5DEDA

Crystal structure of the small alarmone synthethase 1 from bacillus subtilis bound to its product pppgpp
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
198
structure length
196
Chain Sequence
DKQWERFLVPYRQAVEELKVKLKGIRTLYEYEDDHSPIEFVTGRVKPVASILEKARRKSIPLHEIETMQDIAGLRIMCQFVDDIQIVKEMLFARKDFTVVDQRDYIAEHKESGYRSYHLVVLYPLQTVSGEKHVLVEIQIRTLAMNFWATIEHSLNYKYSGNIPEKVKLRLQRASEAASRLDEEMSEIRGEVQEAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP pyrophosphokinase YjbM
publication title Catalytic mechanism and allosteric regulation of an oligomeric (p)ppGpp synthetase by an alarmone.
pubmed doi rcsb
source organism Bacillus subtilis py79
molecule tags Transferase
total genus 62
structure length 196
sequence length 198
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.6.5: GTP diphosphokinase.
pdb deposition date 2015-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04607 RelA_SpoT Region found in RelA / SpoT proteins
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.860 Mainly Alpha Orthogonal Bundle Helix Hairpins Nucleotidyltransferase 5dedA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5dedA01
4AT8B 1UEVA 4ATBB 1ZQPA 7ICLA 1KNYA 3JYYA 4UB3A 8ICLA 4NLKA 3JPQA 3V7LA 4QZBA 4YD1A 1BPYA 1MIVA 4WC3A 4R63A 4TURA 2M2VA 3RJEA 9ICQA 5J2DA 1RPLA 2ZH9A 2PBEA 4RT3A 1ZQDA 3TFRA 4I2FA 4R66A 7ICFA 3B0YA 4R65A 4O5CA 5DBAA 5DB7A 9ICMA 4I27A 5J2EA 7ICPA 2ZH1A 1RZTA 4FHWA 1ZJNA 2M2UA 3H38A 5J0XA 5IIOA 4RWOA 3TFSA 5IIIA 4QZEA 4M04A 4M47A 3JPTA 5HC9A 2ZHAA 4I29A 1XSPA 5DB8A 3OVBA 5CR0A 3V7JA 4E80A 9ICWA 4PGYA 4WCWA 4YMMA 5CJ7A 5DEDA 3MDCA 4XQ7A 1Q78A 1UETA 1KEJA 4XA5A 2PFQA 4RWPA 1WOTA 4NY8A 8ICTA 3AU2A 1BPEA 4I2DA 4KLSA 4F5RA 4PGXA 4WC0A 2VANA 5DBBA 3JPNA 3OUYB 4TUPA 3RJIA 1V4AA 4AT7A 4MFFA 8ICWA 4I2HA 2ZH3A 4QZGA 1F5AA 2IHMA 8ICHA 4KLJA 2FMSA 4QZDA 4KLMA 4UBCA 4RQ2A 2I9GA 5F2VO 1ZQIA 3HX0A 2DR5A 5IIJA 5J2HA 9ICIA 3LQCB 4UD4A 4MFAA 4M2YA 8ICBA 8ICPA 1HUOA 1JAJA 4I2AA 4RQ5A 3PMNA 8ICAA 5J2AA 5CA7A 4LVSA 4FH5A 4Z6DA 4WC5A 8ICIA 2O5AA 4K4IA 4Z6EA 4P4MA 4KLQA 5D46A 1ZQAA 4FHPA 3RJKA 4I2GA 4MF2A 2HHPA 2M2TA 4O5KA 4I2CA 9ICUA 4KLHA 1YLQA 3WFSC 4YMNA 3RH4A 4RT2A 4KLGA 4UAWA 9ICBA 3UXNA 8ICJA 4YN4A 5TZVA 7ICKA 7ICUA 4FHVA 4YMOA 4X0AA 5DDMA 4Z6CA 3RH5A 7ICVA 2DRAA 5DBCA 3C5FA 4KLEA 5J2GA 4YCXA 5D49A 7ICTA 8ICEA 4RQ1A 4F5QA 4NLZA 4RWNA 5J2KA 2NRKA 3ISCA 8ICMA 7ICSA 4RQ0A 9ICSA 3JPSA 3RJFA 4KLLA 2BE3A 3H3AA 5BPCA 2GWSA 3GDXA 4RPZA 4FO6A 4WC1A 1ZQTA 4M9NA 8ICCA 5HHIA 5EOZA 2ZH5A 5HRFA 5CHGA 4ATBA 2BCQA 5IIMA 9ICLA 1JQRA 8ICNA 4M5DA 3JZ0A 1MQ2A 1TFYA 4S3NA 4X4UA 5HRKA 3B0XA 5J0PA 5J2IA 4RPYA 9ICHA 4O9MA 4F5OA 5HRBA 5J2BA 4RPXA 8ICYA 1R8BA 3JPRA 2ZH6A 4X5VA 4XRHA 2DR7A 3HIYA 5J29A 3MGIA 3JPOA 3RJHA 4WC2A 7ICOA 4RQ8A 4NKUA 4M9HA 1Q79A 4AT9B 1ZQRA 3NYBA 3ISBA 7ICEA 3MGHA 1ZQQA 4QZCA 1ZQSA 4UAZA 4P4PA 1ZQEA 4NM1A 5HRDA 2FMQA 4KLOA 8ICRA 4FHXA 5CP2A 2BPGA 4GXJA 4X4PA 1XSNA 1OU5A 9ICTA 5IINA 4UAYA 5HREA 4F5PA 9ICAA 3RH6A 1ZQNA 2ZH2A 2DR8A 3HWTA 3K75D 1JN3A 4E7XA 1MIYA 4DOCA 7ICGA 9ICEA 9ICXA 4WBZA 2ID1A 4PGQA 5J0YA 4O5EA 2DRBA 5HRIA 1ZQFA 4JWNA 4P4OA 8ICXA 5DB6A 1TVAA 5J0SA 4KLIA 8ICKA 5HRLA 4M9GA 2ZH4A 3C5GA 8ICZA 4X4RA 5DKWA 4UB5A 3UPSA 3MDAA 1BPDA 3UQ2A 4X4OA 2P66A 3HW8A 4PHAA 1ZQCA 4IQWA 1BPZA 3RJGA 1R8AA 4KLUA 8ICSA 2BPFA 2ISPA 3V72A 1ZQBA 2ZH7A 4K4HA 4PHPA 3MBYA 3AQNA 4X4TA 4F5NA 4DOBA 3HJ1A 4UD5A 4MF8A 4PH5A 5CWRA 8ICQA 5HRGA 8ICFA 4MFCA 4XUSA 3WFQE 4EBJA 1ZQJA 3JPPA 2BCUA 7ICRA 1VJ7A 1ZQKA 4RQ4A 4X0BA 3RJJA 4WC6A 1VFGA 3UXPA 2PXIA 2O1PA 7ICNA 1JMSA 4DOAA 1FA0A 1ZQOA 5DB9A 4I2IA 3AUOA 2DR9A 4PHEA 3V7KA 9ICCA 4XQ8A 3HJ4A 4IQUA 4WC7A 1MQ3A 4M0AA 4EP7A 3AQLA 4E8FA 5J0OA 4WBYA 8ICGA 4AT8A 4YD2A 5HRHA 4QZIA 2ISOA 2ZHBA 4P2HA 2PFPA 3WFOA 4X4SA 1NOMA 2RFFA 4TUQA 5J0QA 4UB1A 2PFNA 3PMLA 4NM2A 1ZQHA 4R64A 1BPBA 5CB1A 1ZQVA 3AU6A 4QZ8A 1MIWA 9ICNA 4GXIA 5J0TA 3UXOA 2PFOA 4IG8A 1HUZA 5DECA 1XSLA 7ICIA 2FMPA 3OV7A 4PHDA 4AT7B 5J2FA 5IIKA 4UB2A 1ZQXA 2BCRA 5BOMA 5DDYA 4PPXA 3C2LA 5J2JA 4KLDA 5D4BA 7ICHA 4EBKA 3H39A 8ICUA 9ICOA 4NLNA 3L9DA 3C18A 1ZQWA 3PNCA 4UB4A 9ICRA 1ZQGA 4NXZA 9ICGA 3AQKA 4QZFA 1KDHA 4LT6A 4M9JA 5J2CA 1UEUA 4DO9A 4I2BA 5J0WA 3C2MA 1R89A 1ZQMA 4KLFA 2M2WA 4LZDA 9ICKA 3WFRE 1ZQZA 3C66A 4AT9A 4Z6FA 2DVIA 1NO5A 4WC4A 2ZH8A 4RWQA 7ICQA 3AQMA 4JWMA 4TUSA 9ICJA 4FH3A 4QZHA 3UQ0A 1ZQLA 5HHHA 8ICVA 1ZQYA 3OUYA 1TFWA 4IQVA 1ZJMA 3C2KA 2BCSA 4FHYA 4RQ6A 1TV9A 4K4GA 9ICFA 5J0RA 1ZQUA 1R8CA 4NKTA 3OGUA 4QZAA 4I28A 3WFPA 4UBBA 4RQ7A 7ICMA 3UPQA 5IILA 4X4VA 9ICPA 4QZ9A 4KLTA 2BPCA 5BOLA 9ICVA 4I2JA 4LZGA 4GXKA 2BCVA 2Q66A 4I2EA 3OVAA 8ICOA 4IQTA 2W9MA 4M9LA 7ICJA 5J0UA 3ISDA 1BPXA 4X4NA 5HR9A 3LK9A 1PX5A 4X4QA 4RQ3A 3OVSA 3H37A
chains in the Genus database with same CATH superfamily
4GKKO 7ICLA 1KNYA 3JYYA 3K5OA 1V54B 4WH5A 4QZBA 1BPYA 5GONB 2B5UA 3CP1A 2UUBO 9ICQA 3FAVA 3M99B 4MVRA 5EBMC 4IYHA 4MVQA 2ZH9A 1W0KG 4YIPA 1NVPB 1N34O 4RT3A 1PNMA 1ZQDA 5LXTB 4NR1A 4GX1A 3I55V 4TOIA 1DGSA 3ZMSA 4I2FA 1HNZB 4X62O 1LUWA 5IYZA 3B0YA 1CXZB 5IYCO 1UFIA 5DBAA 5LMUB 3SJBC 2ZH1A 4UCSA 1AP6A 1FFXA 1DTOA 2M2UA 4MTGA 4LFAO 4BIOA 4QZEA 4M04A 1P4RA 3BHPA 1YI2V 1FXHA 1WB7A 3AG4B 4FIPC 2PI4A 4F6RB 5HFLA 4B3SO 4I29A 1RP3B 3OVBA 3ETDA 4EFBA 1KB9F 4WFFA 1GN3A 5L3DA 4PGYA 9ICWA 5BZBA 4CS3A 2R9IA 1THZA 1R3JC 2HVJC 4TUYB 1OCCB 5JH7B 1CP9A 1VQ9V 1FFTB 4NXMO 1UETA 1KEJA 3DXRB 4JAUA 2XASA 5JVDB 3BVOA 3ASOB 4W4LA 4I2DA 1QR9A 1JOYA 3K3WA 2ZXWB 1SS3A 4PDMA 3OR6C 4B3RB 3L71H 4PGXA 4EEDA 2OT5A 3E86A 5KLVH 2G38A 4PI2A 4TUPA 5IJ9A 3W7XA 8ICWA 4I2HA 5H2FZ 5LOVB 1DK1A 5B1AB 8ICHA 1NTKH 3K7DA 2ZE7A 4WCEV 1VQKV 3CC2V 4QZDA 4JI3B 4UBCA 1XNRB 4DV5O 1ORQC 5F2VO 4PHZA 9ICIA 8ICBA 4MFAA 4M2YA 3H01A 2E5LO 1BS3A 5J2AA 3G71V 4PD4F 4FH5A 3CRCA 5FPOA 4HYOA 8ICIA 1Q82W 2IJIA 3SYOA 1R3LC 4IGGA 2ZE6A 3LUTB 4JI6B 2M2TA 4DW0A 4O5KA 5KHHA 1TA8A 3HKBB 3AK3A 4YMNA 4DV0B 2P67A 4KLGA 1ZL8B 3RYHA 1ZUQA 3SYPA 2ZINA 4MW3A 3B77A 5D5QA 5LGUA 4FK5C 3IAYA 5TZVA 7ICKA 3BFRA 2WLHA 4YMOA 4X0AA 4UCOA 4HX0A 2DRAA 4LCUC 1XNQO 1B04A 4F4LA 5J2GA 5KHIA 2WAMA 4RQEA 3UQ8A 5D62A 2UXCO 2JJ1G 3SGIA 2NRKA 2QKCA 4HNAA 2Z3YA 4BAYA 7ICSA 4BW9A 4RQ0A 9ICSA 5BXZA 3RJFA 1F4NA 2BE3A 1VARA 4OAIZ 2VS0A 2HP8A 3GDXA 4RPZA 4FO6A 5B1BB 4K9AA 1ZQTA 4K35A 1SQFA 5HHIA 5EYPB 4MS2A 2QDOA 9ICLA 3Q4HB 2XAGA 2EJRA 4X4UA 3BABA 2OCCB 1GTOA 1U97A 5JJEB 2CE4A 1JFFA 5J2BA 3FFQA 3ZS8C 4RPXA 5LA6A 4W4KA 4KHPB 5C8YB 1NTZH 4X5VA 3HIYA 3GB7C 3CCQV 1YJNV 3RJHA 4WC2A 4K96A 1BCCH 4ZI7A 4DRXA 1JCHA 2A7WA 5KX5A 4DR2O 1NVPD 2HN2A 4X1YB 4JLXA 1XMOB 1FS0G 1Q5OA 3UM7A 4H13B 4CH3A 2Y69C 1Z5WA 4IHJA 1MABG 2C2AA 5LGTA 3ZHRA 1ZQEA 1ENVA 1ROPA 5GTIZ 5KA6A 3RYIB 1UJWB 4AHCA 3T1HB 3F5TA 2PYLA 1S77D 3EF2A 2JJ2G 1XOUA 3JAWB 4FHXA 5CP2A 3ZIAG 4LH7A 1G1XB 1XEQA 1FYJA 4WBNB 3E35A 1XSNA 3LDEA 5IINA 5HREA 2YC0A 1NBMG 5CB4A 2QWNB 4TT3G 1E79G 1ZX3A 5FL7G 2ZH2A 4E7XA 3K04A 9ICXA 5CA1A 4FVMA 4JI7B 1OZ0A 4KFMA 1FXKB 2QWQB 1IBLO 3IC9A 4JWNA 4UFZA 5DB6A 1MSDA 2PI5A 1JR9A 4CC5A 8ICKA 2WSSG 1F7YA 3H1LH 4ZIBA 4X4RA 4UB5A 3B8MA 1BPDA 4NB5A 4X4OA 2IM9A 5CBGA 2QM7A 4FLUA 2P66A 2BSKA 4PHAA 4MTXA 3AK1A 4JTAB 1BPZA 2X6BA 3RJGA 3S3WA 5LMNO 3FAVB 4TQDA 2ISPA 5B1NA 3ABTA 2HHHB 3TGUH 4KL1A 1ZQBA 4K4HA 1SQBH 2YDEA 3ML0A 4Z2WA 2F4VO 4F5NA 4DOBA 2NLJC 1KQSU 