5DEDA

Crystal structure of the small alarmone synthethase 1 from bacillus subtilis bound to its product pppgpp
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
198
structure length
196
Chain Sequence
DKQWERFLVPYRQAVEELKVKLKGIRTLYEYEDDHSPIEFVTGRVKPVASILEKARRKSIPLHEIETMQDIAGLRIMCQFVDDIQIVKEMLFARKDFTVVDQRDYIAEHKESGYRSYHLVVLYPLQTVSGEKHVLVEIQIRTLAMNFWATIEHSLNYKYSGNIPEKVKLRLQRASEAASRLDEEMSEIRGEVQEAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Catalytic mechanism and allosteric regulation of an oligomeric (p)ppGpp synthetase by an alarmone.
pubmed doi rcsb
source organism Bacillus subtilis py79
molecule tags Transferase
molecule keywords GTP pyrophosphokinase YjbM
total genus 62
structure length 196
sequence length 198
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.6.5: GTP diphosphokinase.
pdb deposition date 2015-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04607 RelA_SpoT Region found in RelA / SpoT proteins
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.860 Mainly Alpha Orthogonal Bundle Helix Hairpins Nucleotidyltransferase 5dedA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5dedA01
4M04A 4P4OA 7ICUA 4FHXA 4X5VA 4KLSA 3RJJA 3MGIA 4JWNA 2ZH6A 4QZDA 4MFCA 3WFSC 5DECA 2M2TA 4NM2A 1V4AA 3V7LA 8ICHA 3JPRA 4O9MA 1VFGA 5HRFA 3C18A 2DRBA 5BOLA 4RQ7A 1KEJA 1YLQA 1TV9A 5DB9A 4MFAA 3UPSA 4M47A 1JMSA 5HC9A 4GXKA 4P2HA 2M2VA 1R89A 4NM1A 5J0SA 4WBYA 1BPBA 9ICWA 9ICNA 1ZQLA 1BPZA 3JZ0A 1F5AA 2ISPA 4PHPA 5CWRA 8ICWA 3V7KA 1R8CA 4X4OA 4MFFA 3RH6A 4IG8A 5IIIA 1HUOA 4M9JA 2FMQA 7ICNA 2BCQA 3H3AA 4K4IA 4YMNA 3C66A 3OUYB 4MF2A 4KLEA 7ICPA 3C5FA 4LT6A 2ZH4A 4F5PA 8ICKA 5IIKA 1XSPA 2HHPA 3HJ4A 1BPDA 4KLMA 4I2HA 5HRIA 5HREA 3MGHA 2GWSA 4KLIA 5HRLA 4X0AA 1ZJNA 5DBAA 3LK9A 1ZQQA 4RQ2A 4NLKA 3JPTA 1XSNA 2DR9A 1Q78A 8ICYA 3UXOA 5J2HA 3GDXA 4LVSA 8ICNA 7ICFA 1JAJA 1ZQXA 4IQUA 4PPXA 4RQ4A 1ZQTA 4TUSA 5HR9A 2VANA 4X4QA 8ICRA 4NXZA 4XQ8A 3H37A 4FO6A 5DDYA 5F2VO 4AT8A 5J2KA 8ICTA 4RT2A 5J2DA 5HHIA 4FHYA 5TZVA 5HRDA 4UB4A 3L9DA 8ICQA 2PFOA 4KLOA 1Q79A 4I2AA 4M9NA 7ICVA 3RJKA 2Q66A 3V7JA 5IILA 1NO5A 2DR8A 3K75D 1ZQEA 2P66A 4NKTA 4Z6DA 1ZQHA 3NYBA 3RJHA 2ZH1A 4QZEA 9ICMA 8ICJA 9ICQA 4KLUA 1ZQZA 4F5NA 3B0YA 4WBZA 3UXNA 5DB8A 4UB3A 4O5EA 4NLNA 9ICVA 3RJFA 5J2AA 8ICFA 1TFWA 4GXIA 4WC0A 3RJEA 9ICLA 1ZQNA 9ICGA 8ICMA 4M9HA 3PMNA 4X0BA 1XSLA 3AU2A 5J2EA 2ZH9A 3ISBA 3UQ2A 2ZH5A 4QZ9A 4KLFA 1ZQYA 4XQ7A 1ZQBA 2BCSA 4R66A 3WFOA 4UB2A 4QZIA 4XUSA 1R8BA 1ZQOA 4UBCA 9ICTA 1MQ3A 4KLQA 2NRKA 2BPGA 4EBJA 1WOTA 3MBYA 5IIJA 4I2EA 4AT9A 5J0QA 5J29A 9ICPA 4WC5A 1MIYA 1ZQDA 4RT3A 8ICIA 5DBBA 1ZQUA 2ZH8A 4WC7A 4X4UA 4KLTA 3ISCA 9ICOA 1ZQJA 4P4MA 2DVIA 9ICBA 4IQWA 3B0XA 7ICQA 4UD4A 2ISOA 4RWNA 3JPSA 4I2CA 8ICGA 4TURA 4UAYA 5DB6A 5J0XA 2BCRA 1ZQMA 9ICUA 4R63A 3MDCA 4QZCA 4F5RA 4PGQA 1BPYA 4KLHA 4RQ1A 4GXJA 4X4PA 2FMSA 2ZHAA 5J2GA 4FH3A 2BPCA 7ICLA 1ZJMA 4I2IA 4M2YA 4E80A 5IIOA 5IINA 5HRBA 4WC3A 4M9GA 4P4PA 3UQ0A 4AT7B 4RPXA 5BPCA 2DR5A 2BCVA 8ICUA 5CP2A 3AQLA 2DR7A 3HIYA 4NLZA 8ICZA 4KLLA 8ICLA 1ZQVA 4FHPA 4YN4A 3HX0A 1BPEA 4K4GA 8ICCA 9ICCA 3OGUA 3H39A 3C2KA 4QZGA 3HW8A 3C5GA 5D49A 4M9LA 4IQVA 4WC4A 2W9MA 5DBCA 8ICOA 5DDMA 1TVAA 9ICJA 4RQ3A 1ZQCA 9ICKA 4S3NA 2BE3A 5HHHA 9ICIA 1KDHA 4RQ8A 3TFSA 8ICPA 1ZQAA 1BPXA 8ICSA 1MQ2A 4KLDA 4PGXA 5J0RA 1UEVA 9ICXA 1FA0A 4WC2A 3WFPA 4RQ6A 4KLGA 3RJGA 3RH5A 2O1PA 4YCXA 4EBKA 3AUOA 7ICOA 7ICGA 4XRHA 8ICBA 9ICEA 4DOCA 5CJ7A 2PFPA 2M2WA 5DB7A 4PHAA 7ICKA 9ICRA 3OUYA 4I2JA 4EP7A 3HWTA 4YMMA 4NKUA 5CA7A 4I27A 4I29A 4M0AA 4FHWA 7ICRA 4PHEA 5J2FA 5HRHA 4KLJA 4XA5A 2BPFA 3AQNA 4QZHA 1MIVA 4I28A 1TFYA 8ICEA 4ATBA 2FMPA 4R65A 3H38A 2ZH3A 5CR0A 4Z6EA 1RPLA 4TUPA 3AQKA 3TFRA 4F5OA 4E7XA 7ICEA 4PHDA 1HUZA 2O5AA 9ICFA 7ICMA 5J2JA 5J0UA 5J0PA 4RQ5A 4FHVA 1KNYA 4RQ0A 8ICVA 3OVAA 3HJ1A 2PFNA 5J0YA 4LZGA 4NY8A 1JN3A 2DRAA 4R64A 4UD5A 1RZTA 9ICHA 5CB1A 4X4TA 2ID1A 4RWQA 3JPQA 3C2MA 4DO9A 4YMOA 4WC6A 1ZQIA 4PH5A 4RPYA 4O5KA 4I2BA 4RPZA 1NOMA 5J0OA 2M2UA 3V72A 7ICTA 3MDAA 5HRKA 4K4HA 3OVSA 1ZQSA 2ZHBA 2BCUA 4IQTA 4Z6CA 4RWOA 4YD2A 4DOAA 3JPOA 2IHMA 3OVBA 4TUQA 4ATBB 3UXPA 1VJ7A 3UPQA 4QZAA 3RJIA 3JPNA 2RFFA 3ISDA 5HRGA 5D46A 4MF8A 1UETA 1ZQGA 4I2FA 5EOZA 1UEUA 1JQRA 4WCWA 5CHGA 4UB1A 4WC1A 3PMLA 8ICXA 3JYYA 4I2GA 7ICIA 4X4NA 4X4RA 4UB5A 9ICSA 4I2DA 4PGYA 5DKWA 5BOMA 4UBBA 7ICJA 5DEDA 4UAZA 2I9GA 5J2BA 4AT9B 7ICSA 1ZQWA 2PBEA 5J0WA 3WFQE 8ICAA 4LZDA 7ICHA 4FH5A 3RH4A 4YD1A 1ZQFA 4O5CA 4AT7A 1MIWA 2ZH7A 1PX5A 4M5DA 5J2CA 1OU5A 1ZQKA 4E8FA 4F5QA 3PNCA 5J2IA 2ZH2A 3OV7A 3JPPA 4Z6FA 4JWMA 4X4SA 3C2LA 1ZQPA 3AQMA 5J0TA 1ZQRA 9ICAA 4X4VA 2PXIA 4QZFA 5D4BA 1R8AA 4DOBA 4QZ8A 4UAWA 5IIMA 4AT8B 3LQCB 3WFRE 4RWPA 2PFQA 4QZBA 3AU6A
chains in the Genus database with same CATH superfamily
5JQGA 1URFA 2OYQA 3OEHG 1G6UA 3FFQA 2IJJA 1SF9A 3BABA 1IBMB 1GAXA 4MFCA 3WFSC 5DECA 4OGQB 3RVYA 2F4VO 1GTOA 1HNWB 5LGNA 3V7LA 2UUCB 4CH4A 2F1MA 1VFGA 1YIJV 1KEJA 1YLQA 1EFRG 2OCHA 5DB9A 3DC5A 1H2SB 1LNQA 5HC9A 4K0KB 2M7WA 3E8BA 2ZT9B 1X4TA 4K35A 4BR6A 2XAGA 1PD3A 3OUFA 2BOBC 5J0SA 2R72A 4B3RO 1FPOA 1VQ5V 3BFRA 2ZE7A 1OCCB 4IG8A 3JYCA 5EK0A 1P7GA 4M9JA 2YUAA 4OX9B 4I9WA 2JJ2G 3JD1A 1JOYA 1OV9A 3KCXA 4KHPB 3N2KA 4LT6A 3HKEB 3GWOA 1Y74B 4F5PA 1N34B 2B1IA 1KYOF 3FB5C 3HJ4A 4EEDA 3GB7C 3AG1C 1VQPV 4I2HA 1K9MW 5HREA 4KLIA 5JH7A 4ZOLA 3CK6A 2HG5C 1M5IA 1FS0G 4K98A 2YIBD 1XSNA 3WB1A 2H3OA 1FXKA 4RAIA 5J2HA 4LVSA 2CUGA 2RDCA 1L0NH 3T4DA 1WA8A 1P49A 4TUSA 1MNGA 3ERCC 1WB7A 2R9AA 1JJ2U 4OAFA 3FYEB 4YY3B 2HJFC 2DYSB 3CCQV 3N2GA 2QEXV 3H37A 5DDYA 2GTAA 2HKOA 5J2KA 8ICTA 3ASOC 4XDLA 5J2DA 3CC7V 1S72V 5TZVA 4YJ2B 1NJIW 3ZHSA 4UB4A 4U7OA 1Y66A 1WN7A 1FAFA 3MDSA 3OMIB 3PJSK 4UB6Z 5EIBD 1P4RA 3U0ZA 4O4JA 3FB7C 2DR8A 2P66A 2CK3G 4UFZA 2AXTZ 1WPXA 3Q4HB 1SZXA 2WWWA 1KKCA 1QLEC 2ADPA 4NKGB 1OCZC 5LMUB 4KLUA 3T1CA 4DV7B 4DW1A 4HNAA 3UXNA 2R9IA 4PDLA 3K04A 4FK5C 1YJWV 2PYJA 4B08A 4I50A 1WPBA 2N04A 4ZOLB 2JS5A 3DSQA 4JI7O 5B3SC 4B3RB 3RJEA 3JCFA 2P06A 3E83A 1IDSA 8ICMA 2KKWA 2B56A 1WA8B 4ZIBA 1XSLA 2PZSA 2XTAA 3AU2A 4N21A 5J2EA 3ISBA 2ZE5A 1AI5A 3G80A 4QZ9A 4JYAB 4KLFA 1COWG 4O4LA 1ZQYA 2XAJA 5LA6B 1E1QG 1RPOA 4TV8B 3WFOA 2N05A 5IJ9A 4UB2A 3ETEA 4QZIA 2HVJC 4PA7A 2F4VB 1K97A 4UBCA 2Q7EA 9ICTA 2EINC 1MQ3A 5JH7B 2BPGA 4I2EA 1JFFA 1MA1A 4LF6O 4AT9A 4YIOA 1MIYA 4I0XA 1ZQUA 2ZH8A 4X4UA 1PPJH 5CB4B 2DVIA 3K3WA 5L3CA 1W0JG 4NXUA 3CE2A 3UO3A 4WH5A 2ISOA 3BY6A 3UO2A 3RWRD 4I2CA 8ICGA 4TURA 1T5EA 5J0XA 2Y0IA 3SJQC 4IHJA 2DOSA 4QZCA 1G1XB 2GHYA 4RQ1A 2WSSG 4NXXA 4X4PA 3OMNB 5J2GA 3OW2U 4PELA 2DN9A 3JCUZ 3DC6A 7ICLA 4X66O 4MT8A 4TUYB 1K33A 5IIOA 3ZMVA 2A7WA 4H44B 4DR4O 5BMVB 5CA0A 2YI8A 1IURA 2AW9A 4NVPA 1R3LC 4RPXA 3CRAA 4F6EA 1Y4MA 1AI7A 2RNBA 2DR5A 2IJHA 4TV9A 2HEPA 3RN4A 1YCIA 3ER9B 3F5TA 2GBOA 1VMGA 3SR2C 2DR7A 1J5EO 3HIYA 1TGOA 1BT8A 2E76B 8ICLA 4I50B 1ZQVA 3T4ZA 2B5UA 3L72H 3B4SA 1WB8A 1BPEA 4GLXA 3SYOA 3OGUA 3ML0A 3C2KA 3CRCA 2ZCEA 2IU3A 3FAVB 3P30A 3ZHRA 5C8YA 4M9LA 1WLEA 4IQVA 2WLIA 4FLZA 4OPHA 2W9MA 4PDRA 1TVAA 3B40A 4HX0A 2E5LB 2PUSA 2BE3A 4Z1MG 2EJRA 3CJHB 2CH7B 4J41A 3LUTB 3STZC 2UXNA 3CWBH 4JGSA 4KHPO 