZWI C;  3BPZ A;  4I9Q A;  1Q86 W;  4DV7 O;  3CP1 A;  4MTO A;  5LHI A;  2AZ2 A;  3ZHS A;  1NTZ H;  4FHP A;  5KHI A;  2QM8 A;  4Z6D A;  3MDA A;  4WFH A;  2GAF D;  4FM1 A;  3MGH A;  1IBM B;  2PGG A;  4IYI A;  2OYQ A;  3QG5 A;  2ZE8 A;  2CGN A;  9ICA A;  1TFW A;  4FHY A;  1H2K A;  1QR9 A;  4DK0 A;  1Z2G A;  3LSQ A;  3RYF B;  2IH1 C;  3H1J H;  2XAJ A;  1XQ8 A;  5BY1 A;  2EIK B;  5CHE A;  4XQ7 A;  4GXK A;  1K97 A;  2E76 B;  2QTS A;  3ZIA G;  1GPJ A;  1WLE A;  3AQK A;  2MW2 B;  4JI7 O;  4K8Z A;  4QZG A;  2QWP B;  4EFE A;  1QLE B;  1YTF B;  3L72 H;  2VQE B;  4J10 A;  3AG1 C;  1HNW B;  2O1P A;  1UJW B;  2YS8 A;  4DR2 B;  2DWE C;  1FJG O;  3OUY B;  3DC6 A;  1AJN A;  2P5O A;  4X8A A;  3RYF A;  3AU2 A;  3PJS K;  5B1A B;  4OX9 O;  4PPX A;  1DTO A;  3C3T A;  1R8C A;  2OCH A;  3WU2 Z;  4WH5 A;  4QZ8 A;  1IBL O;  1XUQ A;  4HAM A;  5GW7 A;  2YIA A;  1IDS A;  1VF7 A;  3E83 A;  1L0L H;  3JD0 A;  1GN4 A;  5FPR A;  3CRC A;  1A32 A;  5DBA A;  4DYL A;  3WFQ E;  1BPZ A;  4J41 A;  2QR4 A;  3SYQ A;  3OUY A;  1ZQW A;  1BE3 H;  2RDC A;  1ZQF A;  3FB8 C;  2X7R B;  1FXV A;  1XNQ B;  3ASO C;  4XDK A;  9ICT A;  1JMK C;  4UB8 Z;  2HKO A;  4M9N A;  5CFU A;  9ICB A;  1PL0 A;  4O5K A;  5A9G A;  2WLH A;  4ASU G;  4NXM O;  5B3S B;  1BPY A;  3ETE A;  1WAZ A;  2P22 C;  3ZS8 C;  3LSU A;  2JVD A;  3SPC A;  8ICF A;  1Q3E A;  1HNX O;  4QZ9 A;  2QWN B;  2EIJ C;  2WA3 A;  4O2B B;  2Q7G A;  4FH3 A;  5FNV B;  3OGU A;  5HRH A;  3B09 A;  4JI3 B;  2JK5 C;  4E80 A;  8ICP A;  2ZH8 A;  3AG3 C;  3TFS A;  5B1N A; 
#chains in the Genus database with same CATH homology
 3B0Y A;  8ICL A;  5TZV A;  1OU5 A;  5HRD A;  3LK9 A;  3UXN A;  5J0R A;  4WC2 A;  1KNY A;  4NXZ A;  9ICX A;  5J0W A;  4ATB A;  3JPN A;  7ICH A;  3ISC A;  4X4U A;  3UXO A;  3V7J A;  5J0O A;  4UB4 A;  2GWS A;  1UEV A;  4I2I A;  1ZQL A;  4UB2 A;  7ICE A;  4RQ0 A;  2DR9 A;  4I2F A;  5DED A;  3TFR A;  4IQV A;  4F5N A;  8ICW A;  5HRI A;  3RJK A;  5IIK A;  2NRK A;  2BE3 A;  7ICR A;  7ICM A;  4NM1 A;  2PFN A;  4X5V A;  4XQ8 A;  3HW8 A;  3ISD A;  2BPC A;  8ICQ A;  5DB6 A;  3UQ0 A;  4RWQ A;  4QZD A;  3JPS A;  4WC7 A;  4K4G A;  3RJE A;  2ISP A;  4RWO A;  4KLD A;  4M9H A;  7ICQ A;  4NM2 A;  1ZQM A;  7ICK A;  5DB9 A;  2ZHA A;  9ICH A;  3GDX A;  4RWP A;  5IIO A;  2BPG A;  7ICG