5IYZB 5HRGA 8ICQA 2Y48A 3ASOC 3CCRV 1FD9A 1R1BA 4X0BA 3RJJA 2A79B 2O1PA 3QTCA 5IT9N 2ZR2A 1FFXB 1GN4A 2MW2B 4FLXA 4K98A 1ZQOA 1K33A 1US6A 4EKWA 1QLEC 4ZOLA 5B1AC 1BHBA 1MQ3A 5J2UA 2HLDG 3AQLA 5IY5B 2RJZA 2QA4V 3SDLA 3G80A 4AQYO 4JI0O 3H1IH 3SJCC 4YD2A 5CBHA 4QZIA 4DV1B 2VQEO 1URFA 4P2HA 4DR3O 1BZKA 1K34A 4X4SA 3CXHF 2RFFA 4J7JA 4UB1A 1WPBA 1NR7A 3JD1A 4N7RA 1AI6A 4NM2A 1ZQHA 4JGSA 4R64A 4QZ8A 1SETA 9ICNA 4JLZA 4GXIA 1NKDA 3UXOA 4X64O 2PFOA 4IG8A 2M6YA 4U7OA 1V55B 4OXSA 1YEWA 4H0LB 2AZ2A 1XSLA 2FMPA 3UO2A 4UUJC 2CGNA 5J2FA 5IJ9B 3LDCA 2YI9A 4JI8O 4X1KA 3T1YB 1ZWIC 4BWAA 4GUNA 3ZRXA 4O4JA 3GWOA 5D4BA 7ICHA 2GUZA 4R6ZA 1TUEB 1GPJA 4NLNA 1OHHG 1XILA 2N74A 2BTOA 4UB4A 1ZQGA 2DOSA 4NXZA 4TV9A 3GWKC 1YXBA 1N32B 4DO9A 4LFCB 4I2BA 4NXVA 3BCCH 3OGIB 1FPOA 5CA0B 2LFSA 2M2WA 4JZ2A 4MSWC 1ZQZA 3I5DA 1I94B 3C66A 4Z6FA 1IXMA 3OGCC 2IJHA 2Q69A 3ABUA 3UO3A 1QVGU 5B3QA 4WC4A 2NNUA 3T2MA 4DR6B 4HBNA 4LEZA 4TUSA 4UB6Z 4DV4B 1SQQH 1JJOA 3NXSA 5KMGA 4ZHQA 2Y0PA 3TCUA 5J9PC 3NKUA 3RYHB 4FJCC 4HZ3A 1XMQO 4FHYA 3JYCA 2LJ2A 2WWWA 4K4GA 9ICFA 3TJTA 1N33O 4DR5B 4JPRA 2PF4E 3CYOA 4I28A 4MW8A 4RQ7A 7ICMA 4QGPA 4X4VA 5CBFA 2CK3G 3UKMA 4UCUA 2YXYA 2YICA 1EN6A 3UT5A 3CXCU 4K8VA 3K79A 2BCVA 1MZFA 3CRQA 4HNAB 2XAHA 4GLXA 1GM7A 1KBHA 4YY3O 4DV2O 4LH6A 1Q90D 3HKDA 2ATKC 1BMFG 3G4SV 4FM0A 5HR9A 4LBEC 1R6KA 1H2NA 2JDIG 4GXJA 3OVSA 3SPJA 4FM1A 4AI8A 3H37A 1GMGA 3W7UA 1ZQPA 2H3OA 1WA8A 1PD3A 2CH7B 2Q7HA 4YD1A 5FNVA 2LFRA 3OTOB 4TURA 3RJEA 2R72A 2H8PC 2UU9O 2UXBO 4DR7B 1RPLA 5LA6B 3MCRA 4OX9O 2LW7A 1FJGB 1IBMO 4PJ0Z 3FKSG 2UUAB 3W7TA 1FAFA 4ZBMA 7ICFA 1WPXA 1XL4A 3L75H 2BBJA 4ZI7B 4DR4B 3O65A 9ICMA 4DRXB 1FXKC 5KX5B 7ICPA 1M5IA 2E3CA 1RZTA 1R6TA 4FHWA 3DTUB 2Q7EA 1R6NA 3RW0A 5IIOA 4RWOA 1Y4MA 2QM4A 4IHJB 3HKEA 3CCVV 3JPTA 1V9PA 5HC9A 2ZHAA 4NTXA 1XSPA 2VQFB 3V7JA 1U96A 4GYCB 1AVMA 5EYPA 1HNWB 2IU3A 4YMMA 5CJ7A 5DEDA 4GKJB 4JI4O 3IC7A 1Q78A 1AP5A 5CB4B 2Y4TA 4MT8A 4X66B 4LF9O 2K9PA 1YF2A 3RFRA 1P84F 5CA1B 5JQGA 1BPEA 3AU2A 3OW2U 1EN4A 4DR1O 5KUKA 5DN6G 3NR7A 4JI5O 4F5RA 5B66Z 2YIBA 5DBBA 1AI7A 1XL6A 4FLVA 3JPNA 1AI4A 3F7YC 2HEPA 1Y6XA 3SYAA 1V4AA 1TUBA 1X4TA 1QBZA 2DWDC 4QZGA 2JGDA 1XDCA 1Q86W 2BSKB 4O4LA 5B3SC 4I4TB 2OYQA 2OCHA 2QEXV 2I9GA 3LSSA 2DR5A 3JAWA 1VF6C 5IIJA 2CDYA 1GN2A 3QO5A 2ZM6B 3LQCB 4UD4A 8ICPA 4GT1A 2JS5A 2ILMA 1BQZA 4RQ5A 3BA8A 3A8TA 2CGOA 4LVSA 1GKFA 3ZRWA 1SZTA 4WC5A 1W59A 4PV1B 4Z6EA 2K1EA 3I56V 4KLQA 4O2BB 1Q3EA 4U7NA 1V55C 4FHPA 1PL0A 3RJKA 1FXKA 4J9ZB 1W0JG 1OCOC 3MHSC 4X8AA 4XDLA 1J95A 4K8XA 4I2CA 1PKXA 1KUQA 9ICUA 1YLQA 3ZHQA 3RH4A 3FB8C 4ZOLB 5CMUA 1WB8A 4UAWA 5KHJA 5J2UB 1M90W 4LF4B 2W6JG 4DXWA 8ICJA 4CS2A 4O4HA 3VBBA 3ASNB 4JAVA 2XTAA 4N23A 5DDMA 4Z6CA 4LFBO 2F43G 3HR0A 4I50A 7ICVA 3RWRD 1YJ9V 3QO7A 4R50A 2MK3A 3MHHC 1LUVA 4BIZA 4YCXA 4TWKA 5D49A 2Q5ZA 4DV3O 4BR6A 1Q43A 4RWNA 5EK0A 2P6JA 5A9GA 1XREA 4LF7O 4FLWA 3ISCA 3OM3B 4I55B 4JYAB 2ZE8A 2Q0AA 4KLLA 1HNXB 4LF6B 4K8ZA 3ABKB 1RSOB 2WLIB 1YIJV 4O67A 2YXLA 3TK1A 4X1KB 3AK2A 2ZH5A 4EB6A 1VQ7V 4O4JB 5CHGA 2GUZB 2BCQA 1JQRA 3BY6A 5JWPA 4M5DA 5LHGA 4QE9A 5HRKA 3B0XA 5J0PA 9ICHA 4O9MA 4CH5A 4TV9B 4LWSA 4G28B 3VQVA 3JPRA 4I0XA 3CWBH 4XRHA 2DR7A 1VF6A 5J2TA 4AILC 5J29A 2EBOA 3JPOA 2UUBB 4O68A 2OWOA 2GV9A 3ETQA 4NKUA 1K92A 1N34B 1L0NH 1Y67A 3CCJV 3HKCB 3NYBA 2DYSC 2KKWA 3ISBA 4DUYO 4X62B 3MGHA 4FZ0A 4QZCA 1K4DC 1ZQSA 3T1CA 1K9MW 1M1KW 3EHBB 4D7TA 1FXVA 5KMGB 4ZHQB 2FMQA 3OWGA 4KLOA 1SKVA 1DF5A 2NN4A 3WB0A 1B3QA 4WFHA 1QLEB 2XHBA 1XHXA 2AHZA 9ICTA 1PNLA 5H6RA 2W6IG 9ICAA 2BOBC 5ITZA 3RH6A 1ZQNA 2GBOA 4MTOA 3DC6A 4DOCA 1MIYA 4WFGA 2QTOA 4B3TB 2HN1A 4QNHB 3UT5B 4Q20A 3CJHB 4DV0O 4NTYA 2ID1A 4PGQA 1VQ4V 4NXMB 4R7CA 2LGWA 5CA0A 1NH2B 4OAHA 8ICXA 1VF5B 2F1MA 5J0SA 4KLIA 3HKDB 4H37A 5HRLA 3C5GA 4X65O 4QE7A 1R73A 3STLC 3HW8A 1WA8B 5IWAB 5CFUA 1YITV 5FNVB 4J7KA 4FLTA 1R8AA 4KLUA 4YHHO 2BPFA 2JS3A 3OEHG 3ZJZA 1QCEA 4X4TA 3ZMUA 2P06A 3U0ZA 1YTFB 2ZKOA 2QKSA 1HW7A 3K0GA 4DV5B 4MFCA 3WFQE 2BCUA 1ZQJA 4RQ4A 4EGWA 4WC6A 1VFGA 4FZ1A 3UXPA 2A0LA 3QVNA 2DYRB 2E5LB 1QU7A 4MVMA 4FO1A 1Y76A 1M56C 2YXHA 2GTAA 2ZD9A 1BHAA 4PDRA 1VMGA 1DLBA 3HKEB 2GTSA 4X20A 4KHPO 3A0HZ 3NVOA 3LNNA 4PHEA 3WU2Z 4MVOA 1Y74A 4LC1A 3HJ4A 2WLKA 4IQUA 4WC7A 3K58A 3K06A 1E1RG 2OIGA 3CX5F 8ICGA 3N2KA 3JCUZ 5HRHA 2CH7A 3G6EV 2FKXA 3WFOA 4J7ZA 4UCTA 2B9ZA 4JYCA 1AJPA 5J0QA 2PFNA 1EBOA 4LEYA 2WLMA 3LNMB 4O4IA 3C90A 1BPBA 3AU6A 1NTMH 5JQGB 3HPLC 4FLZA 1XNQB 5DECA 1DF4A 2X6AA 2P5OA 7ICIA 2ZNJA 3OV7A 2UXCB 4UVCA 4XBFA 1TUBB 1Q81W 1NZ6A 5LYJA 4JTCB 2EULA 4P30A 4UV9A 1J5EO 2JGDB 2DQ3A 4EBKA 4O4LB 2F95B 3L70H 4MKPA 9ICOA 1P49A 1S5HC 2RCVA 2FYUH 2EILC 2EWRA 4IT5A 1ZQWA 4O2AA 1SZXA 4RAIA 4PI0A 1Q6UA 9ICRA 1IURA 2EIMC 1S5JA 2UUCO 3ASNC 2CTWA 5CHEA 2YIAA 4PA9A 4X88A 3FX7A 4UVAA 2NR5A 4A5UB 4RO2A 5J0WA 3C2MA 1ZQMA 1MSWD 3ZRWB 4JI1O 3WFRE 1H38A 4AT9A 3LSQA 5H9CA 3E83A 1QLNA 7ICQA 4WFBV 4JWMA 3ABKC 9ICJA 4XDKA 4FH3A 4QZHA 3UQ0A 1GM9A 3WB2A 1G6UA 4DR2B 3IJ4A 1TFWA 5EZYA 2DWEC 1ZJMA 3E22A 4DK0A 5KAFZ 3NWIA 1OCZC 4O4HB 5J0RA 4I4TA 2FCLA 4NKTA 1LNQA 4NXNB 4QZAA 2QWOB 5AG2A 3WFPA 4UBBA 4I50B 1K7DA 2JGUA 1R3IC 2VWKA 4LEWA 2FMLA 4KLTA 2BPCA 4J80A 9ICVA 4I2JA 2UXNA 4GXKA 2YS8A 1VEWA 5LBQA 3K03A 2Q66A 4B3MO 3OMAB 2KSDA 3ER8C 4CBCA 3OVAA 1ZLZA 3J80N 4IQTA 3JD3A 5CFTA 1MZEA 4M9LA 4O2BA 3LK9A 3IFXA 4ZKIA 3ZMTA 4X4QA 3D3IA 4EB6B 4FLYA 1IBLB 1NH2D 1I7FA 1UEVA 2ARHA 4AT8B 4NLKA 4O69A 3ABMB 5KAIZ 3CEIA 5B3SB 3RYFA 4YJ2B 4R63A 2M2VA 4O6AA 4LWSB 1VQMV 1KU9A 5B1OA 4I0XB 1PV0A 4IIJB 4K0KB 5J2TB 3TFRA 4MVZA 2YI8A 3SYCA 5LMNB 4ABMA 3ER9B 2ZIOA 2EINB 4I27A 4TV8A 2F4VB 1TVKA 3KCXA 2CTQA 1YTFD 2GDSA 1ZJNA 1ZSPA 4IYIA 3H38A 3CC4V 3A2FA 4KXRA 4I55A 3C3TA 3FB6C 1N32O 2YIDA 4LFCO 1OCOB 3CSXA 5DB8A 4PA4A 4DV7O 1RSOA 5CR0A 2WLIA 3VQXA 1N36O 4LF8B 3APOA 3ETGA 4TSFG 3GVMA 1H2SB 4JV5O 3ERCC 1Q6IA 3W7SA 3OR7C 4WCWA 3BAAA 2IW5A 4FFBA 4XA5A 1R3KC 4DR6O 4UCVA 1KMIZ 3E8BA 5ITZB 2ODMA 5H6QA 2PFQA 3JCZA 4AQYB 4H44B 4JI0B 1K97A 2GHYA 3K9AA 2VQEB 3OFNG 2FB5A 1P7BA 4DR3B 1NI8A 2DYRC 2B51A 2VANA 4DR5O 4UV8A 1VF7A 3OUYB 5LL6Y 3B4SA 4N21A 3RJIA 3HKCA 3AEIA 3TXQA 1EFRG 1HWYA 2KG7A 4RQFA 2ZH3A 1YVWA 4X64B 1AR5A 4K3AA 2YIBD 1F5AA 2IHMA 3ZEDA 3P3NA 2FMSA 2QE7G 4RQ2A 1F23A 2HR3A 3U11A 4JI8B 4WQKA 3HX0A 2Q68A 3HB3B 4DK1A 2ADPA 4MVUA 1HUOA 3K59A 2PY5A 1JAJA 1VQPV 4I2AA 2B1IA 2KQXA 3PMNA 8ICAA 1VIBA 1KKDA 2AHYA 5CA7A 1OCRC 4GZRB 2ZDIC 2O5AA 4K4IA 4B7EA 4P2ZA 3CPWU 5KHKA 2IJJA 5BR8O 3CJHA 1Y76B 4UVBA 2EIKB 3SPCA 1GK9A 2HHPA 2DYSB 4X20B 1S76D 2XUMA 1HR0B 4KLHA 3CCLV 2QWPB 3AG1C 2UUAO 3K0DA 2JEXA 4DYLA 1Y74B 2WLLA 3C3SA 1BT8A 4RT2A 4WFEA 2ETNA 1EZJA 4X9QA 2M7WA 2RMKB 1VQ8V 2A9HA 1BSMA 2YEVA 4DR4O 1B6QA 3N2KB 3UXNA 9ICBA 4YN4A 3CCMV 2LO1A 3JCFA 3RH5A 1GN6A 3ICXA 4RWUA 3A0RA 3CCSV 4KLEA 3PJSK 2ITDC 4YJ3B 4O4IB 7ICTA 8ICEA 4RQ1A 1N33B 2KB1A 4LP8A 2PTMA 2CAZC 4F5QA 2VQFO 3H1KH 4NXWA 3X2QC 8ICMA 5CN0A 3RVZA 1HNWO 3VQWA 1D5AA 2GWSA 2ZR3A 1IZ3A 2OTLV 5LYJB 3CCUV 3RYCA 5LHIA 2DW4A 4M9NA 8ICCA 5EOZA 4X66O 3CD6V 4ATBA 2E74B 3CRRA 1S3JA 3JZ0A 1TFYA 4S3NA 3AG2B 5BY1A 2EX3A 4O2AB 3LDDA 1N4CA 4RPYA 4F5OA 8ICYA 4NXUA 5GTHZ 2F66C 4DV6B 3JATA 1AJNA 1M4UA 5GW7A 2VRZA 2UU9B 2UXBB 3D36C 3ZHTA 4AT9B 3P32A 4U3FH 4NVPA 4OX9B 3CCEV 1IBMB 1VQLV 2ZDIA 1GO3F 1SRYA 2ZM6O 3K9SA 4NM1A 2JEUA 1M56B 5HRDA 3R66A 