4DV0B 3ASOB 1ZQAA 1Z2GA 3ZX6A 4TT3G 5CA1A 4KLDA 4PGXA 4GYCB 3CP1A 1HP8A 4QGPA 4WFEA 3UT5B 2DJVA 2N74A 1RM1B 4JYAO 4OAGA 2O57A 1M90W 4TUYA 4KLGA 1GN2A 3RJGA 1CP9A 3H1LH 4YCXA 3AUOA 2GUZA 7ICGA 2B51A 4KL1A 9ICEA 5DB7A 1JPXA 4TV9B 1SETA 1FFXB 4DXWA 3OUYA 1SQXH 3ZIAG 3BVOA 4RUFA 5CA7A 7ICRA 1YHQV 3QNEA 2IJIA 2VWJA 4DV2B 1PM9A 3AQNA 5CA3A 1MIVA 2EX3A 1TFYA 2IU0A 4LF5O 3MCRA 2FMPA 3I56V 1X59A 1NH2D 1RPLA 3J7AU 2Y48A 1Q5OA 2ADQB 1YITV 4F5OA 1VQMV 4E7XA 3LSQA 2UXBB 1D5NA 1KP3A 1HUZA 1KUQA 2O5AA 2Q67A 3CJHA 2DQ3A 1R6KA 4J9ZB 5J0UA 1EN5A 3SYAA 2IW5A 1MSDA 5LYJB 3JATA 5GW7A 1H2KA 3OVAA 1TAEA 3HJ1A 1F4MA 4NXNB 5J0YA 4LZGA 3W7WA 1L0LH 4QIWF 2DRAA 4NTXA 3ZMSA 1NS1A 2OWOA 4R64A 4KFMA 4UD5A 4LH7A 9ICHA 3O9OA 3IJ4A 3BA8A 4OAIZ 2EWRA 2GAFD 3K5MA 2ID1A 4EGWA 1R73A 1Q8IA 3JPQA 3E22A 3LDEA 3MD0A 4LCUC 5EBWC 4FLTA 1ZWIC 1Q6IA 2RJZA 1Z5VA 4EEQA 2OTLV 1NOMA 4R50A 1IBKB 1JMKC 2XAHA 1H2MA 3OTOO 4DV6B 5EIBC 4L8JA 1QR9A 4K4HA 4GKKB 3OVSA 1ZQSA 3HB3B 1US6A 4IQTA 4RWUA 4Z6CA 2IHMA 3KG2A 3T1YB 3UXPA 1A32A 4QZAA 1PNMA 3RJIA 5LOVA 4MTXA 1I94B 2WLLB 2YIBA 4NXWA 3JAKA 3ISDA 3D36A 3M7MX 3HKDA 4LC1A 3O65A 4FLYA 2Q7HA 2ODMA 5LMNB 3AK2A 1Q81W 3SPJA 5KHKA 1UETA 3ABMC 5EOZA 1K5SA 1V54C 1JQRA 4LFAO 4GT1A 1IBLO 4WC1A 3W7UA 3SJBC 3B09A 1NTMH 3C3SA 4H33A 3ZRWB 3WU2Z 3D3IA 5KMGA 3SPGA 3RYCB 4TWKA 1OCZB 2YXYA 4MVRA 3MAQA 1VQLV 4B3TO 5DEDA 3H9VA 1XBLA 2KSDA 4X66B 3K58A 3UM7A 4LF5B 5J0WA 4LZDA 2F93B 2HJDA 1I5XA 3CCLV 4XDKA 3RH4A 4BIOA 1VF6C 4LR3A 4XBFA 3CRMA 1NTKH 1GRJA 5J2CA 1XREA 4F5QA 2ZH2A 3OV7A 1AR5A 3JPPA 3N2KB 4X4SA 2WLJA 2FB5A 2D2CB 4CS4A 4PJ0Z 4QZ8A 4JZ2A 3VQWA 3JAMN 1G8MA 1R1BA 1SKVA 3G6BA 3C3TA 4X65O 3JD4A 1Q3EA 4Z1VA 7ICUA 1SQFA 4FHXA 3ZMUA 4KLSA 4JWNA 2ZH6A 1KP2A 3OD4A 4QZDA 3W7SA 1VQ6V 2WAMA 3JD3A 4J80A 3BHPA 3ZS8C 2GSMB 2W0FC 3JPRA 1QBZA 4O9MA 1S5JA 5HRFA 1AJPA 4RQ7A 1HNZB 5L3GA 1AB3A 1TV9A 4MFAA 4FZ1A 3WFVA 1YTFD 3SJCC 4ASUG 1AR4A 2BCCH 1VQ7V 1GO3F 1XQ8A 1MG1A 4P2HA 3ZHVA 1SESA 3AG2C 4FIPC 2V1DA 1D5AA 3S3WA 5LOVB 2ETNA 5H2FZ 2EJ7A 3JZ0A 4N7RA 1F5AA 1IXMA 2LP7A 4O2AB 1R8CA 1QQCA 1SA0A 1OHHG 4MFFA 5IIIA 1HUOA 1DLBA 1K92A 3BEHA 1FFXA 3RVZA 3OUYB 2M6YA 4KLEA 4LBEC 4WFBV 1Y76B 2PI5A 4DV0O 2L35A 1GM9A 1BHAA 2HHHO 3K5LA 8ICKA 5J2TA 1M57B 4UUJC 1N8RW 4LFBO 1XNQB 4KLMA 1U97A 2GWSA 4O4HA 1ZJNA 2L6LA 4J11A 4I4TB 2VQEO 3ZBHA 3IC7A 2WLKA 4NLKA 1Q78A 8ICYA 1GPJA 3K08A 2FYUH 5GTIZ 1JAJA 1ZQXA 1M9NA 4JTDB 5B5EZ 3A0BZ 4RQ4A 4LF9O 2Y0PA 1ZQTA 3AK1A 3RYHB 5K1PA 4K99A 3JATB 5HR9A 2BSKB 5JVDB 4XQ8A 2XAQA 1ZL8A 4P9OA 3HKBA 3ZJZA 5GTHZ 4RT2A 1JFFB 3NXSA 2UUAO 3R65A 2PI4A 5TISZ 1N32O 4KB6A 2DW4A 3TJTA 2ITDC 1D2DA 4I55A 3H1HH 4DUZB 1Q79A 4P2ZA 7ICVA 3K5NA 3RJKA 5IILA 1XMQO 1NO5A 3ZRSA 4NKTA 1KB9F 3CYOA 9ICQA 1NR1A 2Q6AA 2KG7B 3L74H 3B0YA 5DB8A 2EIMB 4O5EA 4K8VA 1DF4A 4FM1A 5IYZA 1FJGB 1W0KG 3RJFA 2CDYA 4I4TA 4JI7B 1TFWA 1Q43A 3U10A 2UXCB 3K06A 2XOKG 1GMGA 3AG3C 4HYOA 1NT2B 5LGUA 4X0BA 5CBGA 4K0KO 4DR5O 3VOUA 2ZIMA 2Q68A 2JVDA 3UQ2A 3E89A 2UXDO 1E79G 1GK9A 3VQYA 4XQ7A 4X1IA 4FLVA 4H37A 4WCEV 2A3QA 1XMQB 2BTQB 5ITZB 3HKBB 4N23A 2YXHA 1NVPD 1PP9H 4I7ZB 3MBYA 2QWNB 4PDMA 2Q73A 5J29A 2IH3C 2PGGA 4RT3A 2MW2B 2A06H 1XMOO 9ICOA 4P4MA 4IQWA 2OIEA 3B0XA 2CH7A 2UXCO 3JPSA 2YI9A 3SGIA 2P5OA 5EBMC 3OFNG 4YJ3A 1JX9A 1ZQMA 5KHGA 4O2BB 3LDDA 4WFGA 3MDCA 1I08A 4PGQA 3VQXA 2A0LA 3CXCU 1SRYA 4WBNA 2ZHAA 4FH3A 3JD2A 4M2YA 5FPOA 4EB6A 4O4IA 4GKJB 3JCZA 5B66Z 4AT7B 1DTOA 2P6JA 4U7NA 2YXLA 1Y6XA 1XNRO 2X6BA 4B3MB 4NB5A 5LGTA 1V9PA 3HKCA 4DV5O 2X7RB 3G67A 3OT7A 4OX9O 2A9HA 3UKMA 1BSMA 3ABMB 4KP4A 1IVSA 2IBZH 4DV3B 4B7KA 1L1FA 5ITZA 4NLZA 1KMIZ 4KLLA 8ICZA 3F5WC 5LP6C 2EIJC 2WA3A 3B77A 8ICCA 4EFEA 1IX9A 9ICCA 1N4CA 2VRZA 4DR2O 3I55V 4LNUA 4PI2A 3D8CA 3HW8A 4YHHO 5JJNB 3OUSA 5JWPA 5DBCA 8ICOA 2X6CA 2Z5UA 1F51A 1CXZB 2CAZC 4ZI7B 4RQ3A 9ICKA 5IDJA 1KDHA 4WQKA 5HFMA 4RQ8A 4JZGA 1NVPB 4NXTA 3TFSA 3QO7A 8ICPA 4X9QA 3H1IH 3F7YC 4X89A 1SQPH 1IBMO 4I5SA 5DN6G 4WC2A 2OT5A 3ZCCA 2B9ZA 4RQ6A 4X1KB 4U3JA 5KHHA 2QDOA 4PA6A 1QVGU 1Y67A 3VQVA 4DOCA 4TQFA 3E8FA 4PHAA 5HFLA 4UCSA 4U3FH 1CPYA 2DMXA 4YJ3B 4EP7A 5KAIZ 2ZDIC 3HWTA 4NKUA 3CC4V 4I29A 1NU1H 4E2LA 5HRHA 5J2FA 5CFSA 3W7XA 3JASB 2BPFA 4QZHA 3AG7A 1HNWO 4I28A 4JYYA 4Z2WA 4DV1B 2QM8A 4R65A 4K8XA 3AQKA 2P67A 3JSNA 4TV8A 4NXVA 7ICEA 4PHDA 1R6NA 4DR3O 4UCOA 2ZM6O 3FYIB 5J2JA 1Q6UA 2C2AA 2EILB 1N36B 4K96A 3ZRVA 4FHVA 4J9YB 4RQ0A 4X65B 3FD9A 4E4EA 1GN3A 4I0XB 5KHJA 3T2MA 4F6RA 2Q4PA 4UVCA 3RYIA 2ZINA 4EEBA 5CB1A 2Q0AA 4BW5A 2ATKC 4JPRA 4RWQA 3C2MA 2JIZG 4YMOA 4WC6A 1YTFB 4D7TA 4JI0O 2MK3A 1I5YA 4O5KA 1VIBA 3OMAB 2VWKA 2HR3A 3N27A 4QPJA 5J0OA 3LDCA 1UJWB 1GM8A 3MDAA 4X64B 3SPIA 2Q7GA 4DW0A 2EINB 1XI1A 4JI1B 1F7YA 4DV4O 5H6RA 1F4NA 2P7TC 1QLNA 4MVMA 4RWOA 4YD2A 4LFCB 4JF3A 3EVKA 2CTQA 4LF4O 3LNMB 2GV9A 1EZVH 1KBHA 1VJ7A 2H94A 5CFUA 1HNXB 3A2FA 4DR6B 2DWDC 4UV9A 1BQ0A 5HRGA 2YEVB 4HAMA 3T1HB 4CC5A 2YC0A 5KA6A 4FVMA 4JI8B 2IHOA 2VQFB 2QM4A 1BL8A 2QWRB 4G28B 4UB1A 4NTYA 4IGGA 3E2EA 3PMLA 3ABLC 3T1YO 3JYYA 4I2GA 3ZEDA 2HP8A 3CCJV 3FAVA 3LSSA 4UB5A 9ICSA 1NI8A 4FFBB 3ETDA 5D62A 1H8HG 4PGYA 5BY1A 5DKWA 5BOMA 5B3QA 5LHHA 4WBNB 7ICJA 3K59A 1M93A 3E8HA 3A0HZ 3Q4HA 8ICAA 4FH5A 4HZ3A 4YD1A 3KCYA 3APOA 5CBFA 5KHIA 4HNAB 1BQZA 4AT7A 2ZH7A 1EN4A 3FB8C 1PX5A 2ZD9A 5K1XA 4ICGA 4LWSA 4E8FA 2LW1A 1K5QA 5J2IA 4LEZA 3C2LA 1VEWA 1Q82W 1BGYH 1ZLZA 1ZQRA 9ICAA 2PXIA 2V7QG 1HDJA 3ZMZA 2YIDA 1ZTEA 3CCVV 4FM0A 3JARA 1S3JA 3EXAA 3FX7A 2CGNA 3X2QB 5E1AC 5B1AC 2PFQA 2ILMA 1GKFA 5B1AB 4JV5O 4M04A 4P4OA 4H13B 4O68A 4J7JA 4X5VA 3RJJA 2HN1A 3MGIA 4RQEA 5GONA 2M2TA 4NM2A 4ZI7A 1V55C 1M4UA 2D3OW 4CC6A 1V55B 3C18A 5BOLA 3TGUH 4X1YA 1PL0A 3CMEV 3UPSA 4M47A 1XL4A 4O6AA 2FL4A 2E5LO 2BOCC 5IT9N 4GXKA 3A0RA 1AP6A 1RM1C 4A5UB 2BBHA 2NLJC 3CCRV 4O69A 1AJNA 2M2VA 1R89A 1KU9A 5IYBO 3QO8A 2LQTA 3K0DA 5FNVB 1GM7A 2BBJA 9ICWA 4JTCB 1BPZA 3BRCA 2EILC 3T1HO 4YHHB 2ISPA 4PHPA 5CWRA 5LHIA 2WPDG 4LH6A 5CN0A 2UU9O 4LWSB 7ICNA 3NWIA 3H3AA 2BCQA 3DXRB 1WAZA 5D61A 3TCUA 2QWPB 3RGBA 5IWAB 7ICPA 4JAAA 1N33O 4UVBA 2ZH4A 4LFCO 1H2NA 5IIKA 3JARB 5IYZB 4JI1O 2UUBO 1AI4A 3JASA 1HR0O 1BPDA 4DR5B 2JS3A 5HRLA 2Y4UA 1R3KC 4DUYB 4X0AA 4BIZA 3LK9A 1ZQQA 4LF7B 3K57A 3F7VC 3APQA 4K97A 4UCTA 2Q5ZA 5B1OA 4IYIA 2DR9A 4JI0B 4LEYA 1RPRA 3UXOA 4K3AA 8ICNA 1THZA 1FJGO 3ZRXA 2ARHA 1E1RG 4RO2A 2LJ2A 2VS0A 4B7EA 4YJ2A 2VANA 3E35A 3TETA 2HFEC 8ICRA 4MW3A 1K73W 5CA0B 2YS8A 2BTQA 3K9SA 4O4JB 1JCHA 1S5LZ 2LFRA 4DK0A 1NKDA 1B04A 3RYIB 3RBZA 4IT5A 3P3PA 2X6AA 5HRDA 1M56C 3L9DA 4DV5B 4KLOA 4FM2A 2ZM6B 3K79A 4M9NA 2NNUA 3N2GB 2Q66A 1BZKA 1Q86W 1ZQEA 3SYPA 3NYBA 4PA3A 2CGOA 2HLDG 2ZH1A 4QZEA 1I7FA 1JVMA 3BPZA 3FB6C 1TUEB 4X1YB 4X62O 4ZBMA 2WLNA 4UB8Z 1O9HA 3KZIZ 1ZQZA 5JQGB 1BS3A 4UB3A 2Q8VA 1J95A 1RP3B 3CHXA 5EC2C 5FNVA 5J2AA 1KC8W 4FPPA 4O4LB 2OCCB 3CB2A 4GXIA 5EBLC 4I0UA 4WC0A 5CA1B 4MVQA 9ICLA 1EM1A 9ICGA 5IJ9B 2PTMA 3QF7A 2QKSA 2ZR2A 2YEVA 3PMNA 3OAAG 3AG3B 4IYHA 2P22C 1P7BA 3JALB 2YICA 4GZRB 1XDCA 4R7CA 3EFFK 4PA4A 5DM6V 3ABTA 1EN6A 2Z0AA 2YIAA 2NN4A 2LGWA 4MW8A 3SDLA 2BCSA 3H1KH 1B06A 5KUKA 3AG4C 4X20B 4L87A 5IE9A 3AG4B 4JI2B 1WOTA 1XL6A 5IIJA 5J0QA 5A2QN 2QWOB 2DWEC 2AZ0A 1ORQC 4NTWA 