A;  4XUS A;  7ICS A;  1HUZ A;  3HJ1 A;  3ISB A;  4O9M A;  2M2U A;  4WBZ A;  9ICP A;  1ZQX A;  3C66 A;  4O5E A;  5IIM A;  3HIY A;  4LVS A;  4YD1 A;  7ICT A;  4RQ6 A;  5DB7 A;  1ZQZ A;  1ZQG A;  1MIV A;  5J2I A;  2BPF A;  4UBB A;  3UQ2 A;  5DBB A;  4KLE A;  9ICS A;  5DBC A;  4QZE A;  2P66 A;  5J2C A;  4NKU A;  4QZH A;  4F5Q A;  5CWR A;  5HRK A;  5J0X A;  4PHP A;  3V72 A;  4M9J A;  5HRG A;  1XSP A;  1JN3 A;  3WFS C;  4M47 A;  4MFA A;  2FMQ A;  9ICC A;  4EBJ A;  4X0A A;  4AT8 B;  2PBE A;  4F5O A;  4WC3 A;  1BPB A;  4PGQ A;  3JZ0 A;  3RJJ A;  4PGY A;  3AU6 A;  4KLI A;  3RJI A;  4DO9 A;  5D4B A;  4AT9 B;  2I9G A;  4EP7 A;  2M2V A;  7ICV A;  4LT6 A;  4FO6 A;  4UD4 A;  5CR0 A;  4TUP A;  3MDC A;  7ICU A;  4R65 A;  3C18 A;  4I28 A;  3RJH A;  5J0P A;  4UB3 A;  1ZQC A;  4KLS A;  9ICV A;  4AT8 A;  5J29 A;  5CB1 A;  4FHX A;  4IQW A;  4XA5 A;  4WC0 A;  4NKT A;  4UBC A;  4R64 A;  1ZQJ A;  2IHM A;  5IIN A;  4YN4 A;  3C2M A;  8ICV A;  3RH4 A;  4AT9 A;  5BOL A;  4QZB A;  4P4P A;  1XSL A;  2DR5 A;  2O5A A;  2M2W A;  4UD5 A;  4JWN A;  1JAJ A;  4RT2 A;  1XSN A;  7ICF A;  9ICQ A;  2ISO A;  4PH5 A;  8ICE A;  5J0Y A;  4KLH A;  8ICT A;  1Q79 A;  4RWN A;  3RJF A;  4PHA A;  1UET A;  4E7X A;  4I2E A;  3OVS A;  8ICY A;  1R8A A;  4Z6F A;  2ZH6 A;  1TV9 A;  4WC6 A;  4WBY A;  1UEU A;  4M04 A;  4X4P A;  4TUQ A;  1VFG A;  4LZD A;  4KLQ A;  4YMO A;  4WCW A;  2Q66 A;  3LQC B;  1TFY A;  1ZJN A;  4QZI A;  2M2T A;  9ICU A;  5HR9 A;  1NO5 A;  3H37 A;  1R8B A;  7ICP A;  5J0Q A;  4AT7 B;  3H39 A;  1Q78 A;  4S3N A;  4QZA A;  1MQ2 A;  4YMM A;  4GXI A;  5BOM A;  2HHP A;  1MIY A;  4NLZ A;  4KLF A;  5J2G A;  4UAW A;  4X4T A;  9ICF A;  3H38 A;  4I29 A;  8ICS A;  4IQT A;  1KDH A;  1WOT A;  4I2C A;  2VAN A;  5J2J A;  5J2H A;  3JYY A;  1MIW A;  5HC9 A;  5EOZ A;  4AT7 A;  4RQ8 A;  3RH5 A;  1JMS A;  1HUO A;  1TVA A;  5CHG A;  4I2D A;  3WFP A;  4X4O A;  8ICO A;  3JPT A;  1ZQQ A;  5HRB A;  4LZG A;  5III A;  2DRB A;  2DVI A;  5IIJ A;  2RFF A;  4P2H A;  5DDM A;  3JPR A;  4FHV A;  1R89 A;  1BPD A;  1V4A A;  7ICL A;  1YLQ A;  4M2Y A;  2FMS A;  2ZH7 A;  3AQM A;  8ICA A;  5DB8 A;  4QZC A;  4KLJ A;  2ZH9 A;  1PX5 A;  2PXI A;  2BCU A;  3V7K A;  4X4Q A;  4Z6E A;  2ID1 A;  1ZQE A;  9ICM A;  4DOC A;  3V7L A;  4PHE A;  9ICJ A;  2BCQ A;  