2E75B 2W0XA 4OGQB 1GM8A 1G8MA 3CK6A 2B1GA 5EZYB 1H2GA 3E22B 1NR1A 3ABMC 4BIUA 4NXXA 4K99A 4X4PA 1VQ5V 2QR4A 4IL6Z 1VQNV 4UAYA 4OAFA 2RNBA 5IYBO 4G27B 3RGBA 2WA3A 3E2EA 3RBZA 1I5YA 1SERA 2DR8A 3HWTA 3K75D 2VWJA 9ICEA 3G6BA 4JI4B 2HJDA 2PUSA 1NU1H 5JJNB 1F51A 5J0YA 2EINC 1SC5B 3CMAV 4O5EA 2UXDB 4FFKA 1IBKO 4BW5A 2LW1A 4WQLA 3MDSA 1KP2A 2Z5UA 5H5NA 3TETA 4M9GA 2ZH4A 3IGAC 4DR1B 1QR8A 2UXXA 1AI5A 1TGOA 4KB6A 4LF5B 4DUZB 3FYEB 1X59A 1HNZO 4E4EA 2Y0IA 3RYFB 4JYAO 4ASUG 8ICSA 2EILB 5EBLC 3K57A 4JI2B 2ZH7A 4PHPA 1KD1W 5LMUO 2EIMB 1FKAO 1M9NA 4UD5A 4U3JA 4MF8A 5CWRA 1RPOA 3JPPA 2LP7A 1VJ7A 1ZQKA 2X0LA 2PXIA 3AG7A 4TV8B 5E79Z 1PPJH 3JD4A 3KCYA 1TVKB 7ICNA 3CC7V 3D36A 2B56A 1VQOV 1FA0A 1LR1A 3OEEG 4I2IA 3AUOA 2BTQA 4J42A 2DR9A 2ZT9B 4K9BA 9ICCA 4M0AA 4EP7A 4CZZA 1KECA 2Q6AA 4E8FA 4AT8A 1NT2B 1AJQA 5IJ0A 4I0UA 4LEVA 5C93A 5JCOC 1AROP 1A32A 4FFBB 2PFPA 1OCZB 4TUQA 1NQTA 4YJ2A 4B3RO 2QJ1A 3ZN0A 4EFEA 4GKKB 1SA0A 5CB1A 3JALA 1PL4A 1JMKC 4I9QA 4IIJA 2IJKA 3DSQA 5J0TA 2R9RB 1O9HA 4LFBB 1Q7YW 1Z5VA 4J9YB 4DV3B 3B8NA 2EIKC 5EC2C 4JI3O 4UB2A 4J11A 1MOFA 1XNRO 1K5QA 2BCRA 2KG7B 2P90A 4MVSA 4X1IA 4LF7B 5BOMA 1N8RW 5B5EZ 5DDYA 2QWRB 1O9GA 5E1AC 1Z2GA 3E89A 3H39A 4B3TO 2AXTZ 3ZBHA 5LP6C 3SPGA 3C18A 4PA3A 1L8DA 1YDXA 4GX0A 3PNCA 1Q8IA 1PP9H 3OTFA 9ICGA 4LFAB 3AQKA 1KDHA 4LT6A 4JASA 4M9JA 3BA9A 5J2CA 1EM1A 1JQ0A 3E8FA 4B3SB 1ZTEA 3CHXA 1R89A 1AILA 2Q4PA 4LZDA 9ICKA 4JI6O 3RVYA 3CRMA 1JPXA 3ZRSA 2P22C 2FTKA 5IWAO 4B7KA 1NO5A 2H94A 4QPKA 2ZH8A 5L3EA 1SESA 4RWQA 4PA7A 3AQMA 1MA1A 2WLNA 4LNUB 3JARA 5L3CA 8ICVA 1ZQYA 3OUYA 2F93B 4RUFA 3EFFK 3WFVA 4IQVA 2WLLB 1WNSA 5TISZ 4DUYB 2OIEA 3BPZA 3C2KA 2BCSA 3M8AA 4RQ6A 2QKAA 2YEVB 3AG2C 2L35A 1JX9A 1ZQUA 2WLJA 1R8CA 3OGUA 2A3QA 3UPQA 2DJVA 5IILA 4QJFB 1GH6A 3WG7C 9ICPA 3SR2C 5JCOA 1K8AW 4QZ9A 2V7QG 2N04A 5BOLA 2IUBA 3L72H 4LZGA 2P7TC 4F6EA 1UPGA 3VOUA 4H33A 1D2DA 3N27A 4YIOA 2Y4UA 4I2EA 1I08A 3B09A 1QQCA 2AGAA 3ZN1A 1D5NA 3JAMN 8ICOA 1WJZA 1W2BU 7ICJA 5J0UA 3ISDA 1BPXA 3RYCB 1EN5A 1K4CC 2RDCA 1S72V 1YZBA 1PX5A 2Q73A 4CH6A 4L87A 4RQ3A 3BEHA 5L3BA 4ATBB 4UB3A 8ICLA 2HKOA 1YSCA 2HG5C 3JPQA 1KC8W 3V7LA 1F4MA 1H2MA 2IU0A 3J7AU 1KYOF 3SPHA 4X65B 1MIVA 4WC3A 4FMTA 5LP6A 5J2DA 4EEQA 2PBEA 1SQVH 2OTJV 3SPIA 3JASA 1RFYA 1XMOO 3JD2A 2QM8A 3JATB 4R66A 4GX5A 4OPAA 3OMNB 4R65A 1K3EA 4YHHB 4O5CA 4YJ3A 5DB7A 3WB1A 1OCRB 5J2EA 4D7SA 1QHTA 3T4ZA 3T1HO 3N2GA 5LGNA 1WAZA 1Y66A 3CE2A 5J0XA 3TFSA 5IIIA 4M47A 3RN4A 3A0BZ 4QIWF 5LHHA 4GCZA 4Z1VA 5EIBD 4E2LA 1XBLA 1H8HG 4E80A 4MTFA 1RM1B 3AG1B 2PYJA 1H2KA 3O9OA 3AG3C 3MDCA 3J81N 4CS4A 4XQ7A 3SJQC 4JI7O 2ZIMA 4Z1MG 1XI1A 1WOTA 4RWPA 2JIZG 4NY8A 8ICTA 2V4DA 4KM5A 4CC6A 1H8EG 4JZGA 4KLSA 5EIBC 3UCSC 3ZHSA 5D5PA 3DGEA 4WC0A 3LSUA 3X2QB 1HDJA 1COWG 4NXNO 4K97A 3H9VA 4AT7A 4MFFA 1V54C 1B06A 4NTWA 3F5WC 2HHHO 2XT9A 3KZIZ 1IX9A 5DM6V 4KLJA 4KLMA 2EIJB 1RPRA 5IE9A 3QG5A 3B2EE 1AB3A 1ZQIA 1QNMA 1J5EB 5J2HA 3FYIB 1YJWV 3EXAA 3SJAC 3OUFA 1PM9A 3QNEA 4XDJA 3W7WA 4U3JB 4D6TH 1JJ2U 4WF9V 4PDVA 2UUCB 4Z6DA 2ADQB 2XAQA 3L73H 4GX2A 2IH1C 4P4MA 1PNKA 2ZQMA 5D46A 2QGNA 1ZQAA 3AG4C 2XOKG 2GA9D 1N0NA 2P4VA 4I2GA 4MF2A 4JI1B 3JD0A 3STZC 5A2QN 3PN1A 2BTQB 5JTGA 4K0KO 4DV1O 1ZAUA 3WFSC 4LR3A 2D3OW 5L3FA 1L0LH 1OCCC 1M93A 1NJIW 1M57B 5IJ0B 7ICUA 4FHVA 4JTDB 1BGYH 4I5SA 5BMVA 5K1XA 5DBCA 1G4YB 1MMMA 3C5FA 1SA0B 1QVFU 3JALB 2ZXWC 3JSLA 4NLZA 5J2KA 4LF8O 2CUGA 4EV6A 3JAKA 3T1YO 5IYDO 3JPSA 2JVDA 1WP7A 2LQTA 3PHZA 2EZOA 3H3AA 5BPCA 4R8CA 4HAMA 3ETEA 4WC1A 2Q8VA 1Q6HA 4X1IB 5L3GA 4B3MB 2Q67A 2HFEC 5HRFA 3CS5A 4EEBA 1GAXA 2YUAA 4NYKA 2EJ7A 4J10A 2HVKC 1IXBA 1KKCA 5IIMA 1HP8A 8ICNA 1SQXH 2QSAA 3QO8A 1MQ2A 2BBHA 1MNGA 5GONA 2QTSA 1JA8A 1KP3A 5J2IA 5HRBA 1R8BA 2X7RB 3E8HA 1I94O 2ZH6A 3RT3C 3P30A 5LXTA 3MGIA 4X89A 3ZCCA 3OT7A 7ICOA 3ABLB 3R65A 4L8JA 5IDJA 4RQ8A 4DV4O 3OE7G 4M9HA 1Q79A 1ZQRA 3CMEV 7ICEA 2Q9LA 4WOYA 2L6LA 4PDLA 1ZQQA 2ITCC 3FB5C 2DN9A 4UAZA 3MAQA 1SQPH 5JJJB 1TAEA 4P4PA 2E76B 4P9OA 5D63A 4F6RA 3JARB 5EBWC 2RQ6A 2ZCEA 4C7UA 3H1HH 4I7ZB 8ICRA 3OUSA 3ZMZA 1XHZA 2R70A 2BPGA 1AR4A 5KHGA 4YXWG 4TUYA 3OMIB 5JH7A 1OU5A 1S5LZ 3ZHUA 4DV7B 1IDSA 4F5PA 1N36B 1P7GA 3DXRA 2HJFC 4JV5B 2EZPA 2P4KA 1HR0O 2XAFA 5JVDA 2ZNIA 1JN3A 7ICGA 2AZ0A 4WBZA 2YSUB 4NKGB 2DRBA 1K5SA 5HRIA 1ZQFA 1AR1B 3MD0A 5B1BC 4P4OA 1TVAA 4NXTA 3CRAA 1EZVH 3T4DA 2X6CA 2DQ0A 3B40A 8ICZA 1MG1A 3OTOO 5DKWA 4ICGA 3UPSA 3MDAA 5LOVA 3UQ2A 4DR7O 3K5NA 2OCCC 2XAJA 4LNUA 1FJGO 2IBZH 1RM1C 1ZQCA 3DC5A 4IQWA 1YHQV 3ZHVA 1S0VA 2O57A 3QF7A 5KA5A 3FB7C 5LP6B 1WP8A 3V72A 2R9AA 3MBYA 3K5LA 3AQNA 3JASB 2IHOA 3HJ1A 1VQ6V 4PH5A 1CPYA 8ICFA 2BOCC 4XUSA 4EBJA 7ICRA 3OAAG 1XMQB 1YCIA 5FPRA 3ZMVA 5K1PA 4UXNA 1IVSA 4JYYA 4PELA 3N2GB 1JMSA 2IH3C 4DOAA 4UB8Z 4CH4A 2BCCH 3OD4A 4P9PA 2RN9A 5DB9A 4GKJO 3HKBA 2N05A 3G67A 4KP4A 5BR8B 3V7KA 1OV9A 4G2KA 1L1FA 4DV6O 4XQ8A 4QPJA 1ZL8A 1SF9A 1JFFB 5CA3A 5J0OA 1E1QG 4WBYA 2EIJC 4YY3B 2PGGA 4DV2B 2A06H 2ISOA 3H1JH 3APQA 3KKYA 2ZHBA 2JK5C 2JRIA 2DMXA 3EVKA 1NOMA 3D3QA 2B4VA 4XJEA 3PMLA 1VP7A 1I5XA 2WPDG 1ZQVA 4RUEA 4DO2A 3WG7B 1MIWA 3CB2A 3F7VC 2W0FC 4J41A 2LGQA 1HUZA 3ZX6A 1BQ0A 3SYQA 4PHDA 4AT7B 2CTPA 5IIKA 1ZQXA 5D61A 3KG2A 4PPXA 3C2LA 5J2JA 4KLDA 2CTRA 8ICUA 3Q4HA 2FL4A 3L9DA 3VQYA 5HFMA 3TXSA 2Q7GA 2UXDO 1M57C 4QZFA 4Q6GA 5C8YA 1UEUA 1WN7A 3U10A 1JVMA 4JAAA 4KLFA 1T5EA 3D8CA 2V1DA 3P3PA 2Z0AA 4UCRA 2PZSA 4LF5O 1OJHA 4DUZO 1K73W 1BE3H 4PA6A 4X1YA 2DVIA 2DE0X 2GAFD 1BL8A 4LF4O 4JI2O 5EC1C 1XQ8A 3K08A 4KUMA 4LF9B 4OPHA 2AW9A 1ZQLA 5HHHA 5IY5C 1SQGA 3RYIA 3E8GA 1I0HA 1GRJA 4OAGA 4B08A 5B3PA 2ZE5A 4JI5B 3M7MX 4JYBA 1TV9A 3S3XA 2GSMB 3L74H 4WBNA 4WFAV 2Q0OC 3AG3B 4FM2A 5BMVB 4DW1A 1WLEA 1HNXO 4LF6O 4TQFA 3ZRVA 4FPPA 5CFSA 1XUQA 3ABLC 1NS1A 2F23A 4I9WA 3JAKB 3BRCA 2WA4A 2D2CB 2XNDG 1H2LA 1N0JA 2W9MA 5KUMA 2Y69B 3K5MA 4X4NA 5FLXN 1CEZA 3FD9A 3THOA 1IBKB 4JF3A 3JSNA
chains in the Genus database with same CATH topology
4AT8B 1UEVA 4ATBB 1ZQPA 7ICLA 1KNYA 3JYYA 4UB3A 8ICLA 4NLKA 3JPQA 3V7LA 4QZBA 4YD1A 1BPYA 1MIVA 4WC3A 4R63A 4TURA 2M2VA 3RJEA 9ICQA 5J2DA 1RPLA 2ZH9A 2PBEA 4RT3A 1ZQDA 3TFRA 4I2FA 4R66A 7ICFA 3B0YA 4R65A 4O5CA 5DBAA 5DB7A 9ICMA 4I27A 5J2EA 7ICPA 2ZH1A 1RZTA 4FHWA 1ZJNA 2M2UA 3H38A 5J0XA 5IIOA 4RWOA 3TFSA 5IIIA 4QZEA 4M04A 4M47A 3JPTA 5HC9A 2ZHAA 4I29A 1XSPA 5DB8A 3OVBA 5CR0A 3V7JA 4E80A 9ICWA 4PGYA 4WCWA 4YMMA 5CJ7A 5DEDA 3MDCA 4XQ7A 1Q78A 1UETA 1KEJA 4XA5A 2PFQA 4RWPA 1WOTA 4NY8A 8ICTA 3AU2A 1BPEA 4I2DA 4KLSA 4F5RA 4PGXA 4WC0A 2VANA 5DBBA 3JPNA 3OUYB 4TUPA 3RJIA 1V4AA 4AT7A 4MFFA 8ICWA 4I2HA 2ZH3A 4QZGA 1F5AA 2IHMA 8ICHA 4KLJA 2FMSA 4QZDA 4KLMA 4UBCA 4RQ2A 2I9GA 5F2VO 1ZQIA 3HX0A 2DR5A 5IIJA 5J2HA 9ICIA 3LQCB 4UD4A 4MFAA 4M2YA 8ICBA 8ICPA 1HUOA 1JAJA 4I2AA 4RQ5A 3PMNA 8ICAA 5J2AA 5CA7A 4LVSA 4FH5A 4Z6DA 4WC5A 8ICIA 2O5AA 4K4IA 4Z6EA 4P4MA 4KLQA 5D46A 1ZQAA 4FHPA 3RJKA 4I2GA 4MF2A 2HHPA 2M2TA 4O5KA 4I2CA 9ICUA 4KLHA 1YLQA 3WFSC 4YMNA 3RH4A 4RT2A 4KLGA 4UAWA 9ICBA 3UXNA 8ICJA 4YN4A 5TZVA 7ICKA 7ICUA 4FHVA 4YMOA 4X0AA 5DDMA 4Z6CA 3RH5A 7ICVA 2DRAA 5DBCA 3C5FA 4KLEA 5J2GA 4YCXA 5D49A 7ICTA 8ICEA 4RQ1A 4F5QA 4NLZA 4RWNA 5J2KA 2NRKA 3ISCA 8ICMA 7ICSA 4RQ0A 9ICSA 3JPSA 3RJFA 4KLLA 2BE3A 3H3AA 5BPCA 2GWSA 3GDXA 4RPZA 4FO6A 4WC1A 1ZQTA 4M9NA 8ICCA 5HHIA 5EOZA 2ZH5A 5HRFA 5CHGA 4ATBA 2BCQA 5IIMA 9ICLA 