2JJ1G 4B3SB 4WC5A 4HBNA 4MS2A 2PF4E 4ZKIA 8ICIA 3L71H 3ZMTA 1SC5B 4WC7A 4KLTA 3ISCA 2YDEA 2EIKB 1PNKA 3VBBA 7ICQA 4CZZA 1MABG 1PV0A 4RWNA 2P4VA 4J7ZA 5CBHA 3JSLA 2XHBA 2DYRB 5CFTA 2E3CA 1YDXA 3CPWU 4R63A 1K34A 2R70A 3ETQA 4ABMA 1TUBA 4F5RA 1BPYA 2ZDIA 4KLHA 4QPKA 1B3QA 4DV7O 3K7DA 4TSFG 3ASNB 3HKEA 3BCCH 1XOUA 1Y74A 4I2IA 5FPRA 3GVMA 4E80A 4RUEA 3JD0A 4P4PA 3UQ0A 2Y69B 1SQGA 1BE3H 5L3BA 5BPCA 5J2UB 4GX0A 3QO5A 1LUWA 2AHYA 8ICUA 2R9RB 3SPHA 2ZNIA 2UUBB 1UFIA 1YVWA 4JASA 3CS5A 1VQ4V 5BMVA 4CS3A 3AQLA 4LF8O 4KUMA 3JAKB 1VQ8V 2G38A 4FHPA 3HX0A 1QR8A 2ZXWB 1SERA 2CTRA 1VQ9V 5EZYB 1VF5B 3H39A 3LSUA 4LF9B 3C5GA 1K3EA 5D49A 4WC4A 3JAWB 2ZKOA 3TXSA 4JI6O 4S3NA 1LUVA 1NZ6A 3E8GA 3DXRA 1OJHA 3D36C 2WLLA 2GUZB 2QSAA 5C8YB 1N33B 4WQLA 2GDSA 3AG1B 8ICSA 1FKAO 3IGAC 4ZHQA 5J0RA 4DRXA 1FA0A 1VF6A 2IUBA 5FLXN 3OGCC 3WFPA 2UXDB 2X0LA 3D3QA 4DYLA 2O1PA 7ICOA 4MTOA 5KMGB 4WFFA 8ICBA 3M99B 1H2GA 3NKUA 4UXNA 4NXMB 2QKCA 1NR7A 3DTUB 1KKDA 7ICKA 3OTFA 1OCCC 2F95B 2Q9LA 2RN9A 4YMMA 4DV4B 4I27A 4GKKO 2Z3YA 4M0AA 1SS3A 3OWGA 2PYLA 4X8AA 4TQDA 2JGDA 2LW7A 5LA6A 4DR1B 8ICEA 1HNZO 2ZH3A 1H8EG 5CR0A 4Z6EA 2W6IG 4TUPA 4DR1O 1JQ0A 5C93A 5BR8B 2QTOA 4W4KA 4LF7O 3JAWA 1DK1A 4FFKA 3CCEV 1FFTB 1PNLA 3K03A 4P9PA 4JI5B 5D5QA 1L8DA 1WP8A 1WNSA 1BHBA 8ICVA 1NBMG 2WA4A 2PFNA 4NY8A 1RZTA 2LFSA 5IJ0B 4X4TA 5CHEA 2XT9A 1XILA 4IHJB 4I9QA 1I94O 2QR4A 3CXHF 1ZQIA 4PH5A 3ABKC 3JALA 4LF4B 3ABKB 1UPGA 3V72A 2QKAA 4R6ZA 5LXTB 4DUYO 7ICTA 3E22B 4O4HB 5HRKA 1FXKB 4XJEA 4QE7A 4ZHQB 2ZHBA 3HKDB 5EYPB 1SQBH 4X20A 4TUQA 4UCVA 5IWAO 5JJEB 1Y76A 1AR1B 1R3JC 4DR2B 1SQVH 5LP6A 3QG5A 4DR6O 3UQ8A 3JPNA 2RFFA 1M56B 4JAVA 5B3SB 3FKSG 3QTCA 1OCRB 1ZQGA 3IFXA 4LF8B 2JDIG 3J80N 3H01A 4WCWA 3OE7G 3RYFB 3HPLC 4IIJB 8ICXA 3K0GA 4X64O 4X4NA 4NXNO 3ABLB 2DE0X 4X4RA 1Q7YW 3A8TA 1MZEA 5B1NA 1K8AW 4MTGA 1TUBB 1DF5A 3G71V 5IJ0A 4Q20A 2JEXA 3RYHA 1XHXA 4JI3O 1IZ3A 2IM9A 1Z5WA 3M8AA 1ZQWA 3WFQE 2UXBO 3BA9A 1ZL8B 1YF2A 4O5CA 3WB0A 4MTFA 1MIWA 2IH1C 5J2UA 1W59A 4M5DA 1OU5A 5LXTA 4CS2A 4Z6FA 4JWMA 2YSUB 1FYJA 3L73H 4X4VA 4BIUA 1MOFA 3OEEG 4QZFA 5D4BA 1ZAUA 2B1GA 3NR7A 3STLC 4NXMO 1U96A 5IIMA 2JK5C 4AT8B 4B3MO 3LQCB 3RW0A 1LR1A 3PHZA 4B3SO 5EZYA 3X2QC 3AU6A 5LHGA 3IC9A 5CMUA 2Q69A 3AK3A 4BAYA 2OTJV 3WG7B 5KA5A 3TXQA 1V4AA 2QE7G 1R3IC 1YZBA 8ICHA 1K4CC 3RYFA 5KAFZ 2DRBA 2EIKC 1YJNV 2IJKA 2K1EA 2RCVA 1H38A 4K9BA 4JI6B 1XHZA 1JMSA 2DYRC 4DRXB 4O67A 2ZIOA 1YSCA 4NM1A 4GCZA 4D7SA 5LP6B 4WBYA 3ZN1A 1BPBA 1XMOB 2FKXA 4CH5A 9ICNA 1ZQLA 5JCOA 3C90A 1K4DC 8ICWA 5J2TB 3V7KA 4X4OA 1QU7A 1MZFA 1ENVA 3SYQA 2QA4V 3RH6A 2PY5A 2FMQA 2B4VA 4K4IA 1ROPA 3CX5F 4K8ZA 3C66A 4YMNA 4MF2A 3B8MA 3CC2V 2QGNA 1Q6HA 4X62B 1S0VA 3C5FA 4O2AA 5IYDO 4EB6B 5J9PC 1XSPA 2HHPA 4PHZA 4D6TH 5HRIA 3MGHA 4DV6O 2FMLA 3KKYA 5DBAA 5L3EA 4DK1A 3RFRA 1IBKO 4BW9A 3B2EE 3HKCB 3L75H 4EV6A 3SJAC 1K7DA 5BR8O 4DR4B 2ZXWC 1XUQA 1S77D 4RQ2A 3JPTA 2BTOA 3GDXA 7ICFA 1FXHA 4IQUA 4PPXA 2JRIA 4PDVA 4EKWA 4PA9A 3PN1A 4DV3O 4X4QA 2DYSC 2NR5A 2AZ2A 4NXZA 2LGQA 2F23A 4FO6A 5F2VO 4AT8A 1M1KW 4AQYO 5KUMA 5HHIA 4FHYA 4KM5A 3ZN0A 4Q6GA 8ICQA 2PFOA 1N36O 4JI2O 2KG7A 3RYCA 5KLVH 4I2AA 3AG2B 1YEWA 2ZQMA 1N32B 4JLZA 3V7JA 3CCUV 4FFBA 2ZR3A 1W2BU 3K75D 4Z6DA 1ZUQA 3IAYA 2JEUA 5JTGA 1ZQHA 3RJHA 9ICMA 1N0NA 8ICJA 4MVUA 4DV1O 4WFHA 2K9PA 4I55B 2ZE6A 4F5NA 4WBZA 4DV2O 1GN6A 4U3JB 4NLNA 5EYPA 3ZHUA 1KD1W 9ICVA 2GA9D 1PKXA 2GTSA 1VQKV 8ICFA 3H1JH 2FTKA 3CRQA 1TA8A 2OCCC 4PV1B 4UVAA 4X1IB 3EF2A 1ZQNA 3ER8C 4M9HA 3K9AA 2ZH9A 4CH6A 1XNQO 1YI2V 5KX5B 2ZH5A 4G27B 2EIJB 4LF6B 4IIJA 4H0LB 1SZTA 4JTAB 2HHHB 1ZQBA 3BAAA 4PD4F 1EBOA 4G2KA 4RQFA 2OIGA 4R66A 4K9AA 2AGAA 2XUMA 4AILC 5H5NA 4GX1A 3CD6V 4XUSA 5GONB 1R8BA 1ZQOA 5D5PA 2EZOA 1ZX3A 4MKPA 4KLQA 2NRKA 3WB2A 4EBJA 5LYJA 2QJ1A 3WG7C 9ICPA 1ZQDA 2JGUA 3CEIA 5DBBA 4O2BA 4MVSA 4AQYB 1ZQJA 1MMMA 5A9GA 1NQTA 9ICBA 2UUAB 4UD4A 2EBOA 2F66C 4IL6Z 4LP8A 3HR0A 1QHTA 2EZPA 2WLHA 3E86A 4UAYA 5DB6A 5D63A 3THOA 2BCRA 4PI0A 2EULA 4YY3O 9ICUA 2ZE8A 1SA0B 1GH6A 2UXXA 2CTPA 1YXBA 4GXJA 2FMSA 4FLWA 1FXKC 2UUCO 3ZHTA 2BPCA 1HWYA 5LMUO 1EZJA 3UCSC 4GX2A 4C7UA 5BZBA 4JLXA 3R66A 4LEVA 4LEWA 1ZJMA 1BCCH 4YIPA 4CBCA 2QWQB 5IINA 5HRBA 4NYKA 1XNRB 4WC3A 4M9GA 4F6RB 1RSOB 2BSKA 5JVDA 4FO1A 2Y69C 4GKJO 3ETGA 4QJFB 2BCVA 5KX5A 1O9GA 4LFBB 1TVKA 1IBLB 3G6EV 5CP2A 3OR7C 2VQFO 3ICXA 5FL7G 3CCSV 2WLMA 5H6QA 2H8PC 2JGDB 4J42A 2W0XA 4YN4A 4QNHB 4K4GA 1G4YB 1RFYA 1HNXO 4KXRA 2XAFA 4QZGA 3L70H 3SYCA 4EFBA 3CCMV 4J10A 3S3XA 3ZRWA 5AG2A 4DO2A 2E74B 5DDMA 9ICJA 2LO1A 1ZQCA 2Q0OC 5HHHA 9ICIA 2RQ6A 3SPCA 3P32A 4MVOA 4FZ0A 1XEQA 1AJQA 4X1KA 1M57C 3OTOB 4WF9V 3OGIB 4X88A 1BPXA 1MSWD 3K5OA 1MQ2A 1B6QA 4JAUA 1Q90D 1UEVA 9ICXA 1N34O 3OR6C 4LFAB 3W7TA 5LBQA 1OCOB 5B1BB 1OCOC 2FCLA 3RH5A 4EBKA 2P4KA 1YJ9V 3ABUA 1I0HA 1JJOA 4DUZO 1FXVA 4XRHA 1VQOV 5CJ7A 2PFPA 2M2WA 2XNDG 1IXBA 3CRRA 9ICRA 2RMKB 1P84F 4FJCC 4I2JA 3AEIA 1VARA 2E75B 4GUNA 4FHWA 4FLXA 4W4LA 3RT3C 4PHEA 4KLJA 2W6JG 4XA5A 5E79Z 4WOYA 4JI4O 3P3NA 4ATBA 4JI3B 5L3FA 3H38A 4NR1A 1HW7A 1N0JA 4BWAA 1VF7A 1AILA 4JV5B 3TFRA 2AHZA 1ZSPA 1PL4A 1GN4A 2WLIB 3B8NA 9ICFA 7ICMA 4WFAV 4QE9A 1HR0B 4MVZA 5J0PA 4RQ5A 1TVKB 1KNYA 1SQQH 5IYCO 3LNNA 2EIMC 1S76D 1WJZA 1CEZA 5JJJB 4R8CA 1JN3A 4CH3A 1R6TA 4P30A 3G4SV 5B3PA 4MSWC 5LL6Y 3CMAV 4AI8A 2UU9B 4J7KA 4UCUA 2KB1A 1AROP 3UT5A 4DO9A 3GWKC 1NTZH 2ITCC 4F4LA 4RPYA 3EHBB 2F43G 4I2BA 2HVKC 4RPZA 2HN2A 2VQEB 4DR7B 2M2UA 3TK1A 1QCEA 4UCRA 4O4IB 3QVNA 3CSXA 4FMTA 4OPAA 4AHCA 2P90A 2BCUA 4DOAA 3JPOA 1BMFG 4TOIA 3OVBA 4JI8O 1JR9A 5EC1C 5LMNO 3MHHC 4ATBB 4OXSA 3UPQA 3MHSC 2ZNJA 5BXZA 5D46A 1V54B 2CTWA 1JA8A 2A79B 1J5EB 4MF8A 3J81N 4I2FA 3DGEA 1OCRC 4LNUB 1UEUA 5CHGA 5H9CA 4GX5A 1NH2B 1KQSU 4JI5O 7ICIA 1FD9A 4I2DA 1QLEB 4JYBA 4DR3B 3ASNC 1WP7A 1AVMA 1AI6A 1H2LA 4XDJA 4UBBA 5L3DA 4UAZA 3OM3B 2KQXA 5JCOC 2I9GA 5IY5B 5J2BA 4AT9B 2V4DA 7ICSA 2PBEA 3NVOA 4DR7O 4JYCA 5IY5C 7ICHA 1AP5A 1ZQFA 2QTSA 1RSOA 5CB4A 2QM7A 1QVFU 4YXWG 4B3TB 1ZQKA 1KECA 4JI4B 3PNCA 1DGSA 1ZQPA 1S5HC 1VQNV 3AQMA 5J0TA 1VP7A 3ZHQA 1F23A 4OAHA 1R8AA 1QNMA 4DOBA 5B1BC 2XASA 4UAWA 2Y4TA 1OZ0A 3I5DA 3U11A 3WFRE 4RWPA 4UV8A 4QZBA 2DQ0A 4FLUA 2CE4A
chains in the Genus database with same CATH topology