9ICK A;  1NOM A;  5J2B A;  8ICZ A;  9ICN A;  1ZQS A;  2DR8 A;  8ICR A;  4MFC A;  3AUO A;  8ICH A;  8ICN A;  1ZJM A;  3C2K A;  4PGX A;  4NLN A;  2ZH1 A;  4F5R A;  5F2V O;  3PML A;  2BCS A;  4R66 A;  3JPQ A;  1MQ3 A;  9ICI A;  4JWM A;  5DEC A;  1ZQV A;  4KLG A;  4UAZ A;  9ICO A;  9ICR A;  3JPP A;  1JQR A;  1ZQD A;  5CP2 A;  4RQ2 A;  4DOB A;  4KLO A;  4M0A A;  2PFP A;  4O5C A;  4ATB B;  2FMP A;  4E8F A;  4RPX A;  5J0T A;  4X4N A;  4YCX A;  3JPO A;  4GXJ A;  7ICN A;  4NLK A;  3MBY A;  4F5P A;  5J2A A;  3HJ4 A;  1ZQI A;  4M9L A;  8ICB A;  4EBK A;  2ZH2 A;  4I2J A;  5DKW A;  4RQ5 A;  2PFQ A;  4M9G A;  1ZQO A;  3C5F A;  4RQ7 A;  8ICI A;  4I2B A;  9ICW A;  3B0X A;  4Z6C A;  2DRA A;  4UB5 A;  1ZQU A;  5HRL A;  4X4R A;  2PFO A;  5HHH A;  4P4M A;  5J2E A;  8ICX A;  4RT3 A;  3AQN A;  1ZQY A;  2ZH3 A;  1FA0 A;  4K4I A;  4IQU A;  5CJ7 A;  5J2D A;  3NYB A;  4KLT A;  4UB1 A;  1ZQT A;  4NY8 A;  3OVB A;  3PMN A;  7ICI A;  3C5G A;  9ICE A;  4X4V A;  4UAY A;  8ICM A;  1RPL A;  4FHP A;  4Z6D A;  3MDA A;  4P4O A;  8ICK A;  3MGH A;  4MF8 A;  4I27 A;  2DR7 A;  9ICA A;  1TFW A;  4FHY A;  5HHI A;  4K4H A;  4I2H A;  1ZQA A;  2ZH4 A;  4PHD A;  3C2L A;  5DDY A;  5CA7 A;  3MGI A;  4XQ7 A;  4GXK A;  3AQK A;  4IG8 A;  1ZQP A;  4QZG A;  4RQ3 A;  4RPZ A;  4RQ4 A;  3H3A A;  2O1P A;  3K75 D;  8ICJ A;  3AQL A;  4TUS A;  5D46 A;  3OUY B;  1F5A A;  5J0U A;  5J0S A;  3AU2 A;  4RQ1 A;  4PPX A;  4M5D A;  5J2F A;  1R8C A;  4MFF A;  4QZ8 A;  3UXP A;  4FH5 A;  1ZQB A;  3HWT A;  5IIL A;  8ICG A;  1VJ7 A;  2BCR A;  3OVA A;  5HRF A;  5DBA A;  9ICG A;  2BCV A;  3L9D A;  1RZT A;  9ICL A;  4YD2 A;  4KLL A;  3WFQ E;  3RH6 A;  1BPZ A;  4MF2 A;  4KLU A;  7ICO A;  4DOA A;  3UPQ A;  5D49 A;  3HX0 A;  3OUY A;  1ZQW A;  1ZQF A;  3UPS A;  4FHW A;  9ICT A;  2ZH5 A;  4I2A A;  5HRE A;  4M9N A;  3WFR E;  2ZHB A;  4XRH A;  4I2G A;  1KEJ A;  9ICB A;  4YMN A;  8ICU A;  4O5K A;  4TUR A;  3RJG A;  5BPC A;  1BPY A;  7ICJ A;  1ZQR A;  3PNC A;  4WC1 A;  4KLM A;  4QZF A;  1BPE A;  1ZQN A;  4R63 A;  3WFO A;  8ICF A;  1ZQH A;  4QZ9 A;  5J2K A;  2W9M A;  4FH3 A;  4X4S A;  1ZQK A;  3OGU A;  5HRH A;  1BPX A;  8ICC A;  4E80 A;  4X0B A;  8ICP A;  4RPY A;  4WC5 A;  2ZH8 A;  4WC4 A;  3TFS A;  3OV7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...