1JQRA 8ICNA 4M5DA 3JZ0A 1MQ2A 1TFYA 4S3NA 4X4UA 5HRKA 3B0XA 5J0PA 5J2IA 4RPYA 9ICHA 4O9MA 4F5OA 5HRBA 5J2BA 4RPXA 8ICYA 1R8BA 3JPRA 2ZH6A 4X5VA 4XRHA 2DR7A 3HIYA 5J29A 3MGIA 3JPOA 3RJHA 4WC2A 7ICOA 4RQ8A 4NKUA 4M9HA 1Q79A 4AT9B 1ZQRA 3NYBA 3ISBA 7ICEA 3MGHA 1ZQQA 4QZCA 1ZQSA 4UAZA 4P4PA 1ZQEA 4NM1A 5HRDA 2FMQA 4KLOA 8ICRA 4FHXA 5CP2A 2BPGA 4GXJA 4X4PA 1XSNA 1OU5A 9ICTA 5IINA 4UAYA 5HREA 4F5PA 9ICAA 3RH6A 1ZQNA 2ZH2A 2DR8A 3HWTA 3K75D 1JN3A 4E7XA 1MIYA 4DOCA 7ICGA 9ICEA 9ICXA 4WBZA 2ID1A 4PGQA 5J0YA 4O5EA 2DRBA 5HRIA 1ZQFA 4JWNA 4P4OA 8ICXA 5DB6A 1TVAA 5J0SA 4KLIA 8ICKA 5HRLA 4M9GA 2ZH4A 3C5GA 8ICZA 4X4RA 5DKWA 4UB5A 3UPSA 3MDAA 1BPDA 3UQ2A 4X4OA 2P66A 3HW8A 4PHAA 1ZQCA 4IQWA 1BPZA 3RJGA 1R8AA 4KLUA 8ICSA 2BPFA 2ISPA 3V72A 1ZQBA 2ZH7A 4K4HA 4PHPA 3MBYA 3AQNA 4X4TA 4F5NA 4DOBA 3HJ1A 4UD5A 4MF8A 4PH5A 5CWRA 8ICQA 5HRGA 8ICFA 4MFCA 4XUSA 3WFQE 4EBJA 1ZQJA 3JPPA 2BCUA 7ICRA 1VJ7A 1ZQKA 4RQ4A 4X0BA 3RJJA 4WC6A 1VFGA 3UXPA 2PXIA 2O1PA 7ICNA 1JMSA 4DOAA 1FA0A 1ZQOA 5DB9A 4I2IA 3AUOA 2DR9A 4PHEA 3V7KA 9ICCA 4XQ8A 3HJ4A 4IQUA 4WC7A 1MQ3A 4M0AA 4EP7A 3AQLA 4E8FA 5J0OA 4WBYA 8ICGA 4AT8A 4YD2A 5HRHA 4QZIA 2ISOA 2ZHBA 4P2HA 2PFPA 3WFOA 4X4SA 1NOMA 2RFFA 4TUQA 5J0QA 4UB1A 2PFNA 3PMLA 4NM2A 1ZQHA 4R64A 1BPBA 5CB1A 1ZQVA 3AU6A 4QZ8A 1MIWA 9ICNA 4GXIA 5J0TA 3UXOA 2PFOA 4IG8A 1HUZA 5DECA 1XSLA 7ICIA 2FMPA 3OV7A 4PHDA 4AT7B 5J2FA 5IIKA 4UB2A 1ZQXA 2BCRA 5BOMA 5DDYA 4PPXA 3C2LA 5J2JA 4KLDA 5D4BA 7ICHA 4EBKA 3H39A 8ICUA 9ICOA 4NLNA 3L9DA 3C18A 1ZQWA 3PNCA 4UB4A 9ICRA 1ZQGA 4NXZA 9ICGA 3AQKA 4QZFA 1KDHA 4LT6A 4M9JA 5J2CA 1UEUA 4DO9A 4I2BA 5J0WA 3C2MA 1R89A 1ZQMA 4KLFA 2M2WA 4LZDA 9ICKA 3WFRE 1ZQZA 3C66A 4AT9A 4Z6FA 2DVIA 1NO5A 4WC4A 2ZH8A 4RWQA 7ICQA 3AQMA 4JWMA 4TUSA 9ICJA 4FH3A 4QZHA 3UQ0A 1ZQLA 5HHHA 8ICVA 1ZQYA 3OUYA 1TFWA 4IQVA 1ZJMA 3C2KA 2BCSA 4FHYA 4RQ6A 1TV9A 4K4GA 9ICFA 5J0RA 1ZQUA 1R8CA 4NKTA 3OGUA 4QZAA 4I28A 3WFPA 4UBBA 4RQ7A 7ICMA 3UPQA 5IILA 4X4VA 9ICPA 4QZ9A 4KLTA 2BPCA 5BOLA 9ICVA 4I2JA 4LZGA 4GXKA 2BCVA 2Q66A 4I2EA 3OVAA 8ICOA 4IQTA 2W9MA 4M9LA 7ICJA 5J0UA 3ISDA 1BPXA 4X4NA 5HR9A 3LK9A 1PX5A 4X4QA 4RQ3A 3OVSA 3H37A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AT8 B;  1UEV A;  4ATB B;  1ZQP A;  7ICL A;  1KNY A;  3JYY A;  4UB3 A;  8ICL A;  4NLK A;  3JPQ A;  3V7L A;  4QZB A;  4YD1 A;  1BPY A;  1MIV A;  4WC3 A;  4R63 A;  4TUR A;  2M2V A;  3RJE A;  9ICQ A;  5J2D A;  1RPL A;  2ZH9 A;  2PBE A;  4RT3 A;  1ZQD A;  3TFR A;  4I2F A;  4R66 A;  7ICF A;  3B0Y A;  4R65 A;  4O5C A;  5DBA A;  5DB7 A;  9ICM A;  4I27 A;  5J2E A;  7ICP A;  2ZH1 A;  1RZT A;  4FHW A;  1ZJN A;  2M2U A;  3H38 A;  5J0X A;  5IIO A;  4RWO A;  3TFS A;  5III A;  4QZE A;  4M04 A;  4M47 A;  3JPT A;  5HC9 A;  2ZHA A;  4I29 A;  1XSP A;  5DB8 A;  3OVB A;  5CR0 A;  3V7J A;  4E80 A;  9ICW A;  4PGY A;  4WCW A;  4YMM A;  5CJ7 A;  5DED A;  3MDC A;  4XQ7 A;  1Q78 A;  1UET A;  1KEJ A;  4XA5 A;  2PFQ A;  4RWP A;  1WOT A;  4NY8 A;  8ICT A;  3AU2 A;  1BPE A;  4I2D A;  4KLS A;  4F5R A;  4PGX A;  4WC0 A;  2VAN A;  5DBB A;  3JPN A;  3OUY B;  4TUP A;  3RJI A;  1V4A A;  4AT7 A;  4MFF A;  8ICW A;  4I2H A;  2ZH3 A;  4QZG A;  1F5A A;  2IHM A;  8ICH A;  4KLJ A;  2FMS A;  4QZD A;  4KLM A;  4UBC A;  4RQ2 A;  2I9G A;  5F2V O;  1ZQI A;  3HX0 A;  2DR5 A;  5IIJ A;  5J2H A;  9ICI A;  3LQC B;  4UD4 A;  4MFA A;  4M2Y A;  8ICB A;  8ICP A;  1HUO A;  1JAJ A;  4I2A A;  4RQ5 A;  3PMN A;  8ICA A;  5J2A A;  5CA7 A;  4LVS A;  4FH5 A;  4Z6D A;  4WC5 A;  8ICI A;  2O5A A;  4K4I A;  4Z6E A;  4P4M A;  4KLQ A;  5D46 A;  1ZQA A;  4FHP A;  3RJK A;  4I2G A;  4MF2 A;  2HHP A;  2M2T A;  4O5K A;  4I2C A;  9ICU A;  4KLH A;  1YLQ A;  3WFS C;  4YMN A;  3RH4 A;  4RT2 A;  4KLG A;  4UAW A;  9ICB A;  3UXN A;  8ICJ A;  4YN4 A;  5TZV A;  7ICK A;  7ICU A;  4FHV A;  4YMO A;  4X0A A;  5DDM A;  4Z6C A;  3RH5 A;  7ICV A;  2DRA A;  5DBC A;  3C5F A;  4KLE A;  5J2G A;  4YCX A;  5D49 A;  7ICT A;  8ICE A;  4RQ1 A;  4F5Q A;  4NLZ A;  4RWN A;  5J2K A;  2NRK A;  3ISC A;  8ICM A;  7ICS A;  4RQ0 A;  9ICS A;  3JPS A;  3RJF A;  4KLL A;  2BE3 A;  3H3A A;  5BPC A;  2GWS A;  3GDX A;  4RPZ A;  4FO6 A;  4WC1 A;  1ZQT A;  4M9N A;  8ICC A;  5HHI A;  5EOZ A;  2ZH5 A;  5HRF A;  5CHG A;  4ATB A;  2BCQ A;  5IIM A;  9ICL A;  1JQR A;  8ICN A;  4M5D A;  3JZ0 A;  1MQ2 A;  1TFY A;  4S3N A;  4X4U A;  5HRK A;  3B0X A;  5J0P A;  5J2I A;  4RPY A;  9ICH A;  4O9M A;  4F5O A;  5HRB A;  5J2B A;  4RPX A;  8ICY A;  1R8B A;  3JPR A;  2ZH6 A;  4X5V A;  4XRH A;  2DR7 A;  3HIY A;  5J29 A;  3MGI A;  3JPO A;  3RJH A;  4WC2 A;  7ICO A;  4RQ8 A;  4NKU A;  4M9H A;  1Q79 A;  4AT9 B;  1ZQR A;  3NYB A;  3ISB A;  7ICE A;  3MGH A;  1ZQQ A;  4QZC A;  1ZQS A;  4UAZ A;  4P4P A;  1ZQE A;  4NM1 A;  5HRD A;  2FMQ A;  4KLO A;  8ICR A;  4FHX A;  5CP2 A;  2BPG A;  4GXJ A;  4X4P A;  1XSN A;  1OU5 A;  9ICT A;  5IIN A;  4UAY A;  5HRE A;  4F5P A;  9ICA A;  3RH6 A;  1ZQN A;  2ZH2 A;  2DR8 A;  3HWT A;  3K75 D;  1JN3 A;  4E7X A;  1MIY A;  4DOC A;  7ICG A;  9ICE A;  9ICX A;  4WBZ A;  2ID1 A;  4PGQ A;  5J0Y A;  4O5E A;  2DRB A;  5HRI A;  1ZQF A;  4JWN A;  4P4O A;  8ICX A;  5DB6 A;  1TVA A;  5J0S A;  4KLI A;  8ICK A;  5HRL A;  4M9G A;  2ZH4 A;  3C5G A;  8ICZ A;  4X4R A;  5DKW A;  4UB5 A;  3UPS A;  3MDA A;  1BPD A;  3UQ2 A;  4X4O A;  2P66 A;  3HW8 A;  4PHA A;  1ZQC A;  4IQW A;  1BPZ A;  3RJG A;  1R8A A;  4KLU A;  8ICS A;  2BPF A;  2ISP A;  3V72 A;  1ZQB A;  2ZH7 A;  4K4H A;  4PHP A;  3MBY A;  3AQN A;  4X4T A;  4F5N A;  4DOB A;  3HJ1 A;  4UD5 A;  4MF8 A;  4PH5 A;  5CWR A;  8ICQ A;  5HRG A;  8ICF A;  4MFC A;  4XUS A;  3WFQ E;  4EBJ A;  1ZQJ A;  3JPP A;  2BCU A;  7ICR A;  1VJ7 A;  1ZQK A;  4RQ4 A;  4X0B A;  3RJJ A;  4WC6 A;  1VFG A;  3UXP A;  2PXI A;  2O1P A;  7ICN A;  1JMS A;  4DOA A;  1FA0 A;  1ZQO A;  5DB9 A;  4I2I A;  3AUO A;  2DR9 A;  4PHE A;  3V7K A;  9ICC A;  4XQ8 A;  3HJ4 A;  4IQU A;  4WC7 A;  1MQ3 A;  4M0A A;  4EP7 A;  3AQL A;  4E8F A;  5J0O A;  4WBY A;  8ICG A;  4AT8 A;  4YD2 A;  5HRH A;  4QZI A;  2ISO A;  2ZHB A;  4P2H A;  2PFP A;  3WFO A;  4X4S A;  1NOM A;  2RFF A;  4TUQ A;  5J0Q A;  4UB1 A;  2PFN A;  3PML A;  4NM2 A;  1ZQH A;  4R64 A;  1BPB A;  5CB1 A;  1ZQV A;  3AU6 A;  4QZ8 A;  1MIW A;  9ICN A;  4GXI A;  5J0T A;  3UXO A;  2PFO A;  4IG8 A;  1HUZ A;  5DEC A;  1XSL A;  7ICI A;  2FMP A;  3OV7 A;  4PHD A;  4AT7 B;  5J2F A;  5IIK A;  4UB2 A;  1ZQX A;  2BCR A;  5BOM A;  5DDY A;  4PPX A;  3C2L A;  5J2J A;  4KLD A;  5D4B A;  7ICH A;  4EBK A;  3H39 A;  8ICU A;  9ICO A;  4NLN A;  3L9D A;  3C18 A;  1ZQW A;  3PNC A;  4UB4 A;  9ICR A;  1ZQG A;  4NXZ A;  9ICG A;  3AQK A;  4QZF A;  1KDH A;  4LT6 A;  4M9J A;  5J2C A;  1UEU A;  4DO9 A;  4I2B A;  5J0W A;  3C2M A;  1R89 A;  1ZQM A;  4KLF A;  2M2W A;  4LZD A;  9ICK A;  3WFR E;  1ZQZ A;  3C66 A;  4AT9 A;  4Z6F A;  2DVI A;  1NO5 A;  4WC4 A;  2ZH8 A;  4RWQ A;  7ICQ A;  3AQM A;  4JWM A;  4TUS A;  9ICJ A;  4FH3 A;  4QZH A;  3UQ0 A;  1ZQL A;  5HHH A;  8ICV A;  1ZQY A;  3OUY A;  1TFW A;  4IQV A;  1ZJM A;  3C2K A;  2BCS A;  4FHY A;  4RQ6 A;  1TV9 A;  4K4G A;  9ICF A;  5J0R A;  1ZQU A;  1R8C A;  4NKT A;  3OGU A;  4QZA A;  4I28 A;  3WFP A;  4UBB A;  4RQ7 A;  7ICM A;  3UPQ A;  5IIL A;  4X4V A;  9ICP A;  4QZ9 A;  4KLT A;  2BPC A;  5BOL A;  9ICV A;  4I2J A;  4LZG A;  4GXK A;  2BCV A;  2Q66 A;  4I2E A;  3OVA A;  8ICO A;  4IQT A;  2W9M A;  4M9L A;  7ICJ A;  5J0U A;  3ISD A;  1BPX A;  4X4N A;  5HR9 A;  3LK9 A;  1PX5 A;  4X4Q A;  4RQ3 A;  3OVS A;  3H37 A; 