4M04A 4P4OA 7ICUA 4FHXA 4X5VA 4KLSA 3RJJA 3MGIA 4JWNA 2ZH6A 4QZDA 4MFCA 3WFSC 5DECA 2M2TA 4NM2A 1V4AA 3V7LA 8ICHA 3JPRA 4O9MA 1VFGA 5HRFA 3C18A 2DRBA 5BOLA 4RQ7A 1KEJA 1YLQA 1TV9A 5DB9A 4MFAA 3UPSA 4M47A 1JMSA 5HC9A 4GXKA 4P2HA 2M2VA 1R89A 4NM1A 5J0SA 4WBYA 1BPBA 9ICWA 9ICNA 1ZQLA 1BPZA 3JZ0A 1F5AA 2ISPA 4PHPA 5CWRA 8ICWA 3V7KA 1R8CA 4X4OA 4MFFA 3RH6A 4IG8A 5IIIA 1HUOA 4M9JA 2FMQA 7ICNA 2BCQA 3H3AA 4K4IA 4YMNA 3C66A 3OUYB 4MF2A 4KLEA 7ICPA 3C5FA 4LT6A 2ZH4A 4F5PA 8ICKA 5IIKA 1XSPA 2HHPA 3HJ4A 1BPDA 4KLMA 4I2HA 5HRIA 5HREA 3MGHA 2GWSA 4KLIA 5HRLA 4X0AA 1ZJNA 5DBAA 3LK9A 1ZQQA 4RQ2A 4NLKA 3JPTA 1XSNA 2DR9A 1Q78A 8ICYA 3UXOA 5J2HA 3GDXA 4LVSA 8ICNA 7ICFA 1JAJA 1ZQXA 4IQUA 4PPXA 4RQ4A 1ZQTA 4TUSA 5HR9A 2VANA 4X4QA 8ICRA 4NXZA 4XQ8A 3H37A 4FO6A 5DDYA 5F2VO 4AT8A 5J2KA 8ICTA 4RT2A 5J2DA 5HHIA 4FHYA 5TZVA 5HRDA 4UB4A 3L9DA 8ICQA 2PFOA 4KLOA 1Q79A 4I2AA 4M9NA 7ICVA 3RJKA 2Q66A 3V7JA 5IILA 1NO5A 2DR8A 3K75D 1ZQEA 2P66A 4NKTA 4Z6DA 1ZQHA 3NYBA 3RJHA 2ZH1A 4QZEA 9ICMA 8ICJA 9ICQA 4KLUA 1ZQZA 4F5NA 3B0YA 4WBZA 3UXNA 5DB8A 4UB3A 4O5EA 4NLNA 9ICVA 3RJFA 5J2AA 8ICFA 1TFWA 4GXIA 4WC0A 3RJEA 9ICLA 1ZQNA 9ICGA 8ICMA 4M9HA 3PMNA 4X0BA 1XSLA 3AU2A 5J2EA 2ZH9A 3ISBA 3UQ2A 2ZH5A 4QZ9A 4KLFA 1ZQYA 4XQ7A 1ZQBA 2BCSA 4R66A 3WFOA 4UB2A 4QZIA 4XUSA 1R8BA 1ZQOA 4UBCA 9ICTA 1MQ3A 4KLQA 2NRKA 2BPGA 4EBJA 1WOTA 3MBYA 5IIJA 4I2EA 4AT9A 5J0QA 5J29A 9ICPA 4WC5A 1MIYA 1ZQDA 4RT3A 8ICIA 5DBBA 1ZQUA 2ZH8A 4WC7A 4X4UA 4KLTA 3ISCA 9ICOA 1ZQJA 4P4MA 2DVIA 9ICBA 4IQWA 3B0XA 7ICQA 4UD4A 2ISOA 4RWNA 3JPSA 4I2CA 8ICGA 4TURA 4UAYA 5DB6A 5J0XA 2BCRA 1ZQMA 9ICUA 4R63A 3MDCA 4QZCA 4F5RA 4PGQA 1BPYA 4KLHA 4RQ1A 4GXJA 4X4PA 2FMSA 2ZHAA 5J2GA 4FH3A 2BPCA 7ICLA 1ZJMA 4I2IA 4M2YA 4E80A 5IIOA 5IINA 5HRBA 4WC3A 4M9GA 4P4PA 3UQ0A 4AT7B 4RPXA 5BPCA 2DR5A 2BCVA 8ICUA 5CP2A 3AQLA 2DR7A 3HIYA 4NLZA 8ICZA 4KLLA 8ICLA 1ZQVA 4FHPA 4YN4A 3HX0A 1BPEA 4K4GA 8ICCA 9ICCA 3OGUA 3H39A 3C2KA 4QZGA 3HW8A 3C5GA 5D49A 4M9LA 4IQVA 4WC4A 2W9MA 5DBCA 8ICOA 5DDMA 1TVAA 9ICJA 4RQ3A 1ZQCA 9ICKA 4S3NA 2BE3A 5HHHA 9ICIA 1KDHA 4RQ8A 3TFSA 8ICPA 1ZQAA 1BPXA 8ICSA 1MQ2A 4KLDA 4PGXA 5J0RA 1UEVA 9ICXA 1FA0A 4WC2A 3WFPA 4RQ6A 4KLGA 3RJGA 3RH5A 2O1PA 4YCXA 4EBKA 3AUOA 7ICOA 7ICGA 4XRHA 8ICBA 9ICEA 4DOCA 5CJ7A 2PFPA 2M2WA 5DB7A 4PHAA 7ICKA 9ICRA 3OUYA 4I2JA 4EP7A 3HWTA 4YMMA 4NKUA 5CA7A 4I27A 4I29A 4M0AA 4FHWA 7ICRA 4PHEA 5J2FA 5HRHA 4KLJA 4XA5A 2BPFA 3AQNA 4QZHA 1MIVA 4I28A 1TFYA 8ICEA 4ATBA 2FMPA 4R65A 3H38A 2ZH3A 5CR0A 4Z6EA 1RPLA 4TUPA 3AQKA 3TFRA 4F5OA 4E7XA 7ICEA 4PHDA 1HUZA 2O5AA 9ICFA 7ICMA 5J2JA 5J0UA 5J0PA 4RQ5A 4FHVA 1KNYA 4RQ0A 8ICVA 3OVAA 3HJ1A 2PFNA 5J0YA 4LZGA 4NY8A 1JN3A 2DRAA 4R64A 4UD5A 1RZTA 9ICHA 5CB1A 4X4TA 2ID1A 4RWQA 3JPQA 3C2MA 4DO9A 4YMOA 4WC6A 1ZQIA 4PH5A 4RPYA 4O5KA 4I2BA 4RPZA 1NOMA 5J0OA 2M2UA 3V72A 7ICTA 3MDAA 5HRKA 4K4HA 3OVSA 1ZQSA 2ZHBA 2BCUA 4IQTA 4Z6CA 4RWOA 4YD2A 4DOAA 3JPOA 2IHMA 3OVBA 4TUQA 4ATBB 3UXPA 1VJ7A 3UPQA 4QZAA 3RJIA 3JPNA 2RFFA 3ISDA 5HRGA 5D46A 4MF8A 1UETA 1ZQGA 4I2FA 5EOZA 1UEUA 1JQRA 4WCWA 5CHGA 4UB1A 4WC1A 3PMLA 8ICXA 3JYYA 4I2GA 7ICIA 4X4NA 4X4RA 4UB5A 9ICSA 4I2DA 4PGYA 5DKWA 5BOMA 4UBBA 7ICJA 5DEDA 4UAZA 2I9GA 5J2BA 4AT9B 7ICSA 1ZQWA 2PBEA 5J0WA 3WFQE 8ICAA 4LZDA 7ICHA 4FH5A 3RH4A 4YD1A 1ZQFA 4O5CA 4AT7A 1MIWA 2ZH7A 1PX5A 4M5DA 5J2CA 1OU5A 1ZQKA 4E8FA 4F5QA 3PNCA 5J2IA 2ZH2A 3OV7A 3JPPA 4Z6FA 4JWMA 4X4SA 3C2LA 1ZQPA 3AQMA 5J0TA 1ZQRA 9ICAA 4X4VA 2PXIA 4QZFA 5D4BA 1R8AA 4DOBA 4QZ8A 4UAWA 5IIMA 4AT8B 3LQCB 3WFRE 4RWPA 2PFQA 4QZBA 3AU6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M04 A;  4P4O A;  7ICU A;  4FHX A;  4X5V A;  4KLS A;  3RJJ A;  3MGI A;  4JWN A;  2ZH6 A;  4QZD A;  4MFC A;  3WFS C;  5DEC A;  2M2T A;  4NM2 A;  1V4A A;  3V7L A;  8ICH A;  3JPR A;  4O9M A;  1VFG A;  5HRF A;  3C18 A;  2DRB A;  5BOL A;  4RQ7 A;  1KEJ A;  1YLQ A;  1TV9 A;  5DB9 A;  4MFA A;  3UPS A;  4M47 A;  1JMS A;  5HC9 A;  4GXK A;  4P2H A;  2M2V A;  1R89 A;  4NM1 A;  5J0S A;  4WBY A;  1BPB A;  9ICW A;  9ICN A;  1ZQL A;  1BPZ A;  3JZ0 A;  1F5A A;  2ISP A;  4PHP A;  5CWR A;  8ICW A;  3V7K A;  1R8C A;  4X4O A;  4MFF A;  3RH6 A;  4IG8 A;  5III A;  1HUO A;  4M9J A;  2FMQ A;  7ICN A;  2BCQ A;  3H3A A;  4K4I A;  4YMN A;  3C66 A;  3OUY B;  4MF2 A;  4KLE A;  7ICP A;  3C5F A;  4LT6 A;  2ZH4 A;  4F5P A;  8ICK A;  5IIK A;  1XSP A;  2HHP A;  3HJ4 A;  1BPD A;  4KLM A;  4I2H A;  5HRI A;  5HRE A;  3MGH A;  2GWS A;  4KLI A;  5HRL A;  4X0A A;  1ZJN A;  5DBA A;  3LK9 A;  1ZQQ A;  4RQ2 A;  4NLK A;  3JPT A;  1XSN A;  2DR9 A;  1Q78 A;  8ICY A;  3UXO A;  5J2H A;  3GDX A;  4LVS A;  8ICN A;  7ICF A;  1JAJ A;  1ZQX A;  4IQU A;  4PPX A;  4RQ4 A;  1ZQT A;  4TUS A;  5HR9 A;  2VAN A;  4X4Q A;  8ICR A;  4NXZ A;  4XQ8 A;  3H37 A;  4FO6 A;  5DDY A;  5F2V O;  4AT8 A;  5J2K A;  8ICT A;  4RT2 A;  5J2D A;  5HHI A;  4FHY A;  5TZV A;  5HRD A;  4UB4 A;  3L9D A;  8ICQ A;  2PFO A;  4KLO A;  1Q79 A;  4I2A A;  4M9N A;  7ICV A;  3RJK A;  2Q66 A;  3V7J A;  5IIL A;  1NO5 A;  2DR8 A;  3K75 D;  1ZQE A;  2P66 A;  4NKT A;  4Z6D A;  1ZQH A;  3NYB A;  3RJH A;  2ZH1 A;  4QZE A;  9ICM A;  8ICJ A;  9ICQ A;  4KLU A;  1ZQZ A;  4F5N A;  3B0Y A;  4WBZ A;  3UXN A;  5DB8 A;  4UB3 A;  4O5E A;  4NLN A;  9ICV A;  3RJF A;  5J2A A;  8ICF A;  1TFW A;  4GXI A;  4WC0 A;  3RJE A;  9ICL A;  1ZQN A;  9ICG A;  8ICM A;  4M9H A;  3PMN A;  4X0B A;  1XSL A;  3AU2 A;  5J2E A;  2ZH9 A;  3ISB A;  3UQ2 A;  2ZH5 A;  4QZ9 A;  4KLF A;  1ZQY A;  4XQ7 A;  1ZQB A;  2BCS A;  4R66 A;  3WFO A;  4UB2 A;  4QZI A;  4XUS A;  1R8B A;  1ZQO A;  4UBC A;  9ICT A;  1MQ3 A;  4KLQ A;  2NRK A;  2BPG A;  4EBJ A;  1WOT A;  3MBY A;  5IIJ A;  4I2E A;  4AT9 A;  5J0Q A;  5J29 A;  9ICP A;  4WC5 A;  1MIY A;  1ZQD A;  4RT3 A;  8ICI A;  5DBB A;  1ZQU A;  2ZH8 A;  4WC7 A;  4X4U A;  4KLT A;  3ISC A;  9ICO A;  1ZQJ A;  4P4M A;  2DVI A;  9ICB A;  4IQW A;  3B0X A;  7ICQ A;  4UD4 A;  2ISO A;  4RWN A;  3JPS A;  4I2C A;  8ICG A;  4TUR A;  4UAY A;  5DB6 A;  5J0X A;  2BCR A;  1ZQM A;  9ICU A;  4R63 A;  3MDC A;  4QZC A;  4F5R A;  4PGQ A;  1BPY A;  4KLH A;  4RQ1 A;  4GXJ A;  4X4P A;  2FMS A;  2ZHA A;  5J2G A;  4FH3 A;  2BPC A;  7ICL A;  1ZJM A;  4I2I A;  4M2Y A;  4E80 A;  5IIO A;  5IIN A;  5HRB A;  4WC3 A;  4M9G A;  4P4P A;  3UQ0 A;  4AT7 B;  4RPX A;  5BPC A;  2DR5 A;  2BCV A;  8ICU A;  5CP2 A;  3AQL A;  2DR7 A;  3HIY A;  4NLZ A;  8ICZ A;  4KLL A;  8ICL A;  1ZQV A;  4FHP A;  4YN4 A;  3HX0 A;  1BPE A;  4K4G A;  8ICC A;  9ICC A;  3OGU A;  3H39 A;  3C2K A;  4QZG A;  3HW8 A;  3C5G A;  5D49 A;  4M9L A;  4IQV A;  4WC4 A;  2W9M A;  5DBC A;  8ICO A;  5DDM A;  1TVA A;  9ICJ A;  4RQ3 A;  1ZQC A;  9ICK A;  4S3N A;  2BE3 A;  5HHH A;  9ICI A;  1KDH A;  4RQ8 A;  3TFS A;  8ICP A;  1ZQA A;  1BPX A;  8ICS A;  1MQ2 A;  4KLD A;  4PGX A;  5J0R A;  1UEV A;  9ICX A;  1FA0 A;  4WC2 A;  3WFP A;  4RQ6 A;  4KLG A;  3RJG A;  3RH5 A;  2O1P A;  4YCX A;  4EBK A;  3AUO A;  7ICO A;  7ICG A;  4XRH A;  8ICB A;  9ICE A;  4DOC A;  5CJ7 A;  2PFP A;  2M2W A;  5DB7 A;  4PHA A;  7ICK A;  9ICR A;  3OUY A;  4I2J A;  4EP7 A;  3HWT A;  4YMM A;  4NKU A;  5CA7 A;  4I27 A;  4I29 A;  4M0A A;  4FHW A;  7ICR A;  4PHE A;  5J2F A;  5HRH A;  4KLJ A;  4XA5 A;  2BPF A;  3AQN A;  4QZH A;  1MIV A;  4I28 A;  1TFY A;  8ICE A;  4ATB A;  2FMP A;  4R65 A;  3H38 A;  2ZH3 A;  5CR0 A;  4Z6E A;  1RPL A;  4TUP A;  3AQK A;  3TFR A;  4F5O A;  4E7X A;  7ICE A;  4PHD A;  1HUZ A;  2O5A A;  9ICF A;  7ICM A;  5J2J A;  5J0U A;  5J0P A;  4RQ5 A;  4FHV A;  1KNY A;  4RQ0 A;  8ICV A;  3OVA A;  3HJ1 A;  2PFN A;  5J0Y A;  4LZG A;  4NY8 A;  1JN3 A;  2DRA A;  4R64 A;  4UD5 A;  1RZT A;  9ICH A;  5CB1 A;  4X4T A;  2ID1 A;  4RWQ A;  3JPQ A;  3C2M A;  4DO9 A;  4YMO A;  4WC6 A;  1ZQI A;  4PH5 A;  4RPY A;  4O5K A;  4I2B A;  4RPZ A;  1NOM A;  5J0O A;  2M2U A;  3V72 A;  7ICT A;  3MDA A;  5HRK A;  4K4H A;  3OVS A;  1ZQS A;  2ZHB A;  2BCU A;  4IQT A;  4Z6C A;  4RWO A;  4YD2 A;  4DOA A;  3JPO A;  2IHM A;  3OVB A;  4TUQ A;  4ATB B;  3UXP A;  1VJ7 A;  3UPQ A;  4QZA A;  3RJI A;  3JPN A;  2RFF A;  3ISD A;  5HRG A;  5D46 A;  4MF8 A;  1UET A;  1ZQG A;  4I2F A;  5EOZ A;  1UEU A;  1JQR A;  4WCW A;  5CHG A;  4UB1 A;  4WC1 A;  3PML A;  8ICX A;  3JYY A;  4I2G A;  7ICI A;  4X4N A;  4X4R A;  4UB5 A;  9ICS A;  4I2D A;  4PGY A;  5DKW A;  5BOM A;  4UBB A;  7ICJ A;  5DED A;  4UAZ A;  2I9G A;  5J2B A;  4AT9 B;  7ICS A;  1ZQW A;  2PBE A;  5J0W A;  3WFQ E;  8ICA A;  4LZD A;  7ICH A;  4FH5 A;  3RH4 A;  4YD1 A;  1ZQF A;  4O5C A;  4AT7 A;  1MIW A;  2ZH7 A;  1PX5 A;  4M5D A;  5J2C A;  1OU5 A;  1ZQK A;  4E8F A;  4F5Q A;  3PNC A;  5J2I A;  2ZH2 A;  3OV7 A;  3JPP A;  4Z6F A;  4JWM A;  4X4S A;  3C2L A;  1ZQP A;  3AQM A;  5J0T A;  1ZQR A;  9ICA A;  4X4V A;  2PXI A;  4QZF A;  5D4B A;  1R8A A;  4DOB A;  4QZ8 A;  4UAW A;  5IIM A;  4AT8 B;  3LQC B;  3WFR E;  4RWP A;  2PFQ A;  4QZB A;  3AU6 A; 