#chains in the Genus database with same CATH topology
 4GKK O;  7ICL A;  1KNY A;  3JYY A;  3K5O A;  1V54 B;  4WH5 A;  4QZB A;  1BPY A;  5GON B;  2B5U A;  3CP1 A;  2UUB O;  9ICQ A;  3FAV A;  3M99 B;  4MVR A;  5EBM C;  4IYH A;  4MVQ A;  2ZH9 A;  1W0K G;  4YIP A;  1NVP B;  1N34 O;  4RT3 A;  1PNM A;  1ZQD A;  5LXT B;  4NR1 A;  4GX1 A;  3I55 V;  4TOI A;  1DGS A;  3ZMS A;  4I2F A;  1HNZ B;  4X62 O;  1LUW A;  5IYZ A;  3B0Y A;  1CXZ B;  5IYC O;  1UFI A;  5DBA A;  5LMU B;  3SJB C;  2ZH1 A;  4UCS A;  1AP6 A;  1FFX A;  1DTO A;  2M2U A;  4MTG A;  4LFA O;  4BIO A;  4QZE A;  4M04 A;  1P4R A;  3BHP A;  1YI2 V;  1FXH A;  1WB7 A;  3AG4 B;  4FIP C;  2PI4 A;  4F6R B;  5HFL A;  4B3S O;  4I29 A;  1RP3 B;  3OVB A;  3ETD A;  4EFB A;  1KB9 F;  4WFF A;  1GN3 A;  5L3D A;  4PGY A;  9ICW A;  5BZB A;  4CS3 A;  2R9I A;  1THZ A;  1R3J C;  2HVJ C;  4TUY B;  1OCC B;  5JH7 B;  1CP9 A;  1VQ9 V;  1FFT B;  4NXM O;  1UET A;  1KEJ A;  3DXR B;  4JAU A;  2XAS A;  5JVD B;  3BVO A;  3ASO B;  4W4L A;  4I2D A;  1QR9 A;  1JOY A;  3K3W A;  2ZXW B;  1SS3 A;  4PDM A;  3OR6 C;  4B3R B;  3L71 H;  4PGX A;  4EED A;  2OT5 A;  3E86 A;  5KLV H;  2G38 A;  4PI2 A;  4TUP A;  5IJ9 A;  3W7X A;  8ICW A;  4I2H A;  5H2F Z;  5LOV B;  1DK1 A;  5B1A B;  8ICH A;  1NTK H;  3K7D A;  2ZE7 A;  4WCE V;  1VQK V;  3CC2 V;  4QZD A;  4JI3 B;  4UBC A;  1XNR B;  4DV5 O;  1ORQ C;  5F2V O;  4PHZ A;  9ICI A;  8ICB A;  4MFA A;  4M2Y A;  3H01 A;  2E5L O;  1BS3 A;  5J2A A;  3G71 V;  4PD4 F;  4FH5 A;  3CRC A;  5FPO A;  4HYO A;  8ICI A;  1Q82 W;  2IJI A;  3SYO A;  1R3L C;  4IGG A;  2ZE6 A;  3LUT B;  4JI6 B;  2M2T A;  4DW0 A;  4O5K A;  5KHH A;  1TA8 A;  3HKB B;  3AK3 A;  4YMN A;  4DV0 B;  2P67 A;  4KLG A;  1ZL8 B;  3RYH A;  1ZUQ A;  3SYP A;  2ZIN A;  4MW3 A;  3B77 A;  5D5Q A;  5LGU A;  4FK5 C;  3IAY A;  5TZV A;  7ICK A;  3BFR A;  2WLH A;  4YMO A;  4X0A A;  4UCO A;  4HX0 A;  2DRA A;  4LCU C;  1XNQ O;  1B04 A;  4F4L A;  5J2G A;  5KHI A;  2WAM A;  4RQE A;  3UQ8 A;  5D62 A;  2UXC O;  2JJ1 G;  3SGI A;  2NRK A;  2QKC A;  4HNA A;  2Z3Y A;  4BAY A;  7ICS A;  4BW9 A;  4RQ0 A;  9ICS A;  5BXZ A;  3RJF A;  1F4N A;  2BE3 A;  1VAR A;  4OAI Z;  2VS0 A;  2HP8 A;  3GDX A;  4RPZ A;  4FO6 A;  5B1B B;  4K9A A;  1ZQT A;  4K35 A;  1SQF A;  5HHI A;  5EYP B;  4MS2 A;  2QDO A;  9ICL A;  3Q4H B;  2XAG A;  2EJR A;  4X4U A;  3BAB A;  2OCC B;  1GTO A;  1U97 A;  5JJE B;  2CE4 A;  1JFF A;  5J2B A;  3FFQ A;  3ZS8 C;  4RPX A;  5LA6 A;  4W4K A;  4KHP B;  5C8Y B;  1NTZ H;  4X5V A;  3HIY A;  3GB7 C;  3CCQ V;  1YJN V;  3RJH A;  4WC2 A;  4K96 A;  1BCC H;  4ZI7 A;  4DRX A;  1JCH A;  2A7W A;  5KX5 A;  4DR2 O;  1NVP D;  2HN2 A;  4X1Y B;  4JLX A;  1XMO B;  1FS0 G;  1Q5O A;  3UM7 A;  4H13 B;  4CH3 A;  2Y69 C;  1Z5W A;  4IHJ A;  1MAB G;  2C2A A;  5LGT A;  3ZHR A;  1ZQE A;  1ENV A;  1ROP A;  5GTI Z;  5KA6 A;  3RYI B;  1UJW B;  4AHC A;  3T1H B;  3F5T A;  2PYL A;  1S77 D;  3EF2 A;  2JJ2 G;  1XOU A;  3JAW B;  4FHX A;  5CP2 A;  3ZIA G;  4LH7 A;  1G1X B;  1XEQ A;  1FYJ A;  4WBN B;  3E35 A;  1XSN A;  3LDE A;  5IIN A;  5HRE A;  2YC0 A;  1NBM G;  5CB4 A;  2QWN B;  4TT3 G;  1E79 G;  1ZX3 A;  5FL7 G;  2ZH2 A;  4E7X A;  3K04 A;  9ICX A;  5CA1 A;  4FVM A;  4JI7 B;  1OZ0 A;  4KFM A;  1FXK B;  2QWQ B;  1IBL O;  3IC9 A;  4JWN A;  4UFZ A;  5DB6 A;  1MSD A;  2PI5 A;  1JR9 A;  4CC5 A;  8ICK A;  2WSS G;  1F7Y A;  3H1L H;  4ZIB A;  4X4R A;  4UB5 A;  3B8M A;  1BPD A;  4NB5 A;  4X4O A;  2IM9 A;  5CBG A;  2QM7 A;  4FLU A;  2P66 A;  2BSK A;  4PHA A;  4MTX A;  3AK1 A;  4JTA B;  1BPZ A;  2X6B A;  3RJG A;  3S3W A;  5LMN O;  3FAV B;  4TQD A;  2ISP A;  5B1N A;  3ABT A;  2HHH B;  3TGU H;  4KL1 A;  1ZQB A;  4K4H A;  1SQB H;  2YDE A;  3ML0 A;  4Z2W A;  2F4V O;  4F5N A;  4DOB A;  2NLJ C;  1KQS U;  5IYZ B;  5HRG A;  8ICQ A;  2Y48 A;  3ASO C;  3CCR V;  1FD9 A;  1R1B A;  4X0B A;  3RJJ A;  2A79 B;  2O1P A;  3QTC A;  5IT9 N;  2ZR2 A;  1FFX B;  1GN4 A;  2MW2 B;  4FLX A;  4K98 A;  1ZQO A;  1K33 A;  1US6 A;  4EKW A;  1QLE C;  4ZOL A;  5B1A C;  1BHB A;  1MQ3 A;  5J2U A;  2HLD G;  3AQL A;  5IY5 B;  2RJZ A;  2QA4 V;  3SDL A;  3G80 A;  4AQY O;  4JI0 O;  3H1I H;  3SJC C;  4YD2 A;  5CBH A;  4QZI A;  4DV1 B;  2VQE O;  1URF A;  4P2H A;  4DR3 O;  1BZK A;  1K34 A;  4X4S A;  3CXH F;  2RFF A;  4J7J A;  4UB1 A;  1WPB A;  1NR7 A;  3JD1 A;  4N7R A;  1AI6 A;  4NM2 A;  1ZQH A;  4JGS A;  4R64 A;  4QZ8 A;  1SET A;  9ICN A;  4JLZ A;  4GXI A;  1NKD A;  3UXO A;  4X64 O;  2PFO A;  4IG8 A;  2M6Y A;  4U7O A;  1V55 B;  4OXS A;  1YEW A;  4H0L B;  2AZ2 A;  1XSL A;  2FMP A;  3UO2 A;  4UUJ C;  2CGN A;  5J2F A;  5IJ9 B;  3LDC A;  2YI9 A;  4JI8 O;  4X1K A;  3T1Y B;  1ZWI C;  4BWA A;  4GUN A;  3ZRX A;  4O4J A;  3GWO A;  5D4B A;  7ICH A;  2GUZ A;  4R6Z A;  1TUE B;  1GPJ A;  4NLN A;  1OHH G;  1XIL A;  2N74 A;  2BTO A;  4UB4 A;  1ZQG A;  2DOS A;  4NXZ A;  4TV9 A;  3GWK C;  1YXB A;  1N32 B;  4DO9 A;  4LFC B;  4I2B A;  4NXV A;  3BCC H;  3OGI B;  1FPO A;  5CA0 B;  2LFS A;  2M2W A;  4JZ2 A;  4MSW C;  1ZQZ A;  3I5D A;  1I94 B;  3C66 A;  4Z6F A;  1IXM A;  3OGC C;  2IJH A;  2Q69 A;  3ABU A;  3UO3 A;  1QVG U;  5B3Q A;  4WC4 A;  2NNU A;  3T2M A;  4DR6 B;  4HBN A;  4LEZ A;  4TUS A;  4UB6 Z;  4DV4 B;  1SQQ H;  1JJO A;  3NXS A;  5KMG A;  4ZHQ A;  2Y0P A;  3TCU A;  5J9P C;  3NKU A;  3RYH B;  4FJC C;  4HZ3 A;  1XMQ O;  4FHY A;  3JYC A;  2LJ2 A;  2WWW A;  4K4G A;  9ICF A;  3TJT A;  1N33 O;  4DR5 B;  4JPR A;  2PF4 E;  3CYO A;  4I28 A;  4MW8 A;  4RQ7 A;  7ICM A;  4QGP A;  4X4V A;  5CBF A;  2CK3 G;  3UKM A;  4UCU A;  2YXY A;  2YIC A;  1EN6 A;  3UT5 A;  3CXC U;  4K8V A;  3K79 A;  2BCV A;  1MZF A;  3CRQ A;  4HNA B;  2XAH A;  4GLX A;  1GM7 A;  1KBH A;  4YY3 O;  4DV2 O;  4LH6 A;  1Q90 D;  3HKD A;  2ATK C;  1BMF G;  3G4S V;  4FM0 A;  5HR9 A;  4LBE C;  1R6K A;  1H2N A;  2JDI G;  4GXJ A;  3OVS A;  3SPJ A;  4FM1 A;  4AI8 A;  3H37 A;  1GMG A;  3W7U A;  1ZQP A;  2H3O A;  1WA8 A;  1PD3 A;  2CH7 B;  2Q7H A;  4YD1 A;  5FNV A;  2LFR A;  3OTO B;  4TUR A;  3RJE A;  2R72 A;  2H8P C;  2UU9 O;  2UXB O;  4DR7 B;  1RPL A;  5LA6 B;  3MCR A;  4OX9 O;  2LW7 A;  1FJG B;  1IBM O;  4PJ0 Z;  3FKS G;  2UUA B;  3W7T A;  1FAF A;  4ZBM A;  7ICF A;  1WPX A;  1XL4 A;  3L75 H;  2BBJ A;  4ZI7 B;  4DR4 B;  3O65 A;  9ICM A;  4DRX B;  1FXK C;  5KX5 B;  7ICP A;  1M5I A;  2E3C A;  1RZT A;  1R6T A;  4FHW A;  3DTU B;  2Q7E A;  1R6N A;  3RW0 A;  5IIO A;  4RWO A;  1Y4M A;  2QM4 A;  4IHJ B;  3HKE A;  3CCV V;  3JPT A;  1V9P A;  5HC9 A;  2ZHA A;  4NTX A;  1XSP A;  2VQF B;  3V7J A;  1U96 A;  4GYC B;  1AVM A;  5EYP A;  1HNW B;  2IU3 A;  4YMM A;  5CJ7 A;  5DED A;  4GKJ B;  4JI4 O;  3IC7 A;  1Q78 A;  1AP5 A;  5CB4 B;  2Y4T A;  4MT8 A;  4X66 B;  4LF9 O;  2K9P A;  1YF2 A;  3RFR A;  1P84 F;  5CA1 B;  5JQG A;  1BPE A;  3AU2 A;  3OW2 U;  1EN4 A;  4DR1 O;  5KUK A;  5DN6 G;  3NR7 A;  4JI5 O;  4F5R A;  5B66 Z;  2YIB A;  5DBB A;  1AI7 A;  1XL6 A;  4FLV A;  3JPN A;  1AI4 A;  3F7Y C;  2HEP A;  1Y6X A;  3SYA A;  1V4A A;  1TUB A;  1X4T A;  1QBZ A;  2DWD C;  4QZG A;  2JGD A;  1XDC A;  1Q86 W;  2BSK B;  4O4L A;  5B3S C;  4I4T B;  2OYQ A;  2OCH A;  2QEX V;  2I9G A;  3LSS A;  2DR5 A;  3JAW A;  1VF6 C;  5IIJ A;  2CDY A;  1GN2 A;  3QO5 A;  2ZM6 B;  3LQC B;  4UD4 A;  8ICP A;  4GT1 A;  2JS5 A;  2ILM A;  1BQZ A;  4RQ5 A;  3BA8 A;  3A8T A;  2CGO A;  4LVS A;  1GKF A;  3ZRW A;  1SZT A;  4WC5 A;  1W59 A;  4PV1 B;  4Z6E A;  2K1E A;  3I56 V;  4KLQ A;  4O2B B;  1Q3E A;  4U7N A;  1V55 C;  4FHP A;  1PL0 A;  3RJK A;  1FXK A;  4J9Z B;  1W0J G;  1OCO C;  3MHS C;  4X8A A;  4XDL A;  1J95 A;  4K8X A;  4I2C A;  1PKX A;  1KUQ A;  9ICU A;  1YLQ A;  3ZHQ A;  3RH4 A;  3FB8 C;  4ZOL B;  5CMU A;  1WB8 A;  4UAW A;  5KHJ A;  5J2U B;  1M90 W;  4LF4 B;  2W6J G;  4DXW A;  8ICJ A;  4CS2 A;  4O4H A;  3VBB A;  3ASN B;  4JAV A;  2XTA A;  4N23 A;  5DDM A;  4Z6C A;  4LFB O;  2F43 G;  3HR0 A;  4I50 A;  7ICV A;  3RWR D;  1YJ9 V;  3QO7 A;  4R50 A;  2MK3 A;  3MHH C;  1LUV A;  4BIZ A;  4YCX A;  4TWK A;  5D49 A;  2Q5Z A;  4DV3 O;  4BR6 A;  1Q43 A;  4RWN A;  5EK0 A;  2P6J A;  5A9G A;  1XRE A;  4LF7 O;  4FLW A;  3ISC A;  3OM3 B;  4I55 B;  4JYA B;  2ZE8 A;  2Q0A A;  4KLL A;  1HNX B;  4LF6 B;  4K8Z A;  3ABK B;  1RSO B;  2WLI B;  1YIJ V;  4O67 A;  2YXL A;  3TK1 A;  4X1K B;  3AK2 A;  2ZH5 A;  4EB6 A;  1VQ7 V;  4O4J B;  5CHG A;  2GUZ B;  2BCQ A;  1JQR A;  3BY6 A;  5JWP A;  4M5D A;  5LHG A;  4QE9 A;  5HRK A;  3B0X A;  5J0P A;  9ICH A;  4O9M A;  4CH5 A;  4TV9 B;  4LWS A;  4G28 B;  3VQV A;  3JPR A;  4I0X A;  3CWB H;  4XRH A;  2DR7 A;  1VF6 A;  5J2T A;  4AIL C;  5J29 A;  2EBO A;  3JPO A;  2UUB B;  4O68 A;  2OWO A;  2GV9 A;  3ETQ A;  4NKU A;  1K92 A;  1N34 B;  1L0N H;  1Y67 A;  3CCJ V;  3HKC B;  3NYB A;  2DYS C;  2KKW A;  3ISB A;  4DUY O;  4X62 B;  3MGH A;  4FZ0 A;  4QZC A;  1K4D C;  1ZQS A;  3T1C A;  1K9M W;  1M1K W;  3EHB B;  4D7T A;  1FXV A;  5KMG B;  4ZHQ B;  2FMQ A;  3OWG A;  4KLO A;  1SKV A;  1DF5 A;  2NN4 A;  3WB0 A;  1B3Q A;  4WFH A;  1QLE B;  2XHB A;  1XHX A;  2AHZ A;  9ICT A;  1PNL A;  5H6R A;  2W6I G;  9ICA A;  2BOB C;  5ITZ A;  3RH6 A;  1ZQN A;  2GBO A;  4MTO A;  3DC6 A;  4DOC A;  1MIY A;  4WFG A;  2QTO A;  4B3T B;  2HN1 A;  4QNH B;  3UT5 B;  4Q20 A;  3CJH B;  4DV0 O;  4NTY A;  2ID1 A;  4PGQ A;  1VQ4 V;  4NXM B;  4R7C A;  2LGW A;  5CA0 A;  1NH2 B;  4OAH A;  8ICX A;  1VF5 B;  2F1M A;  5J0S A;  4KLI A;  3HKD B;  4H37 A;  5HRL A;  3C5G A;  4X65 O;  4QE7 A;  1R73 A;  3STL C;  3HW8 A;  1WA8 B;  5IWA B;  5CFU A;  1YIT V;  5FNV B;  4J7K A;  4FLT A;  1R8A A;  4KLU A;  4YHH O;  2BPF A;  2JS3 A;  3OEH G;  3ZJZ A;  1QCE A;  4X4T A;  3ZMU A;  2P06 A;  3U0Z A;  1YTF B;  2ZKO A;  2QKS A;  1HW7 A;  3K0G A;  4DV5 B;  4MFC A;  3WFQ E;  2BCU A;  1ZQJ A;  4RQ4 A;  4EGW A;  4WC6 A;  1VFG A;  4FZ1 A;  3UXP A;  2A0L A;  3QVN A;  2DYR B;  2E5L B;  1QU7 A;  4MVM A;  4FO1 A;  1Y76 A;  1M56 C;  2YXH A;  2GTA A;  2ZD9 A;  1BHA A;  4PDR A;  1VMG A;  1DLB A;  3HKE B;  2GTS A;  4X20 A;  4KHP O;  3A0H Z;  3NVO A;  3LNN A;  4PHE A;  3WU2 Z;  4MVO A;  1Y74 A;  4LC1 A;  3HJ4 A;  2WLK A;  4IQU A;  4WC7 A;  3K58 A;  3K06 A;  1E1R G;  2OIG A;  3CX5 F;  8ICG A;  3N2K A;  3JCU Z;  5HRH A;  2CH7 A;  3G6E V;  2FKX A;  3WFO A;  4J7Z A;  4UCT A;  2B9Z A;  4JYC A;  1AJP A;  5J0Q A;  2PFN A;  1EBO A;  4LEY A;  2WLM A;  3LNM B;  4O4I A;  3C90 A;  1BPB A;  3AU6 A;  1NTM H;  5JQG B;  3HPL C;  4FLZ A;  1XNQ B;  5DEC A;  1DF4 A;  2X6A A;  2P5O A;  7ICI A;  2ZNJ A;  3OV7 A;  2UXC B;  4UVC A;  4XBF A;  1TUB B;  1Q81 W;  1NZ6 A;  5LYJ A;  4JTC B;  2EUL A;  4P30 A;  4UV9 A;  1J5E O;  2JGD B;  2DQ3 A;  4EBK A;  4O4L B;  2F95 B;  3L70 H;  4MKP A;  9ICO A;  1P49 A;  1S5H C;  2RCV A;  2FYU H;  2EIL C;  2EWR A;  4IT5 A;  1ZQW A;  4O2A A;  1SZX A;  4RAI A;  4PI0 A;  1Q6U A;  9ICR A;  1IUR A;  2EIM C;  1S5J A;  2UUC O;  3ASN C;  2CTW A;  5CHE A;  2YIA A;  4PA9 A;  4X88 A;  3FX7 A;  4UVA A;  2NR5 A;  4A5U B;  4RO2 A;  5J0W A;  3C2M A;  1ZQM A;  1MSW D;  3ZRW B;  4JI1 O;  3WFR E;  1H38 A;  4AT9 A;  3LSQ A;  5H9C A;  3E83 A;  1QLN A;  7ICQ A;  4WFB V;  4JWM A;  3ABK C;  9ICJ A;  4XDK A;  4FH3 A;  4QZH A;  3UQ0 A;  1GM9 A;  3WB2 A;  1G6U A;  4DR2 B;  3IJ4 A;  1TFW A;  5EZY A;  2DWE C;  1ZJM A;  3E22 A;  4DK0 A;  5KAF Z;  3NWI A;  1OCZ C;  4O4H B;  5J0R A;  4I4T A;  2FCL A;  4NKT A;  1LNQ A;  4NXN B;  4QZA A;  2QWO B;  5AG2 A;  3WFP A;  4UBB A;  4I50 B;  1K7D A;  2JGU A;  1R3I C;  2VWK A;  4LEW A;  2FML A;  4KLT A;  2BPC A;  4J80 A;  9ICV A;  4I2J A;  2UXN A;  4GXK A;  2YS8 A;  1VEW A;  5LBQ A;  3K03 A;  2Q66 A;  4B3M O;  3OMA B;  2KSD A;  3ER8 C;  4CBC A;  3OVA A;  1ZLZ A;  3J80 N;  4IQT A;  3JD3 A;  5CFT A;  1MZE A;  4M9L A;  4O2B A;  3LK9 A;  3IFX A;  4ZKI A;  3ZMT A;  4X4Q A;  3D3I A;  4EB6 B;  4FLY A;  1IBL B;  1NH2 D;  1I7F A;  1UEV A;  2ARH A;  4AT8 B;  4NLK A;  4O69 A;  3ABM B;  5KAI Z;  3CEI A;  5B3S B;  3RYF A;  4YJ2 B;  4R63 A;  2M2V A;  4O6A A;  4LWS B;  1VQM V;  1KU9 A;  5B1O A;  4I0X B;  1PV0 A;  4IIJ B;  4K0K B;  5J2T B;  3TFR A;  4MVZ A;  2YI8 A;  3SYC A;  5LMN B;  4ABM A;  3ER9 B;  2ZIO A;  2EIN B;  4I27 A;  4TV8 A;  2F4V B;  1TVK A;  3KCX A;  2CTQ A;  1YTF D;  2GDS A;  1ZJN A;  1ZSP A;  4IYI A;  3H38 A;  3CC4 V;  3A2F A;  4KXR A;  4I55 A;  3C3T A;  3FB6 C;  1N32 O;  2YID A;  4LFC O;  1OCO B;  3CSX A;  5DB8 A;  4PA4 A;  4DV7 O;  1RSO A;  5CR0 A;  2WLI A;  3VQX A;  1N36 O;  4LF8 B;  3APO A;  3ETG A;  4TSF G;  3GVM A;  1H2S B;  4JV5 O;  3ERC C;  1Q6I A;  3W7S A;  3OR7 C;  4WCW A;  3BAA A;  2IW5 A;  4FFB A;  4XA5 A;  1R3K C;  4DR6 O;  4UCV A;  1KMI Z;  3E8B A;  5ITZ B;  2ODM A;  5H6Q A;  2PFQ A;  3JCZ A;  4AQY B;  4H44 B;  4JI0 B;  1K97 A;  2GHY A;  3K9A A;  2VQE B;  3OFN G;  2FB5 A;  1P7B A;  4DR3 B;  1NI8 A;  2DYR C;  2B51 A;  2VAN A;  4DR5 O;  4UV8 A;  1VF7 A;  3OUY B;  5LL6 Y;  3B4S A;  4N21 A;  3RJI A;  3HKC A;  3AEI A;  3TXQ A;  1EFR G;  1HWY A;  2KG7 A;  4RQF A;  2ZH3 A;  1YVW A;  4X64 B;  1AR5 A;  4K3A A;  2YIB D;  1F5A A;  2IHM A;  3ZED A;  3P3N A;  2FMS A;  2QE7 G;  4RQ2 A;  1F23 A;  2HR3 A;  3U11 A;  4JI8 B;  4WQK A;  3HX0 A;  2Q68 A;  3HB3 B;  4DK1 A;  2ADP A;  4MVU A;  1HUO A;  3K59 A;  2PY5 A;  1JAJ A;  1VQP V;  4I2A A;  2B1I A;  2KQX A;  3PMN A;  8ICA A;  1VIB A;  1KKD A;  2AHY A;  5CA7 A;  1OCR C;  4GZR B;  2ZDI C;  2O5A A;  4K4I A;  4B7E A;  4P2Z A;  3CPW U;  5KHK A;  2IJJ A;  5BR8 O;  3CJH A;  1Y76 B;  4UVB A;  2EIK B;  3SPC A;  1GK9 A;  2HHP A;  2DYS B;  4X20 B;  1S76 D;  2XUM A;  1HR0 B;  4KLH A;  3CCL V;  2QWP B;  3AG1 C;  2UUA O;  3K0D A;  2JEX A;  4DYL A;  1Y74 B;  2WLL A;  3C3S A;  1BT8 A;  4RT2 A;  4WFE A;  2ETN A;  1EZJ A;  4X9Q A;  2M7W A;  2RMK B;  1VQ8 V;  2A9H A;  1BSM A;  2YEV A;  4DR4 O;  1B6Q A;  3N2K B;  3UXN A;  9ICB A;  4YN4 A;  3CCM V;  2LO1 A;  3JCF A;  3RH5 A;  1GN6 A;  3ICX A;  4RWU A;  3A0R A;  3CCS V;  4KLE A;  3PJS K;  2ITD C;  4YJ3 B;  4O4I B;  7ICT A;  8ICE A;  4RQ1 A;  1N33 B;  2KB1 A;  4LP8 A;  2PTM A;  2CAZ C;  4F5Q A;  2VQF O;  3H1K H;  4NXW A;  3X2Q C;  8ICM A;  5CN0 A;  3RVZ A;  1HNW O;  3VQW A;  1D5A A;  2GWS A;  2ZR3 A;  1IZ3 A;  2OTL V;  5LYJ B;  3CCU V;  3RYC A;  5LHI A;  2DW4 A;  4M9N A;  8ICC A;  5EOZ A;  4X66 O;  3CD6 V;  4ATB A;  2E74 B;  3CRR A;  1S3J A;  3JZ0 A;  1TFY A;  4S3N