#chains in the Genus database with same CATH topology
 5JQG A;  1URF A;  2OYQ A;  3OEH G;  1G6U A;  3FFQ A;  2IJJ A;  1SF9 A;  3BAB A;  1IBM B;  1GAX A;  4MFC A;  3WFS C;  5DEC A;  4OGQ B;  3RVY A;  2F4V O;  1GTO A;  1HNW B;  5LGN A;  3V7L A;  2UUC B;  4CH4 A;  2F1M A;  1VFG A;  1YIJ V;  1KEJ A;  1YLQ A;  1EFR G;  2OCH A;  5DB9 A;  3DC5 A;  1H2S B;  1LNQ A;  5HC9 A;  4K0K B;  2M7W A;  3E8B A;  2ZT9 B;  1X4T A;  4K35 A;  4BR6 A;  2XAG A;  1PD3 A;  3OUF A;  2BOB C;  5J0S A;  2R72 A;  4B3R O;  1FPO A;  1VQ5 V;  3BFR A;  2ZE7 A;  1OCC B;  4IG8 A;  3JYC A;  5EK0 A;  1P7G A;  4M9J A;  2YUA A;  4OX9 B;  4I9W A;  2JJ2 G;  3JD1 A;  1JOY A;  1OV9 A;  3KCX A;  4KHP B;  3N2K A;  4LT6 A;  3HKE B;  3GWO A;  1Y74 B;  4F5P A;  1N34 B;  2B1I A;  1KYO F;  3FB5 C;  3HJ4 A;  4EED A;  3GB7 C;  3AG1 C;  1VQP V;  4I2H A;  1K9M W;  5HRE A;  4KLI A;  5JH7 A;  4ZOL A;  3CK6 A;  2HG5 C;  1M5I A;  1FS0 G;  4K98 A;  2YIB D;  1XSN A;  3WB1 A;  2H3O A;  1FXK A;  4RAI A;  5J2H A;  4LVS A;  2CUG A;  2RDC A;  1L0N H;  3T4D A;  1WA8 A;  1P49 A;  4TUS A;  1MNG A;  3ERC C;  1WB7 A;  2R9A A;  1JJ2 U;  4OAF A;  3FYE B;  4YY3 B;  2HJF C;  2DYS B;  3CCQ V;  3N2G A;  2QEX V;  3H37 A;  5DDY A;  2GTA A;  2HKO A;  5J2K A;  8ICT A;  3ASO C;  4XDL A;  5J2D A;  3CC7 V;  1S72 V;  5TZV A;  4YJ2 B;  1NJI W;  3ZHS A;  4UB4 A;  4U7O A;  1Y66 A;  1WN7 A;  1FAF A;  3MDS A;  3OMI B;  3PJS K;  4UB6 Z;  5EIB D;  1P4R A;  3U0Z A;  4O4J A;  3FB7 C;  2DR8 A;  2P66 A;  2CK3 G;  4UFZ A;  2AXT Z;  1WPX A;  3Q4H B;  1SZX A;  2WWW A;  1KKC A;  1QLE C;  2ADP A;  4NKG B;  1OCZ C;  5LMU B;  4KLU A;  3T1C A;  4DV7 B;  4DW1 A;  4HNA A;  3UXN A;  2R9I A;  4PDL A;  3K04 A;  4FK5 C;  1YJW V;  2PYJ A;  4B08 A;  4I50 A;  1WPB A;  2N04 A;  4ZOL B;  2JS5 A;  3DSQ A;  4JI7 O;  5B3S C;  4B3R B;  3RJE A;  3JCF A;  2P06 A;  3E83 A;  1IDS A;  8ICM A;  2KKW A;  2B56 A;  1WA8 B;  4ZIB A;  1XSL A;  2PZS A;  2XTA A;  3AU2 A;  4N21 A;  5J2E A;  3ISB A;  2ZE5 A;  1AI5 A;  3G80 A;  4QZ9 A;  4JYA B;  4KLF A;  1COW G;  4O4L A;  1ZQY A;  2XAJ A;  5LA6 B;  1E1Q G;  1RPO A;  4TV8 B;  3WFO A;  2N05 A;  5IJ9 A;  4UB2 A;  3ETE A;  4QZI A;  2HVJ C;  4PA7 A;  2F4V B;  1K97 A;  4UBC A;  2Q7E A;  9ICT A;  2EIN C;  1MQ3 A;  5JH7 B;  2BPG A;  4I2E A;  1JFF A;  1MA1 A;  4LF6 O;  4AT9 A;  4YIO A;  1MIY A;  4I0X A;  1ZQU A;  2ZH8 A;  4X4U A;  1PPJ H;  5CB4 B;  2DVI A;  3K3W A;  5L3C A;  1W0J G;  4NXU A;  3CE2 A;  3UO3 A;  4WH5 A;  2ISO A;  3BY6 A;  3UO2 A;  3RWR D;  4I2C A;  8ICG A;  4TUR A;  1T5E A;  5J0X A;  2Y0I A;  3SJQ C;  4IHJ A;  2DOS A;  4QZC A;  1G1X B;  2GHY A;  4RQ1 A;  2WSS G;  4NXX A;  4X4P A;  3OMN B;  5J2G A;  3OW2 U;  4PEL A;  2DN9 A;  3JCU Z;  3DC6 A;  7ICL A;  4X66 O;  4MT8 A;  4TUY B;  1K33 A;  5IIO A;  3ZMV A;  2A7W A;  4H44 B;  4DR4 O;  5BMV B;  5CA0 A;  2YI8 A;  1IUR A;  2AW9 A;  4NVP A;  1R3L C;  4RPX A;  3CRA A;  4F6E A;  1Y4M A;  1AI7 A;  2RNB A;  2DR5 A;  2IJH A;  4TV9 A;  2HEP A;  3RN4 A;  1YCI A;  3ER9 B;  3F5T A;  2GBO A;  1VMG A;  3SR2 C;  2DR7 A;  1J5E O;  3HIY A;  1TGO A;  1BT8 A;  2E76 B;  8ICL A;  4I50 B;  1ZQV A;  3T4Z A;  2B5U A;  3L72 H;  3B4S A;  1WB8 A;  1BPE A;  4GLX A;  3SYO A;  3OGU A;  3ML0 A;  3C2K A;  3CRC A;  2ZCE A;  2IU3 A;  3FAV B;  3P30 A;  3ZHR A;  5C8Y A;  4M9L A;  1WLE A;  4IQV A;  2WLI A;  4FLZ A;  4OPH A;  2W9M A;  4PDR A;  1TVA A;  3B40 A;  4HX0 A;  2E5L B;  2PUS A;  2BE3 A;  4Z1M G;  2EJR A;  3CJH B;  2CH7 B;  4J41 A;  3LUT B;  3STZ C;  2UXN A;  3CWB H;  4JGS A;  4KHP O;  4DV0 B;  3ASO B;  1ZQA A;  1Z2G A;  3ZX6 A;  4TT3 G;  5CA1 A;  4KLD A;  4PGX A;  4GYC B;  3CP1 A;  1HP8 A;  4QGP A;  4WFE A;  3UT5 B;  2DJV A;  2N74 A;  1RM1 B;  4JYA O;  4OAG A;  2O57 A;  1M90 W;  4TUY A;  4KLG A;  1GN2 A;  3RJG A;  1CP9 A;  3H1L H;  4YCX A;  3AUO A;  2GUZ A;  7ICG A;  2B51 A;  4KL1 A;  9ICE A;  5DB7 A;  1JPX A;  4TV9 B;  1SET A;  1FFX B;  4DXW A;  3OUY A;  1SQX H;  3ZIA G;  3BVO A;  4RUF A;  5CA7 A;  7ICR A;  1YHQ V;  3QNE A;  2IJI A;  2VWJ A;  4DV2 B;  1PM9 A;  3AQN A;  5CA3 A;  1MIV A;  2EX3 A;  1TFY A;  2IU0 A;  4LF5 O;  3MCR A;  2FMP A;  3I56 V;  1X59 A;  1NH2 D;  1RPL A;  3J7A U;  2Y48 A;  1Q5O A;  2ADQ B;  1YIT V;  4F5O A;  1VQM V;  4E7X A;  3LSQ A;  2UXB B;  1D5N A;  1KP3 A;  1HUZ A;  1KUQ A;  2O5A A;  2Q67 A;  3CJH A;  2DQ3 A;  1R6K A;  4J9Z B;  5J0U A;  1EN5 A;  3SYA A;  2IW5 A;  1MSD A;  5LYJ B;  3JAT A;  5GW7 A;  1H2K A;  3OVA A;  1TAE A;  3HJ1 A;  1F4M A;  4NXN B;  5J0Y A;  4LZG A;  3W7W A;  1L0L H;  4QIW F;  2DRA A;  4NTX A;  3ZMS A;  1NS1 A;  2OWO A;  4R64 A;  4KFM A;  4UD5 A;  4LH7 A;  9ICH A;  3O9O A;  3IJ4 A;  3BA8 A;  4OAI Z;  2EWR A;  2GAF D;  3K5M A;  2ID1 A;  4EGW A;  1R73 A;  1Q8I A;  3JPQ A;  3E22 A;  3LDE A;  3MD0 A;  4LCU C;  5EBW C;  4FLT A;  1ZWI C;  1Q6I A;  2RJZ A;  1Z5V A;  4EEQ A;  2OTL V;  1NOM A;  4R50 A;  1IBK B;  1JMK C;  2XAH A;  1H2M A;  3OTO O;  4DV6 B;  5EIB C;  4L8J A;  1QR9 A;  4K4H A;  4GKK B;  3OVS A;  1ZQS A;  3HB3 B;  1US6 A;  4IQT A;  4RWU A;  4Z6C A;  2IHM A;  3KG2 A;  3T1Y B;  3UXP A;  1A32 A;  4QZA A;  1PNM A;  3RJI A;  5LOV A;  4MTX A;  1I94 B;  2WLL B;  2YIB A;  4NXW A;  3JAK A;  3ISD A;  3D36 A;  3M7M X;  3HKD A;  4LC1 A;  3O65 A;  4FLY A;  2Q7H A;  2ODM A;  5LMN B;  3AK2 A;  1Q81 W;  3SPJ A;  5KHK A;  1UET A;  3ABM C;  5EOZ A;  1K5S A;  1V54 C;  1JQR A;  4LFA O;  4GT1 A;  1IBL O;  4WC1 A;  3W7U A;  3SJB C;  3B09 A;  1NTM H;  3C3S A;  4H33 A;  3ZRW B;  3WU2 Z;  3D3I A;  5KMG A;  3SPG A;  3RYC B;  4TWK A;  1OCZ B;  2YXY A;  4MVR A;  3MAQ A;  1VQL V;  4B3T O;  5DED A;  3H9V A;  1XBL A;  2KSD A;  4X66 B;  3K58 A;  3UM7 A;  4LF5 B;  5J0W A;  4LZD A;  2F93 B;  2HJD A;  1I5X A;  3CCL V;  4XDK A;  3RH4 A;  4BIO A;  1VF6 C;  4LR3 A;  4XBF A;  3CRM A;  1NTK H;  1GRJ A;  5J2C A;  1XRE A;  4F5Q A;  2ZH2 A;  3OV7 A;  1AR5 A;  3JPP A;  3N2K B;  4X4S A;  2WLJ A;  2FB5 A;  2D2C B;  4CS4 A;  4PJ0 Z;  4QZ8 A;  4JZ2 A;  3VQW A;  3JAM N;  1G8M A;  1R1B A;  1SKV A;  3G6B A;  3C3T A;  4X65 O;  3JD4 A;  1Q3E A;  4Z1V A;  7ICU A;  1SQF A;  4FHX A;  3ZMU A;  4KLS A;  4JWN A;  2ZH6 A;  1KP2 A;  3OD4 A;  4QZD A;  3W7S A;  1VQ6 V;  2WAM A;  3JD3 A;  4J80 A;  3BHP A;  3ZS8 C;  2GSM B;  2W0F C;  3JPR A;  1QBZ A;  4O9M A;  1S5J A;  5HRF A;  1AJP A;  4RQ7 A;  1HNZ B;  5L3G A;  1AB3 A;  1TV9 A;  4MFA A;  4FZ1 A;  3WFV A;  1YTF D;  3SJC C;  4ASU G;  1AR4 A;  2BCC H;  1VQ7 V;  1GO3 F;  1XQ8 A;  1MG1 A;  4P2H A;  3ZHV A;  1SES A;  3AG2 C;  4FIP C;  2V1D A;  1D5A A;  3S3W A;  5LOV B;  2ETN A;  5H2F Z;  2EJ7 A;  3JZ0 A;  4N7R A;  1F5A A;  1IXM A;  2LP7 A;  4O2A B;  1R8C A;  1QQC A;  1SA0 A;  1OHH G;  4MFF A;  5III A;  1HUO A;  1DLB A;  1K92 A;  3BEH A;  1FFX A;  3RVZ A;  3OUY B;  2M6Y A;  4KLE A;  4LBE C;  4WFB V;  1Y76 B;  2PI5 A;  4DV0 O;  2L35 A;  1GM9 A;  1BHA A;  2HHH O;  3K5L A;  8ICK A;  5J2T A;  1M57 B;  4UUJ C;  1N8R W;  4LFB O;  1XNQ B;  4KLM A;  1U97 A;  2GWS A;  4O4H A;  1ZJN A;  2L6L A;  4J11 A;  4I4T B;  2VQE O;  3ZBH A;  3IC7 A;  2WLK A;  4NLK A;  1Q78 A;  8ICY A;  1GPJ A;  3K08 A;  2FYU H;  5GTI Z;  1JAJ A;  1ZQX A;  1M9N A;  4JTD B;  5B5E Z;  3A0B Z;  4RQ4 A;  4LF9 O;  2Y0P A;  1ZQT A;  3AK1 A;  3RYH B;  5K1P A;  4K99 A;  3JAT B;  5HR9 A;  2BSK B;  5JVD B;  4XQ8 A;  2XAQ A;  1ZL8 A;  4P9O A;  3HKB A;  3ZJZ A;  5GTH Z;  4RT2 A;  1JFF B;  3NXS A;  2UUA O;  3R65 A;  2PI4 A;  5TIS Z;  1N32 O;  4KB6 A;  2DW4 A;  3TJT A;  2ITD C;  1D2D A;  4I55 A;  3H1H H;  4DUZ B;  1Q79 A;  4P2Z A;  7ICV A;  3K5N A;  3RJK A;  5IIL A;  1XMQ O;  1NO5 A;  3ZRS A;  4NKT A;  1KB9 F;  3CYO A;  9ICQ A;  1NR1 A;  2Q6A A;  2KG7 B;  3L74 H;  3B0Y A;  5DB8 A;  2EIM B;  4O5E A;  4K8V A;  1DF4 A;  4FM1 A;  5IYZ A;  1FJG B;  1W0K G;  3RJF A;  2CDY A;  4I4T A;  4JI7 B;  1TFW A;  1Q43 A;  3U10 A;  2UXC B;  3K06 A;  2XOK G;  1GMG A;  3AG3 C;  4HYO A;  1NT2 B;  5LGU A;  4X0B A;  5CBG A;  4K0K O;  4DR5 O;  3VOU A;  2ZIM A;  2Q68 A;  2JVD A;  3UQ2 A;  3E89 A;  2UXD O;  1E79 G;  1GK9 A;  3VQY A;  4XQ7 A;  4X1I A;  4FLV A;  4H37 A;  4WCE V;  2A3Q A;  1XMQ B;  2BTQ B;  5ITZ B;  3HKB B;  4N23 A;  2YXH A;  1NVP D;  1PP9 H;  4I7Z B;  3MBY A;  2QWN B;  4PDM A;  2Q73 A;  5J29 A;  2IH3 C;  2PGG A;  4RT3 A;  2MW2 B;  2A06 H;  1XMO O;  9ICO A;  4P4M A;  4IQW A;  2OIE A;  3B0X A;  2CH7 A;  2UXC O;  3JPS A;  2YI9 A;  3SGI A;  2P5O A;  5EBM C;  3OFN G;  4YJ3 A;  1JX9 A;  1ZQM A;  5KHG A;  4O2B B;  3LDD A;  4WFG A;  3MDC A;  1I08 A;  4PGQ A;  3VQX A;  2A0L A;  3CXC U;  1SRY A;  4WBN A;  2ZHA A;  4FH3 A;  3JD2 A;  4M2Y A;  5FPO A;  4EB6 A;  4O4I A;  4GKJ B;  3JCZ A;  5B66 Z;  4AT7 B;  1DTO A;  2P6J A;  4U7N A;  2YXL A;  1Y6X A;  1XNR O;  2X6B A;  4B3M B;  4NB5 A;  5LGT A;  1V9P A;  3HKC A;  4DV5 O;  2X7R B;  3G67 A;  3OT7 A;  4OX9 O;  2A9H A;  3UKM A;  1BSM A;  3ABM B;  4KP4 A;  1IVS A;  2IBZ H;  4DV3 B;  4B7K A;  1L1F A;  5ITZ A;  4NLZ A;  1KMI Z;  4KLL A;  8ICZ A;  3F5W C;  5LP6 C;  2EIJ C;  2WA3 A;  3B77 A;  8ICC A;  4EFE A;  1IX9 A;  9ICC A;  1N4C A;  2VRZ A;  4DR2 O;  3I55 V;  4LNU A;  4PI2 A;  3D8C A;  3HW8 A;  4YHH O;  5JJN B;  3OUS A;  5JWP A;  5DBC A;  8ICO A;  2X6C A;  2Z5U A;  1F51 A;  1CXZ B;  2CAZ C;  4ZI7 B;  4RQ3 A;  9ICK A;  5IDJ A;  1KDH A;  4WQK A;  5HFM A;  4RQ8 A;  4JZG A;  1NVP B;  4NXT A;  3TFS A;  3QO7 A;  8ICP A;  4X9Q A;  3H1I H;  3F7Y C;  4X89 A;  1SQP H;  1IBM O;  4I5S A;  5DN6 G;  4WC2 A;  2OT5 A;  3ZCC A;  2B9Z A;  4RQ6 A;  4X1K B;  4U3J A;  5KHH A;  2QDO A;  4PA6 A;  1QVG U;  1Y67 A;  3VQV A;  4DOC A;  4TQF A;  3E8F A;  4PHA A;  5HFL A;  4UCS A;  4U3F H;  1CPY A;  2DMX A;  4YJ3 B;  4EP7 A;  5KAI Z;  2ZDI C;  3HWT A;  4NKU A;  3CC4 V;  4I29 A;  1NU1 H;  4E2L A;  5HRH A;  5J2F A;  5CFS A;  3W7X A;  3JAS B;  2BPF A;  4QZH A;  3AG7 A;  1HNW O;  4I28 A;  4JYY A;  4Z2W A;  4DV1 B;  2QM8 A;  4R65 A;  4K8X A;  3AQK A;  2P67 A;  3JSN A;  4TV8 A;  4NXV A;  7ICE A;  4PHD A;  1R6N A;  4DR3 O;  4UCO A;  2ZM6 O;  3FYI B;  5J2J A;  1Q6U A;  2C2A A;  2EIL B;  1N36 B;  4K96 A;  3ZRV A;  4FHV A;  4J9Y B;  4RQ0 A;  4X65 B;  3FD9 A;  4E4E A;  1GN3 A;  4I0X B;  5KHJ A;  3T2M A;  4F6R A;  2Q4P A;  4UVC A;  3RYI A;  2ZIN A;  4EEB A;  5CB1 A;  2Q0A A;  4BW5 A;  2ATK C;  4JPR A;  4RWQ A;  3C2M A;  2JIZ G;  4YMO A;  4WC6 A;  1YTF B;  4D7T A;  4JI0 O;  2MK3 A;  1I5Y A;  4O5K A;  1VIB A;  3OMA B;  2VWK A;  2HR3 A;  3N27 A;  4QPJ A;  5J0O A;  3LDC A;  1UJW B;  1GM8 A;  3MDA A;  4X64 B;  3SPI A;  2Q7G A;  4DW0 A;  2EIN B;  1XI1 A;  4JI1 B;  1F7Y A;  4DV4 O;  5H6R A;  1F4N A;  2P7T C;  1QLN A;  4MVM A;  4RWO A;  4YD2 A;  4LFC B;  4JF3 A;  3EVK A;  2CTQ A;  4LF4 O;  3LNM B;  2GV9 A;  1EZV H;  1KBH A;  1VJ7 A;  2H94 A;  5CFU A;  1HNX B;  3A2F A;  4DR6 B;  2DWD C;  4UV9 A;  1BQ0 A;  5HRG A;  2YEV B;  4HAM A;  3T1H B;  4CC5 A;  2YC0 A;  5KA6 A;  4FVM A;  4JI8 B;  2IHO A;  2VQF B;  2QM4 A;  1BL8 A;  2QWR B;  4G28 B;  4UB1 A;  4NTY A;  4IGG A;  3E2E A;  3PML A;  3ABL C;  3T1Y O;  3JYY A;  4I2G A;  3ZED A;  2HP8 A;  3CCJ V;  3FAV A;  3LSS A;  4UB5 A;  9ICS A;  1NI8 A;  4FFB B;  3ETD A;  5D62 A;  1H8H G;  4PGY A;  5BY1 A;  5DKW A;  5BOM A;  5B3Q A;  5LHH A;  4WBN B;  7ICJ A;  3K59 A;  1M93 A;  3E8H A;  3A0H Z;  3Q4H A;  8ICA A;  4FH5 A;  4HZ3 A;  4YD1 A;  3KCY A;  3APO A;  5CBF A;  5KHI A;  4HNA B;  1BQZ A;  4AT7 A;  2ZH7 A;  1EN4 A;  3FB8 C;  1PX5 A;  2ZD9 A;  5K1X A;  4ICG A;  4LWS A;  4E8F A;  2LW1 A;  1K5Q A;  5J2I A;  4LEZ A;  3C2L A;  1VEW A;  1Q82 W;  1BGY H;  1ZLZ A;  1ZQR A;  9ICA A;  2PXI A;  2V7Q G;  1HDJ A;  3ZMZ A;  2YID A;  1ZTE A;  3CCV V;  4FM0 A;  3JAR A;  1S3J A;  3EXA A;  3FX7 A;  2CGN A;  3X2Q B;  5E1A C;  5B1A C;  2PFQ A;  2ILM A;  1GKF A;  5B1A B;  4JV5 O;  4M04 A;  4P4O A;  4H13 B;  4O68 A;  4J7J A;  4X5V A;  3RJJ A;  2HN1 A;  3MGI A;  4RQE A;  5GON A;  2M2T A;  4NM2 A;  4ZI7 A;  1V55 C;  1M4U A;  2D3O W;  4CC6 A;  1V55 B;  3C18 A;  5BOL A;  3TGU H;  4X1Y A;  1PL0 A;  3CME V;  3UPS A;  4M47 A;  1XL4 A;  4O6A A;  2FL4 A;  2E5L O;  2BOC C;  5IT9 N;  4GXK A;  3A0R A;  1AP6 A;  1RM1 C;  4A5U B;  2BBH A;  2NLJ C;  3CCR V;  4O69 A;  1AJN A;  2M2V A;  1R89 A;  1KU9 A;  5IYB O;  3QO8 A;  2LQT A;  3K0D A;  5FNV B;  1GM7 A;  2BBJ A;  9ICW A;  4JTC B;  1BPZ A;  3BRC A;  2EIL C;  3T1H O;  4YHH B;  2ISP A;  4PHP A;  5CWR A;  5LHI A;  2WPD G;  4LH6 A;  5CN0 A;  2UU9 O;  4LWS B;  7ICN A;  3NWI A;  3H3A A;  2BCQ A;  3DXR B;  1WAZ A;  5D61 A;  3TCU A;  2QWP B;  3RGB A;  5IWA B;  7ICP A;  4JAA A;  1N33 O;  4UVB A;  2ZH4 A;  4LFC O;  1H2N A;  5IIK A;  3JAR B;  5IYZ B;  4JI1 O;  2UUB O;  1AI4 A;  3JAS A;  1HR0 O;  1BPD A;  4DR5 B;  2JS3 A;  5HRL A;  2Y4U A;  1R3K C;  4DUY B;  4X0A A;  4BIZ A;  3LK9 A;  1ZQQ A;  4LF7 B;  3K57 A;  3F7V C;  3APQ A;  4K97 A;  4UCT A;  2Q5Z A;  5B1O A;  4IYI A;  2DR9 A;  4JI0 B;  4LEY A;  1RPR A;  3UXO A;  4K3A A;  8ICN A;  1THZ A;  1FJG O;  3ZRX A;  2ARH A;  1E1R G;  4RO2 A;  2LJ2 A;  2VS0 A;  4B7E A;  4YJ2 A;  2VAN A;  3E35 A;  3TET A;  2HFE C;  8ICR A;  4MW3 A;  1K73 W;  5CA0 B;  2YS8 A;  2BTQ A;  3K9S A;  4O4J B;  1JCH A;  1S5L Z;  2LFR A;  4DK0 A;  1NKD A;  1B04 A;  3RYI B;  3RBZ A;  4IT5 A;  3P3P A;  2X6A A;  5HRD A;  1M56 C;  3L9D A;  4DV5 B;  4KLO A;  4FM2 A;  2ZM6 B;  3K79 A;  4M9N A;  2NNU A;  3N2G B;  2Q66 A;  1BZK A;  1Q86 W;  1ZQE A;  3SYP A;  3NYB A;  4PA3 A;  2CGO A;  2HLD