A;  3AG2 B;  5BY1 A;  2EX3 A;  4O2A B;  3LDD A;  1N4C A;  4RPY A;  4F5O A;  8ICY A;  4NXU A;  5GTH Z;  2F66 C;  4DV6 B;  3JAT A;  1AJN A;  1M4U A;  5GW7 A;  2VRZ A;  2UU9 B;  2UXB B;  3D36 C;  3ZHT A;  4AT9 B;  3P32 A;  4U3F H;  4NVP A;  4OX9 B;  3CCE V;  1IBM B;  1VQL V;  2ZDI A;  1GO3 F;  1SRY A;  2ZM6 O;  3K9S A;  4NM1 A;  2JEU A;  1M56 B;  5HRD A;  3R66 A;  2E75 B;  2W0X A;  4OGQ B;  1GM8 A;  1G8M A;  3CK6 A;  2B1G A;  5EZY B;  1H2G A;  3E22 B;  1NR1 A;  3ABM C;  4BIU A;  4NXX A;  4K99 A;  4X4P A;  1VQ5 V;  2QR4 A;  4IL6 Z;  1VQN V;  4UAY A;  4OAF A;  2RNB A;  5IYB O;  4G27 B;  3RGB A;  2WA3 A;  3E2E A;  3RBZ A;  1I5Y A;  1SER A;  2DR8 A;  3HWT A;  3K75 D;  2VWJ A;  9ICE A;  3G6B A;  4JI4 B;  2HJD A;  2PUS A;  1NU1 H;  5JJN B;  1F51 A;  5J0Y A;  2EIN C;  1SC5 B;  3CMA V;  4O5E A;  2UXD B;  4FFK A;  1IBK O;  4BW5 A;  2LW1 A;  4WQL A;  3MDS A;  1KP2 A;  2Z5U A;  5H5N A;  3TET A;  4M9G A;  2ZH4 A;  3IGA C;  4DR1 B;  1QR8 A;  2UXX A;  1AI5 A;  1TGO A;  4KB6 A;  4LF5 B;  4DUZ B;  3FYE B;  1X59 A;  1HNZ O;  4E4E A;  2Y0I A;  3RYF B;  4JYA O;  4ASU G;  8ICS A;  2EIL B;  5EBL C;  3K57 A;  4JI2 B;  2ZH7 A;  4PHP A;  1KD1 W;  5LMU O;  2EIM B;  1FKA O;  1M9N A;  4UD5 A;  4U3J A;  4MF8 A;  5CWR A;  1RPO A;  3JPP A;  2LP7 A;  1VJ7 A;  1ZQK A;  2X0L A;  2PXI A;  3AG7 A;  4TV8 B;  5E79 Z;  1PPJ H;  3JD4 A;  3KCY A;  1TVK B;  7ICN A;  3CC7 V;  3D36 A;  2B56 A;  1VQO V;  1FA0 A;  1LR1 A;  3OEE G;  4I2I A;  3AUO A;  2BTQ A;  4J42 A;  2DR9 A;  2ZT9 B;  4K9B A;  9ICC A;  4M0A A;  4EP7 A;  4CZZ A;  1KEC A;  2Q6A A;  4E8F A;  4AT8 A;  1NT2 B;  1AJQ A;  5IJ0 A;  4I0U A;  4LEV A;  5C93 A;  5JCO C;  1ARO P;  1A32 A;  4FFB B;  2PFP A;  1OCZ B;  4TUQ A;  1NQT A;  4YJ2 A;  4B3R O;  2QJ1 A;  3ZN0 A;  4EFE A;  4GKK B;  1SA0 A;  5CB1 A;  3JAL A;  1PL4 A;  1JMK C;  4I9Q A;  4IIJ A;  2IJK A;  3DSQ A;  5J0T A;  2R9R B;  1O9H A;  4LFB B;  1Q7Y W;  1Z5V A;  4J9Y B;  4DV3 B;  3B8N A;  2EIK C;  5EC2 C;  4JI3 O;  4UB2 A;  4J11 A;  1MOF A;  1XNR O;  1K5Q A;  2BCR A;  2KG7 B;  2P90 A;  4MVS A;  4X1I A;  4LF7 B;  5BOM A;  1N8R W;  5B5E Z;  5DDY A;  2QWR B;  1O9G A;  5E1A C;  1Z2G A;  3E89 A;  3H39 A;  4B3T O;  2AXT Z;  3ZBH A;  5LP6 C;  3SPG A;  3C18 A;  4PA3 A;  1L8D A;  1YDX A;  4GX0 A;  3PNC A;  1Q8I A;  1PP9 H;  3OTF A;  9ICG A;  4LFA B;  3AQK A;  1KDH A;  4LT6 A;  4JAS A;  4M9J A;  3BA9 A;  5J2C A;  1EM1 A;  1JQ0 A;  3E8F A;  4B3S B;  1ZTE A;  3CHX A;  1R89 A;  1AIL A;  2Q4P A;  4LZD A;  9ICK A;  4JI6 O;  3RVY A;  3CRM A;  1JPX A;  3ZRS A;  2P22 C;  2FTK A;  5IWA O;  4B7K A;  1NO5 A;  2H94 A;  4QPK A;  2ZH8 A;  5L3E A;  1SES A;  4RWQ A;  4PA7 A;  3AQM A;  1MA1 A;  2WLN A;  4LNU B;  3JAR A;  5L3C A;  8ICV A;  1ZQY A;  3OUY A;  2F93 B;  4RUF A;  3EFF K;  3WFV A;  4IQV A;  2WLL B;  1WNS A;  5TIS Z;  4DUY B;  2OIE A;  3BPZ A;  3C2K A;  2BCS A;  3M8A A;  4RQ6 A;  2QKA A;  2YEV B;  3AG2 C;  2L35 A;  1JX9 A;  1ZQU A;  2WLJ A;  1R8C A;  3OGU A;  2A3Q A;  3UPQ A;  2DJV A;  5IIL A;  4QJF B;  1GH6 A;  3WG7 C;  9ICP A;  3SR2 C;  5JCO A;  1K8A W;  4QZ9 A;  2V7Q G;  2N04 A;  5BOL A;  2IUB A;  3L72 H;  4LZG A;  2P7T C;  4F6E A;  1UPG A;  3VOU A;  4H33 A;  1D2D A;  3N27 A;  4YIO A;  2Y4U A;  4I2E A;  1I08 A;  3B09 A;  1QQC A;  2AGA A;  3ZN1 A;  1D5N A;  3JAM N;  8ICO A;  1WJZ A;  1W2B U;  7ICJ A;  5J0U A;  3ISD A;  1BPX A;  3RYC B;  1EN5 A;  1K4C C;  2RDC A;  1S72 V;  1YZB A;  1PX5 A;  2Q73 A;  4CH6 A;  4L87 A;  4RQ3 A;  3BEH A;  5L3B A;  4ATB B;  4UB3 A;  8ICL A;  2HKO A;  1YSC A;  2HG5 C;  3JPQ A;  1KC8 W;  3V7L A;  1F4M A;  1H2M A;  2IU0 A;  3J7A U;  1KYO F;  3SPH A;  4X65 B;  1MIV A;  4WC3 A;  4FMT A;  5LP6 A;  5J2D A;  4EEQ A;  2PBE A;  1SQV H;  2OTJ V;  3SPI A;  3JAS A;  1RFY A;  1XMO O;  3JD2 A;  2QM8 A;  3JAT B;  4R66 A;  4GX5 A;  4OPA A;  3OMN B;  4R65 A;  1K3E A;  4YHH B;  4O5C A;  4YJ3 A;  5DB7 A;  3WB1 A;  1OCR B;  5J2E A;  4D7S A;  1QHT A;  3T4Z A;  3T1H O;  3N2G A;  5LGN A;  1WAZ A;  1Y66 A;  3CE2 A;  5J0X A;  3TFS A;  5III A;  4M47 A;  3RN4 A;  3A0B Z;  4QIW F;  5LHH A;  4GCZ A;  4Z1V A;  5EIB D;  4E2L A;  1XBL A;  1H8H G;  4E80 A;  4MTF A;  1RM1 B;  3AG1 B;  2PYJ A;  1H2K A;  3O9O A;  3AG3 C;  3MDC A;  3J81 N;  4CS4 A;  4XQ7 A;  3SJQ C;  4JI7 O;  2ZIM A;  4Z1M G;  1XI1 A;  1WOT A;  4RWP A;  2JIZ G;  4NY8 A;  8ICT A;  2V4D A;  4KM5 A;  4CC6 A;  1H8E G;  4JZG A;  4KLS A;  5EIB C;  3UCS C;  3ZHS A;  5D5P A;  3DGE A;  4WC0 A;  3LSU A;  3X2Q B;  1HDJ A;  1COW G;  4NXN O;  4K97 A;  3H9V A;  4AT7 A;  4MFF A;  1V54 C;  1B06 A;  4NTW A;  3F5W C;  2HHH O;  2XT9 A;  3KZI Z;  1IX9 A;  5DM6 V;  4KLJ A;  4KLM A;  2EIJ B;  1RPR A;  5IE9 A;  3QG5 A;  3B2E E;  1AB3 A;  1ZQI A;  1QNM A;  1J5E B;  5J2H A;  3FYI B;  1YJW V;  3EXA A;  3SJA C;  3OUF A;  1PM9 A;  3QNE A;  4XDJ A;  3W7W A;  4U3J B;  4D6T H;  1JJ2 U;  4WF9 V;  4PDV A;  2UUC B;  4Z6D A;  2ADQ B;  2XAQ A;  3L73 H;  4GX2 A;  2IH1 C;  4P4M A;  1PNK A;  2ZQM A;  5D46 A;  2QGN A;  1ZQA A;  3AG4 C;  2XOK G;  2GA9 D;  1N0N A;  2P4V A;  4I2G A;  4MF2 A;  4JI1 B;  3JD0 A;  3STZ C;  5A2Q N;  3PN1 A;  2BTQ B;  5JTG A;  4K0K O;  4DV1 O;  1ZAU A;  3WFS C;  4LR3 A;  2D3O W;  5L3F A;  1L0L H;  1OCC C;  1M93 A;  1NJI W;  1M57 B;  5IJ0 B;  7ICU A;  4FHV A;  4JTD B;  1BGY H;  4I5S A;  5BMV A;  5K1X A;  5DBC A;  1G4Y B;  1MMM A;  3C5F A;  1SA0 B;  1QVF U;  3JAL B;  2ZXW C;  3JSL A;  4NLZ A;  5J2K A;  4LF8 O;  2CUG A;  4EV6 A;  3JAK A;  3T1Y O;  5IYD O;  3JPS A;  2JVD A;  1WP7 A;  2LQT A;  3PHZ A;  2EZO A;  3H3A A;  5BPC A;  4R8C A;  4HAM A;  3ETE A;  4WC1 A;  2Q8V A;  1Q6H A;  4X1I B;  5L3G A;  4B3M B;  2Q67 A;  2HFE C;  5HRF A;  3CS5 A;  4EEB A;  1GAX A;  2YUA A;  4NYK A;  2EJ7 A;  4J10 A;  2HVK C;  1IXB A;  1KKC A;  5IIM A;  1HP8 A;  8ICN A;  1SQX H;  2QSA A;  3QO8 A;  1MQ2 A;  2BBH A;  1MNG A;  5GON A;  2QTS A;  1JA8 A;  1KP3 A;  5J2I A;  5HRB A;  1R8B A;  2X7R B;  3E8H A;  1I94 O;  2ZH6 A;  3RT3 C;  3P30 A;  5LXT A;  3MGI A;  4X89 A;  3ZCC A;  3OT7 A;  7ICO A;  3ABL B;  3R65 A;  4L8J A;  5IDJ A;  4RQ8 A;  4DV4 O;  3OE7 G;  4M9H A;  1Q79 A;  1ZQR A;  3CME V;  7ICE A;  2Q9L A;  4WOY A;  2L6L A;  4PDL A;  1ZQQ A;  2ITC C;  3FB5 C;  2DN9 A;  4UAZ A;  3MAQ A;  1SQP H;  5JJJ B;  1TAE A;  4P4P A;  2E76 B;  4P9O A;  5D63 A;  4F6R A;  3JAR B;  5EBW C;  2RQ6 A;  2ZCE A;  4C7U A;  3H1H H;  4I7Z B;  8ICR A;  3OUS A;  3ZMZ A;  1XHZ A;  2R70 A;  2BPG A;  1AR4 A;  5KHG A;  4YXW G;  4TUY A;  3OMI B;  5JH7 A;  1OU5 A;  1S5L Z;  3ZHU A;  4DV7 B;  1IDS A;  4F5P A;  1N36 B;  1P7G A;  3DXR A;  2HJF C;  4JV5 B;  2EZP A;  2P4K A;  1HR0 O;  2XAF A;  5JVD A;  2ZNI A;  1JN3 A;  7ICG A;  2AZ0 A;  4WBZ A;  2YSU B;  4NKG B;  2DRB A;  1K5S A;  5HRI A;  1ZQF A;  1AR1 B;  3MD0 A;  5B1B C;  4P4O A;  1TVA A;  4NXT A;  3CRA A;  1EZV H;  3T4D A;  2X6C A;  2DQ0 A;  3B40 A;  8ICZ A;  1MG1 A;  3OTO O;  5DKW A;  4ICG A;  3UPS A;  3MDA A;  5LOV A;  3UQ2 A;  4DR7 O;  3K5N A;  2OCC C;  2XAJ A;  4LNU A;  1FJG O;  2IBZ H;  1RM1 C;  1ZQC A;  3DC5 A;  4IQW A;  1YHQ V;  3ZHV A;  1S0V A;  2O57 A;  3QF7 A;  5KA5 A;  3FB7 C;  5LP6 B;  1WP8 A;  3V72 A;  2R9A A;  3MBY A;  3K5L A;  3AQN A;  3JAS B;  2IHO A;  3HJ1 A;  1VQ6 V;  4PH5 A;  1CPY A;  8ICF