G;  2ZH1 A;  4QZE A;  1I7F A;  1JVM A;  3BPZ A;  3FB6 C;  1TUE B;  4X1Y B;  4X62 O;  4ZBM A;  2WLN A;  4UB8 Z;  1O9H A;  3KZI Z;  1ZQZ A;  5JQG B;  1BS3 A;  4UB3 A;  2Q8V A;  1J95 A;  1RP3 B;  3CHX A;  5EC2 C;  5FNV A;  5J2A A;  1KC8 W;  4FPP A;  4O4L B;  2OCC B;  3CB2 A;  4GXI A;  5EBL C;  4I0U A;  4WC0 A;  5CA1 B;  4MVQ A;  9ICL A;  1EM1 A;  9ICG A;  5IJ9 B;  2PTM A;  3QF7 A;  2QKS A;  2ZR2 A;  2YEV A;  3PMN A;  3OAA G;  3AG3 B;  4IYH A;  2P22 C;  1P7B A;  3JAL B;  2YIC A;  4GZR B;  1XDC A;  4R7C A;  3EFF K;  4PA4 A;  5DM6 V;  3ABT A;  1EN6 A;  2Z0A A;  2YIA A;  2NN4 A;  2LGW A;  4MW8 A;  3SDL A;  2BCS A;  3H1K H;  1B06 A;  5KUK A;  3AG4 C;  4X20 B;  4L87 A;  5IE9 A;  3AG4 B;  4JI2 B;  1WOT A;  1XL6 A;  5IIJ A;  5J0Q A;  5A2Q N;  2QWO B;  2DWE C;  2AZ0 A;  1ORQ C;  4NTW A;  2JJ1 G;  4B3S B;  4WC5 A;  4HBN A;  4MS2 A;  2PF4 E;  4ZKI A;  8ICI A;  3L71 H;  3ZMT A;  1SC5 B;  4WC7 A;  4KLT A;  3ISC A;  2YDE A;  2EIK B;  1PNK A;  3VBB A;  7ICQ A;  4CZZ A;  1MAB G;  1PV0 A;  4RWN A;  2P4V A;  4J7Z A;  5CBH A;  3JSL A;  2XHB A;  2DYR B;  5CFT A;  2E3C A;  1YDX A;  3CPW U;  4R63 A;  1K34 A;  2R70 A;  3ETQ A;  4ABM A;  1TUB A;  4F5R A;  1BPY A;  2ZDI A;  4KLH A;  4QPK A;  1B3Q A;  4DV7 O;  3K7D A;  4TSF G;  3ASN B;  3HKE A;  3BCC H;  1XOU A;  1Y74 A;  4I2I A;  5FPR A;  3GVM A;  4E80 A;  4RUE A;  3JD0 A;  4P4P A;  3UQ0 A;  2Y69 B;  1SQG A;  1BE3 H;  5L3B A;  5BPC A;  5J2U B;  4GX0 A;  3QO5 A;  1LUW A;  2AHY A;  8ICU A;  2R9R B;  3SPH A;  2ZNI A;  2UUB B;  1UFI A;  1YVW A;  4JAS A;  3CS5 A;  1VQ4 V;  5BMV A;  4CS3 A;  3AQL A;  4LF8 O;  4KUM A;  3JAK B;  1VQ8 V;  2G38 A;  4FHP A;  3HX0 A;  1QR8 A;  2ZXW B;  1SER A;  2CTR A;  1VQ9 V;  5EZY B;  1VF5 B;  3H39 A;  3LSU A;  4LF9 B;  3C5G A;  1K3E A;  5D49 A;  4WC4 A;  3JAW B;  2ZKO A;  3TXS A;  4JI6 O;  4S3N A;  1LUV A;  1NZ6 A;  3E8G A;  3DXR A;  1OJH A;  3D36 C;  2WLL A;  2GUZ B;  2QSA A;  5C8Y B;  1N33 B;  4WQL A;  2GDS A;  3AG1 B;  8ICS A;  1FKA O;  3IGA C;  4ZHQ A;  5J0R A;  4DRX A;  1FA0 A;  1VF6 A;  2IUB A;  5FLX N;  3OGC C;  3WFP A;  2UXD B;  2X0L A;  3D3Q A;  4DYL A;  2O1P A;  7ICO A;  4MTO A;  5KMG B;  4WFF A;  8ICB A;  3M99 B;  1H2G A;  3NKU A;  4UXN A;  4NXM B;  2QKC A;  1NR7 A;  3DTU B;  1KKD A;  7ICK A;  3OTF A;  1OCC C;  2F95 B;  2Q9L A;  2RN9 A;  4YMM A;  4DV4 B;  4I27 A;  4GKK O;  2Z3Y A;  4M0A A;  1SS3 A;  3OWG A;  2PYL A;  4X8A A;  4TQD A;  2JGD A;  2LW7 A;  5LA6 A;  4DR1 B;  8ICE A;  1HNZ O;  2ZH3 A;  1H8E G;  5CR0 A;  4Z6E A;  2W6I G;  4TUP A;  4DR1 O;  1JQ0 A;  5C93 A;  5BR8 B;  2QTO A;  4W4K A;  4LF7 O;  3JAW A;  1DK1 A;  4FFK A;  3CCE V;  1FFT B;  1PNL A;  3K03 A;  4P9P A;  4JI5 B;  5D5Q A;  1L8D A;  1WP8 A;  1WNS A;  1BHB A;  8ICV A;  1NBM G;  2WA4 A;  2PFN A;  4NY8 A;  1RZT A;  2LFS A;  5IJ0 B;  4X4T A;  5CHE A;  2XT9 A;  1XIL A;  4IHJ B;  4I9Q A;  1I94 O;  2QR4 A;  3CXH F;  1ZQI A;  4PH5 A;  3ABK C;  3JAL A;  4LF4 B;  3ABK B;  1UPG A;  3V72 A;  2QKA A;  4R6Z A;  5LXT B;  4DUY O;  7ICT A;  3E22 B;  4O4H B;  5HRK A;  1FXK B;  4XJE A;  4QE7 A;  4ZHQ B;  2ZHB A;  3HKD B;  5EYP B;  1SQB H;  4X20 A;  4TUQ A;  4UCV A;  5IWA O;  5JJE B;  1Y76 A;  1AR1 B;  1R3J C;  4DR2 B;  1SQV H;  5LP6 A;  3QG5 A;  4DR6 O;  3UQ8 A;  3JPN A;  2RFF A;  1M56 B;  4JAV A;  5B3S B;  3FKS G;  3QTC A;  1OCR B;  1ZQG A;  3IFX A;  4LF8 B;  2JDI G;  3J80 N;  3H01 A;  4WCW A;  3OE7 G;  3RYF B;  3HPL C;  4IIJ B;  8ICX A;  3K0G A;  4X64 O;  4X4N A;  4NXN O;  3ABL B;  2DE0 X;  4X4R A;  1Q7Y W;  3A8T A;  1MZE A;  5B1N A;  1K8A W;  4MTG A;  1TUB B;  1DF5 A;  3G71 V;  5IJ0 A;  4Q20 A;  2JEX A;  3RYH A;  1XHX A;  4JI3 O;  1IZ3 A;  2IM9 A;  1Z5W A;  3M8A A;  1ZQW A;  3WFQ E;  2UXB O;  3BA9 A;  1ZL8 B;  1YF2 A;  4O5C A;  3WB0 A;  4MTF A;  1MIW A;  2IH1 C;  5J2U A;  1W59 A;  4M5D A;  1OU5 A;  5LXT A;  4CS2 A;  4Z6F A;  4JWM A;  2YSU B;  1FYJ A;  3L73 H;  4X4V A;  4BIU A;  1MOF A;  3OEE G;  4QZF A;  5D4B A;  1ZAU A;  2B1G A;  3NR7 A;  3STL C;  4NXM O;  1U96 A;  5IIM A;  2JK5 C;  4AT8 B;  4B3M O;  3LQC B;  3RW0 A;  1LR1 A;  3PHZ A;  4B3S O;  5EZY A;  3X2Q C;  3AU6 A;  5LHG A;  3IC9 A;  5CMU A;  2Q69 A;  3AK3 A;  4BAY A;  2OTJ V;  3WG7 B;  5KA5 A;  3TXQ A;  1V4A A;  2QE7 G;  1R3I C;  1YZB A;  8ICH A;  1K4C C;  3RYF A;  5KAF Z;  2DRB A;  2EIK C;  1YJN V;  2IJK A;  2K1E A;  2RCV A;  1H38 A;  4K9B A;  4JI6 B;  1XHZ A;  1JMS A;  2DYR C;  4DRX B;  4O67 A;  2ZIO A;  1YSC A;  4NM1 A;  4GCZ A;  4D7S A;  5LP6 B;  4WBY A;  3ZN1 A;  1BPB A;  1XMO B;  2FKX A;  4CH5 A;  9ICN A;  1ZQL A;  5JCO A;  3C90 A;  1K4D C;  8ICW A;  5J2T B;  3V7K A;  4X4O A;  1QU7 A;  1MZF A;  1ENV A;  3SYQ A;  2QA4 V;  3RH6 A;  2PY5 A;  2FMQ A;  2B4V A;  4K4I A;  1ROP A;  3CX5 F;  4K8Z A;  3C66 A;  4YMN A;  4MF2 A;  3B8M A;  3CC2 V;  2QGN A;  1Q6H A;  4X62 B;  1S0V A;  3C5F A;  4O2A A;  5IYD O;  4EB6 B;  5J9P C;  1XSP A;  2HHP A;  4PHZ A;  4D6T H;  5HRI A;  3MGH A;  4DV6 O;  2FML A;  3KKY A;  5DBA A;  5L3E A;  4DK1 A;  3RFR A;  1IBK O;  4BW9 A;  3B2E E;  3HKC B;  3L75 H;  4EV6 A;  3SJA C;  1K7D A;  5BR8 O;  4DR4 B;  2ZXW C;  1XUQ A;  1S77 D;  4RQ2 A;  3JPT A;  2BTO A;  3GDX A;  7ICF A;  1FXH A;  4IQU A;  4PPX A;  2JRI A;  4PDV A;  4EKW A;  4PA9 A;  3PN1 A;  4DV3 O;  4X4Q A;  2DYS C;  2NR5 A;  2AZ2 A;  4NXZ A;  2LGQ A;  2F23 A;  4FO6 A;  5F2V O;  4AT8 A;  1M1K W;  4AQY O;  5KUM A;  5HHI A;  4FHY A;  4KM5 A;  3ZN0 A;  4Q6G A;  8ICQ A;  2PFO A;  1N36 O;  4JI2 O;  2KG7 A;  3RYC A;  5KLV H;  4I2A A;  3AG2 B;  1YEW A;  2ZQM A;  1N32 B;  4JLZ A;  3V7J A;  3CCU V;  4FFB A;  2ZR3 A;  1W2B U;  3K75 D;  4Z6D A;  1ZUQ A;  3IAY A;  2JEU A;  5JTG A;  1ZQH A;  3RJH A;  9ICM A;  1N0N A;  8ICJ A;  4MVU A;  4DV1 O;  4WFH A;  2K9P A;  4I55 B;  2ZE6 A;  4F5N A;  4WBZ A;  4DV2 O;  1GN6 A;  4U3J B;  4NLN A;  5EYP A;  3ZHU A;  1KD1 W;  9ICV A;  2GA9 D;  1PKX A;  2GTS A;  1VQK V;  8ICF A;  3H1J H;  2FTK A;  3CRQ A;  1TA8 A;  2OCC C;  4PV1 B;  4UVA A;  4X1I B;  3EF2 A;  1ZQN A;  3ER8 C;  4M9H A;  3K9A A;  2ZH9 A;  4CH6 A;  1XNQ O;  1YI2 V;  5KX5 B;  2ZH5 A;  4G27 B;  2EIJ B;  4LF6 B;  4IIJ A;  4H0L B;  1SZT A;  4JTA B;  2HHH B;  1ZQB A;  3BAA A;  4PD4 F;  1EBO A;  4G2K A;  4RQF A;  2OIG A;  4R66 A;  4K9A A;  2AGA A;  2XUM A;  4AIL C;  5H5N A;  4GX1 A;  3CD6 V;  4XUS A;  5GON B;  1R8B A;  1ZQO A;  5D5P A;  2EZO A;  1ZX3 A;  4MKP A;  4KLQ A;  2NRK A;  3WB2 A;  4EBJ A;  5LYJ A;  2QJ1 A;  3WG7 C;  9ICP A;  1ZQD A;  2JGU A;  3CEI A;  5DBB A;  4O2B A;  4MVS A;  4AQY B;  1ZQJ A;  1MMM A;  5A9G A;  1NQT A;  9ICB A;  2UUA B;  4UD4 A;  2EBO A;  2F66 C;  4IL6 Z;  4LP8 A;  3HR0 A;  1QHT A;  2EZP A;  2WLH A;  3E86 A;  4UAY A;  5DB6 A;  5D63 A;  3THO A;  2BCR A;  4PI0 A;  2EUL A;  4YY3 O;  9ICU A;  2ZE8 A;  1SA0 B;  1GH6 A;  2UXX A;  2CTP A;  1YXB A;  4GXJ A;  2FMS A;  4FLW A;  1FXK C;  2UUC O;  3ZHT A;  2BPC A;  1HWY A;  5LMU O;  1EZJ A;  3UCS C;  4GX2 A;  4C7U A;  5BZB A;  4JLX A;  3R66 A;  4LEV A;  4LEW A;  1ZJM A;  1BCC H;  4YIP A;  4CBC A;  2QWQ B;  5IIN A;  5HRB A;  4NYK A;  1XNR B;  4WC3 A;  4M9G A;  4F6R