A;  2BOC C;  4XUS A;  4EBJ A;  7ICR A;  3OAA G;  1XMQ B;  1YCI A;  5FPR A;  3ZMV A;  5K1P A;  4UXN A;  1IVS A;  4JYY A;  4PEL A;  3N2G B;  1JMS A;  2IH3 C;  4DOA A;  4UB8 Z;  4CH4 A;  2BCC H;  3OD4 A;  4P9P A;  2RN9 A;  5DB9 A;  4GKJ O;  3HKB A;  2N05 A;  3G67 A;  4KP4 A;  5BR8 B;  3V7K A;  1OV9 A;  4G2K A;  1L1F A;  4DV6 O;  4XQ8 A;  4QPJ A;  1ZL8 A;  1SF9 A;  1JFF B;  5CA3 A;  5J0O A;  1E1Q G;  4WBY A;  2EIJ C;  4YY3 B;  2PGG A;  4DV2 B;  2A06 H;  2ISO A;  3H1J H;  3APQ A;  3KKY A;  2ZHB A;  2JK5 C;  2JRI A;  2DMX A;  3EVK A;  1NOM A;  3D3Q A;  2B4V A;  4XJE A;  3PML A;  1VP7 A;  1I5X A;  2WPD G;  1ZQV A;  4RUE A;  4DO2 A;  3WG7 B;  1MIW A;  3CB2 A;  3F7V C;  2W0F C;  4J41 A;  2LGQ A;  1HUZ A;  3ZX6 A;  1BQ0 A;  3SYQ A;  4PHD A;  4AT7 B;  2CTP A;  5IIK A;  1ZQX A;  5D61 A;  3KG2 A;  4PPX A;  3C2L A;  5J2J A;  4KLD A;  2CTR A;  8ICU A;  3Q4H A;  2FL4 A;  3L9D A;  3VQY A;  5HFM A;  3TXS A;  2Q7G A;  2UXD O;  1M57 C;  4QZF A;  4Q6G A;  5C8Y A;  1UEU A;  1WN7 A;  3U10 A;  1JVM A;  4JAA A;  4KLF A;  1T5E A;  3D8C A;  2V1D A;  3P3P A;  2Z0A A;  4UCR A;  2PZS A;  4LF5 O;  1OJH A;  4DUZ O;  1K73 W;  1BE3 H;  4PA6 A;  4X1Y A;  2DVI A;  2DE0 X;  2GAF D;  1BL8 A;  4LF4 O;  4JI2 O;  5EC1 C;  1XQ8 A;  3K08 A;  4KUM A;  4LF9 B;  4OPH A;  2AW9 A;  1ZQL A;  5HHH A;  5IY5 C;  1SQG A;  3RYI A;  3E8G A;  1I0H A;  1GRJ A;  4OAG A;  4B08 A;  5B3P A;  2ZE5 A;  4JI5 B;  3M7M X;  4JYB A;  1TV9 A;  3S3X A;  2GSM B;  3L74 H;  4WBN A;  4WFA V;  2Q0O C;  3AG3 B;  4FM2 A;  5BMV B;  4DW1 A;  1WLE A;  1HNX O;  4LF6 O;  4TQF A;  3ZRV A;  4FPP A;  5CFS A;  1XUQ A;  3ABL C;  1NS1 A;  2F23 A;  4I9W A;  3JAK B;  3BRC A;  2WA4 A;  2D2C B;  2XND G;  1H2L A;  1N0J A;  2W9M A;  5KUM A;  2Y69 B;  3K5M A;  4X4N A;  5FLX N;  1CEZ A;  3FD9 A;  3THO A;  1IBK B;  4JF3 A;  3JSN A; 
#chains in the Genus database with same CATH homology
 4AT8 B;  1UEV A;  4ATB B;  1ZQP A;  7ICL A;  1KNY A;  3JYY A;  4UB3 A;  8ICL A;  4NLK A;  3JPQ A;  3V7L A;  4QZB A;  4YD1 A;  1BPY A;  1MIV A;  4WC3 A;  4R63 A;  4TUR A;  2M2V A;  3RJE A;  9ICQ A;  5J2D A;  1RPL A;  2ZH9 A;  2PBE A;  4RT3 A;  1ZQD A;  3TFR A;  4I2F A;  4R66 A;  7ICF A;  3B0Y A;  4R65 A;  4O5C A;  5DBA A;  5DB7 A;  9ICM A;  4I27 A;  5J2E A;  7ICP A;  2ZH1 A;  1RZT A;  4FHW A;  1ZJN A;  2M2U A;  3H38 A;  5J0X A;  5IIO A;  4RWO A;  3TFS A;  5III A;  4QZE A;  4M04 A;  4M47 A;  3JPT A;  5HC9 A;  2ZHA A;  4I29 A;  1XSP A;  5DB8 A;  3OVB A;  5CR0 A;  3V7J A;  4E80 A;  9ICW A;  4PGY A;  4WCW A;  4YMM A;  5CJ7 A;  5DED A;  3MDC A;  4XQ7 A;  1Q78 A;  1UET A;  1KEJ A;  4XA5 A;  2PFQ A;  4RWP A;  1WOT A;  4NY8 A;  8ICT A;  3AU2 A;  1BPE A;  4I2D A;  4KLS A;  4F5R A;  4PGX A;  4WC0 A;  2VAN A;  5DBB A;  3JPN A;  3OUY B;  4TUP A;  3RJI A;  1V4A A;  4AT7 A;  4MFF A;  8ICW A;  4I2H A;  2ZH3 A;  4QZG A;  1F5A A;  2IHM A;  8ICH A;  4KLJ A;  2FMS A;  4QZD A;  4KLM A;  4UBC A;  4RQ2 A;  2I9G A;  5F2V O;  1ZQI A;  3HX0 A;  2DR5 A;  5IIJ A;  5J2H A;  9ICI A;  3LQC B;  4UD4 A;  4MFA A;  4M2Y A;  8ICB A;  8ICP A;  1HUO A;  1JAJ A;  4I2A A;  4RQ5 A;  3PMN A;  8ICA A;  5J2A A;  5CA7 A;  4LVS A;  4FH5 A;  4Z6D A;  4WC5 A;  8ICI A;  2O5A A;  4K4I A;  4Z6E A;  4P4M A;  4KLQ A;  5D46 A;  1ZQA A;  4FHP A;  3RJK A;  4I2G A;  4MF2 A;  2HHP A;  2M2T A;  4O5K A;  4I2C A;  9ICU A;  4KLH A;  1YLQ A;  3WFS C;  4YMN A;  3RH4 A;  4RT2 A;  4KLG A;  4UAW A;  9ICB A;  3UXN A;  8ICJ A;  4YN4 A;  5TZV A;  7ICK A;  7ICU A;  4FHV A;  4YMO A;  4X0A A;  5DDM A;  4Z6C A;  3RH5 A;  7ICV A;  2DRA A;  5DBC A;  3C5F A;  4KLE A;  5J2G A;  4YCX A;  5D49 A;  7ICT A;  8ICE A;  4RQ1 A;  4F5Q A;  4NLZ A;  4RWN A;  5J2K A;  2NRK A;  3ISC A;  8ICM A;  7ICS A;  4RQ0 A;  9ICS A;  3JPS A;  3RJF A;  4KLL A;  2BE3 A;  3H3A A;  5BPC A;  2GWS A;  3GDX A;  4RPZ A;  4FO6 A;  4WC1 A;  1ZQT A;  4M9N A;  8ICC A;  5HHI A;  5EOZ A;  2ZH5 A;  5HRF A;  5CHG A;  4ATB A;  2BCQ A;  5IIM A;  9ICL A;  1JQR A;  8ICN A;  4M5D A;  3JZ0 A;  1MQ2 A;  1TFY A;  4S3N A;  4X4U A;  5HRK A;  3B0X A;  5J0P A;  5J2I A;  4RPY A;  9ICH A;  4O9M A;  4F5O A;  5HRB A;  5J2B A;  4RPX A;  8ICY A;  1R8B A;  3JPR A;  2ZH6 A;  4X5V A;  4XRH A;  2DR7 A;  3HIY A;  5J29 A;  3MGI A;  3JPO A;  3RJH A;  4WC2 A;  7ICO A;  4RQ8 A;  4NKU A;  4M9H A;  1Q79 A;  4AT9 B;  1ZQR A;  3NYB A;  3ISB A;  7ICE A;  3MGH A;  1ZQQ A;  4QZC A;  1ZQS A;  4UAZ A;  4P4P A;  1ZQE A;  4NM1 A;  5HRD A;  2FMQ A;  4KLO A;  8ICR A;  4FHX A;  5CP2 A;  2BPG A;  4GXJ A;  4X4P A;  1XSN A;  1OU5 A;  9ICT A;  5IIN A;  4UAY A;  5HRE A;  4F5P A;  9ICA A;  3RH6 A;  1ZQN A;  2ZH2 A;  2DR8 A;  3HWT A;  3K75 D;  1JN3 A;  4E7X A;  1MIY A;  4DOC A;  7ICG A;  9ICE A;  9ICX A;  4WBZ A;  2ID1 A;  4PGQ A;  5J0Y A;  4O5E A;  2DRB A;  5HRI A;  1ZQF A;  4JWN A;  4P4O A;  8ICX A;  5DB6 A;  1TVA A;  5J0S A;  4KLI A;  8ICK A;  5HRL A;  4M9G A;  2ZH4 A;  3C5G A;  8ICZ A;  4X4R A;  5DKW A;  4UB5 A;  3UPS A;  3MDA A;  1BPD A;  3UQ2 A;  4X4O A;  2P66 A;  3HW8 A;  4PHA A;  1ZQC A;  4IQW A;  1BPZ A;  3RJG A;  1R8A A;  4KLU A;  8ICS A;  2BPF A;  2ISP A;  3V72 A;  1ZQB A;  2ZH7 A;  4K4H A;  4PHP A;  3MBY A;  3AQN A;  4X4T A;  4F5N A;  4DOB A;  3HJ1 A;  4UD5 A;  4MF8 A;  4PH5 A;  5CWR A;  8ICQ A;  5HRG A;  8ICF A;  4MFC A;  4XUS A;  3WFQ E;  4EBJ A;  1ZQJ A;  3JPP A;  2BCU A;  7ICR A;  1VJ7 A;  1ZQK A;  4RQ4 A;  4X0B A;  3RJJ A;  4WC6 A;  1VFG A;  3UXP A;  2PXI A;  2O1P A;  7ICN A;  1JMS A;  4DOA A;  1FA0 A;  1ZQO A;  5DB9 A;  4I2I A;  3AUO A;  2DR9 A;  4PHE A;  3V7K A;  9ICC A;  4XQ8 A;  3HJ4 A;  4IQU A;  4WC7 A;  1MQ3 A;  4M0A A;  4EP7 A;  3AQL A;  4E8F A;  5J0O A;  4WBY A;  8ICG A;  4AT8 A;  4YD2 A;  5HRH A;  4QZI A;  2ISO A;  2ZHB A;  4P2H A;  2PFP A;  3WFO A;  4X4S A;  1NOM A;  2RFF A;  4TUQ A;  5J0Q A;  4UB1 A;  2PFN A;  3PML A;  4NM2 A;  1ZQH A;  4R64 A;  1BPB A;  5CB1 A;  1ZQV A;  3AU6 A;  4QZ8 A;  1MIW A;  9ICN A;  4GXI A;  5J0T A;  3UXO A;  2PFO A;  4IG8 A;  1HUZ A;  5DEC A;  1XSL A;  7ICI A;  2FMP A;  3OV7 A;  4PHD A;  4AT7 B;  5J2F A;  5IIK A;  4UB2 A;  1ZQX A;  2BCR A;  5BOM A;  5DDY A;  4PPX A;  3C2L A;  5J2J A;  4KLD A;  5D4B A;  7ICH A;  4EBK A;  3H39 A;  8ICU A;  9ICO A;  4NLN A;  3L9D A;  3C18 A;  1ZQW A;  3PNC A;  4UB4 A;  9ICR A;  1ZQG A;  4NXZ A;  9ICG A;  3AQK A;  4QZF A;  1KDH A;  4LT6 A;  4M9J A;  5J2C A;  1UEU A;  4DO9 A;  4I2B A;  5J0W A;  3C2M A;  1R89 A;  1ZQM A;  4KLF A;  2M2W A;  4LZD A;  9ICK A;  3WFR E;  1ZQZ A;  3C66 A;  4AT9 A;  4Z6F A;  2DVI A;  1NO5 A;  4WC4 A;  2ZH8 A;  4RWQ A;  7ICQ A;  3AQM A;  4JWM A;  4TUS A;  9ICJ A;  4FH3 A;  4QZH A;  3UQ0 A;  1ZQL A;  5HHH A;  8ICV A;  1ZQY A;  3OUY A;  1TFW A;  4IQV A;  1ZJM A;  3C2K A;  2BCS A;  4FHY A;  4RQ6 A;  1TV9 A;  4K4G A;  9ICF A;  5J0R A;  1ZQU A;  1R8C A;  4NKT A;  3OGU A;  4QZA A;  4I28 A;  3WFP A;  4UBB A;  4RQ7 A;  7ICM A;  3UPQ A;  5IIL A;  4X4V A;  9ICP A;  4QZ9 A;  4KLT A;  2BPC A;  5BOL A;  9ICV A;  4I2J A;  4LZG A;  4GXK A;  2BCV A;  2Q66 A;  4I2E A;  3OVA A;  8ICO A;  4IQT A;  2W9M A;  4M9L A;  7ICJ A;  5J0U A;  3ISD A;  1BPX A;  4X4N A;  5HR9 A;  3LK9 A;  1PX5 A;  4X4Q A;  4RQ3 A;  3OVS A;  3H37 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...