B;  1RSO B;  2BSK A;  5JVD A;  4FO1 A;  2Y69 C;  4GKJ O;  3ETG A;  4QJF B;  2BCV A;  5KX5 A;  1O9G A;  4LFB B;  1TVK A;  1IBL B;  3G6E V;  5CP2 A;  3OR7 C;  2VQF O;  3ICX A;  5FL7 G;  3CCS V;  2WLM A;  5H6Q A;  2H8P C;  2JGD B;  4J42 A;  2W0X A;  4YN4 A;  4QNH B;  4K4G A;  1G4Y B;  1RFY A;  1HNX O;  4KXR A;  2XAF A;  4QZG A;  3L70 H;  3SYC A;  4EFB A;  3CCM V;  4J10 A;  3S3X A;  3ZRW A;  5AG2 A;  4DO2 A;  2E74 B;  5DDM A;  9ICJ A;  2LO1 A;  1ZQC A;  2Q0O C;  5HHH A;  9ICI A;  2RQ6 A;  3SPC A;  3P32 A;  4MVO A;  4FZ0 A;  1XEQ A;  1AJQ A;  4X1K A;  1M57 C;  3OTO B;  4WF9 V;  3OGI B;  4X88 A;  1BPX A;  1MSW D;  3K5O A;  1MQ2 A;  1B6Q A;  4JAU A;  1Q90 D;  1UEV A;  9ICX A;  1N34 O;  3OR6 C;  4LFA B;  3W7T A;  5LBQ A;  1OCO B;  5B1B B;  1OCO C;  2FCL A;  3RH5 A;  4EBK A;  2P4K A;  1YJ9 V;  3ABU A;  1I0H A;  1JJO A;  4DUZ O;  1FXV A;  4XRH A;  1VQO V;  5CJ7 A;  2PFP A;  2M2W A;  2XND G;  1IXB A;  3CRR A;  9ICR A;  2RMK B;  1P84 F;  4FJC C;  4I2J A;  3AEI A;  1VAR A;  2E75 B;  4GUN A;  4FHW A;  4FLX A;  4W4L A;  3RT3 C;  4PHE A;  4KLJ A;  2W6J G;  4XA5 A;  5E79 Z;  4WOY A;  4JI4 O;  3P3N A;  4ATB A;  4JI3 B;  5L3F A;  3H38 A;  4NR1 A;  1HW7 A;  1N0J A;  4BWA A;  1VF7 A;  1AIL A;  4JV5 B;  3TFR A;  2AHZ A;  1ZSP A;  1PL4 A;  1GN4 A;  2WLI B;  3B8N A;  9ICF A;  7ICM A;  4WFA V;  4QE9 A;  1HR0 B;  4MVZ A;  5J0P A;  4RQ5 A;  1TVK B;  1KNY A;  1SQQ H;  5IYC O;  3LNN A;  2EIM C;  1S76 D;  1WJZ A;  1CEZ A;  5JJJ B;  4R8C A;  1JN3 A;  4CH3 A;  1R6T A;  4P30 A;  3G4S V;  5B3P A;  4MSW C;  5LL6 Y;  3CMA V;  4AI8 A;  2UU9 B;  4J7K A;  4UCU A;  2KB1 A;  1ARO P;  3UT5 A;  4DO9 A;  3GWK C;  1NTZ H;  2ITC C;  4F4L A;  4RPY A;  3EHB B;  2F43 G;  4I2B A;  2HVK C;  4RPZ A;  2HN2 A;  2VQE B;  4DR7 B;  2M2U A;  3TK1 A;  1QCE A;  4UCR A;  4O4I B;  3QVN A;  3CSX A;  4FMT A;  4OPA A;  4AHC A;  2P90 A;  2BCU A;  4DOA A;  3JPO A;  1BMF G;  4TOI A;  3OVB A;  4JI8 O;  1JR9 A;  5EC1 C;  5LMN O;  3MHH C;  4ATB B;  4OXS A;  3UPQ A;  3MHS C;  2ZNJ A;  5BXZ A;  5D46 A;  1V54 B;  2CTW A;  1JA8 A;  2A79 B;  1J5E B;  4MF8 A;  3J81 N;  4I2F A;  3DGE A;  1OCR C;  4LNU B;  1UEU A;  5CHG A;  5H9C A;  4GX5 A;  1NH2 B;  1KQS U;  4JI5 O;  7ICI A;  1FD9 A;  4I2D A;  1QLE B;  4JYB A;  4DR3 B;  3ASN C;  1WP7 A;  1AVM A;  1AI6 A;  1H2L A;  4XDJ A;  4UBB A;  5L3D A;  4UAZ A;  3OM3 B;  2KQX A;  5JCO C;  2I9G A;  5IY5 B;  5J2B A;  4AT9 B;  2V4D A;  7ICS A;  2PBE A;  3NVO A;  4DR7 O;  4JYC A;  5IY5 C;  7ICH A;  1AP5 A;  1ZQF A;  2QTS A;  1RSO A;  5CB4 A;  2QM7 A;  1QVF U;  4YXW G;  4B3T B;  1ZQK A;  1KEC A;  4JI4 B;  3PNC A;  1DGS A;  1ZQP A;  1S5H C;  1VQN V;  3AQM A;  5J0T A;  1VP7 A;  3ZHQ A;  1F23 A;  4OAH A;  1R8A A;  1QNM A;  4DOB A;  5B1B C;  2XAS A;  4UAW A;  2Y4T A;  1OZ0 A;  3I5D A;  3U11 A;  3WFR E;  4RWP A;  4UV8 A;  4QZB A;  2DQ0 A;  4FLU A;  2CE4 A; 
#chains in the Genus database with same CATH homology
 4M04 A;  4P4O A;  7ICU A;  4FHX A;  4X5V A;  4KLS A;  3RJJ A;  3MGI A;  4JWN A;  2ZH6 A;  4QZD A;  4MFC A;  3WFS C;  5DEC A;  2M2T A;  4NM2 A;  1V4A A;  3V7L A;  8ICH A;  3JPR A;  4O9M A;  1VFG A;  5HRF A;  3C18 A;  2DRB A;  5BOL A;  4RQ7 A;  1KEJ A;  1YLQ A;  1TV9 A;  5DB9 A;  4MFA A;  3UPS A;  4M47 A;  1JMS A;  5HC9 A;  4GXK A;  4P2H A;  2M2V A;  1R89 A;  4NM1 A;  5J0S A;  4WBY A;  1BPB A;  9ICW A;  9ICN A;  1ZQL A;  1BPZ A;  3JZ0 A;  1F5A A;  2ISP A;  4PHP A;  5CWR A;  8ICW A;  3V7K A;  1R8C A;  4X4O A;  4MFF A;  3RH6 A;  4IG8 A;  5III A;  1HUO A;  4M9J A;  2FMQ A;  7ICN A;  2BCQ A;  3H3A A;  4K4I A;  4YMN A;  3C66 A;  3OUY B;  4MF2 A;  4KLE A;  7ICP A;  3C5F A;  4LT6 A;  2ZH4 A;  4F5P A;  8ICK A;  5IIK A;  1XSP A;  2HHP A;  3HJ4 A;  1BPD A;  4KLM A;  4I2H A;  5HRI A;  5HRE A;  3MGH A;  2GWS A;  4KLI A;  5HRL A;  4X0A A;  1ZJN A;  5DBA A;  3LK9 A;  1ZQQ A;  4RQ2 A;  4NLK A;  3JPT A;  1XSN A;  2DR9 A;  1Q78 A;  8ICY A;  3UXO A;  5J2H A;  3GDX A;  4LVS A;  8ICN A;  7ICF A;  1JAJ A;  1ZQX A;  4IQU A;  4PPX A;  4RQ4 A;  1ZQT A;  4TUS A;  5HR9 A;  2VAN A;  4X4Q A;  8ICR A;  4NXZ A;  4XQ8 A;  3H37 A;  4FO6 A;  5DDY A;  5F2V O;  4AT8 A;  5J2K A;  8ICT A;  4RT2 A;  5J2D A;  5HHI A;  4FHY A;  5TZV A;  5HRD A;  4UB4 A;  3L9D A;  8ICQ A;  2PFO A;  4KLO A;  1Q79 A;  4I2A A;  4M9N A;  7ICV A;  3RJK A;  2Q66 A;  3V7J A;  5IIL A;  1NO5 A;  2DR8 A;  3K75 D;  1ZQE A;  2P66 A;  4NKT A;  4Z6D A;  1ZQH A;  3NYB A;  3RJH A;  2ZH1 A;  4QZE A;  9ICM A;  8ICJ A;  9ICQ A;  4KLU A;  1ZQZ A;  4F5N A;  3B0Y A;  4WBZ A;  3UXN A;  5DB8 A;  4UB3 A;  4O5E A;  4NLN A;  9ICV A;  3RJF A;  5J2A A;  8ICF A;  1TFW A;  4GXI A;  4WC0 A;  3RJE A;  9ICL A;  1ZQN A;  9ICG A;  8ICM A;  4M9H A;  3PMN A;  4X0B A;  1XSL A;  3AU2 A;  5J2E A;  2ZH9 A;  3ISB A;  3UQ2 A;  2ZH5 A;  4QZ9 A;  4KLF A;  1ZQY A;  4XQ7 A;  1ZQB A;  2BCS A;  4R66 A;  3WFO A;  4UB2 A;  4QZI A;  4XUS A;  1R8B A;  1ZQO A;  4UBC A;  9ICT A;  1MQ3 A;  4KLQ A;  2NRK A;  2BPG A;  4EBJ A;  1WOT A;  3MBY A;  5IIJ A;  4I2E A;  4AT9 A;  5J0Q A;  5J29 A;  9ICP A;  4WC5 A;  1MIY A;  1ZQD A;  4RT3 A;  8ICI A;  5DBB A;  1ZQU A;  2ZH8 A;  4WC7 A;  4X4U A;  4KLT A;  3ISC A;  9ICO A;  1ZQJ A;  4P4M A;  2DVI A;  9ICB A;  4IQW A;  3B0X A;  7ICQ A;  4UD4 A;  2ISO A;  4RWN A;  3JPS A;  4I2C A;  8ICG A;  4TUR A;  4UAY A;  5DB6 A;  5J0X A;  2BCR A;  1ZQM A;  9ICU A;  4R63 A;  3MDC A;  4QZC A;  4F5R A;  4PGQ A;  1BPY A;  4KLH A;  4RQ1 A;  4GXJ A;  4X4P A;  2FMS A;  2ZHA A;  5J2G A;  4FH3 A;  2BPC A;  7ICL A;  1ZJM A;  4I2I A;  4M2Y A;  4E80 A;  5IIO A;  5IIN A;  5HRB A;  4WC3 A;  4M9G A;  4P4P A;  3UQ0 A;  4AT7 B;  4RPX A;  5BPC A;  2DR5 A;  2BCV A;  8ICU A;  5CP2 A;  3AQL A;  2DR7 A;  3HIY A;  4NLZ A;  8ICZ A;  4KLL A;  8ICL A;  1ZQV A;  4FHP A;  4YN4 A;  3HX0 A;  1BPE A;  4K4G A;  8ICC A;  9ICC A;  3OGU A;  3H39 A;  3C2K A;  4QZG A;  3HW8 A;  3C5G A;  5D49 A;  4M9L A;  4IQV A;  4WC4 A;  2W9M A;  5DBC A;  8ICO A;  5DDM A;  1TVA A;  9ICJ A;  4RQ3 A;  1ZQC A;  9ICK A;  4S3N A;  2BE3 A;  5HHH A;  9ICI A;  1KDH A;  4RQ8 A;  3TFS A;  8ICP A;  1ZQA A;  1BPX A;  8ICS A;  1MQ2 A;  4KLD A;  4PGX A;  5J0R A;  1UEV A;  9ICX A;  1FA0 A;  4WC2 A;  3WFP A;  4RQ6 A;  4KLG A;  3RJG A;  3RH5 A;  2O1P A;  4YCX A;  4EBK A;  3AUO A;  7ICO A;  7ICG A;  4XRH A;  8ICB A;  9ICE A;  4DOC A;  5CJ7 A;  2PFP A;  2M2W A;  5DB7 A;  4PHA A;  7ICK A;  9ICR A;  3OUY A;  4I2J A;  4EP7 A;  3HWT A;  4YMM A;  4NKU A;  5CA7 A;  4I27 A;  4I29 A;  4M0A A;  4FHW A;  7ICR A;  4PHE A;  5J2F A;  5HRH A;  4KLJ A;  4XA5 A;  2BPF A;  3AQN A;  4QZH A;  1MIV A;  4I28 A;  1TFY A;  8ICE A;  4ATB A;  2FMP A;  4R65 A;  3H38 A;  2ZH3 A;  5CR0 A;  4Z6E A;  1RPL A;  4TUP A;  3AQK A;  3TFR A;  4F5O A;  4E7X A;  7ICE A;  4PHD A;  1HUZ A;  2O5A A;  9ICF A;  7ICM A;  5J2J A;  5J0U A;  5J0P A;  4RQ5 A;  4FHV A;  1KNY A;  4RQ0 A;  8ICV A;  3OVA A;  3HJ1 A;  2PFN A;  5J0Y A;  4LZG A;  4NY8 A;  1JN3 A;  2DRA A;  4R64 A;  4UD5 A;  1RZT A;  9ICH A;  5CB1 A;  4X4T A;  2ID1 A;  4RWQ A;  3JPQ A;  3C2M A;  4DO9 A;  4YMO A;  4WC6 A;  1ZQI A;  4PH5 A;  4RPY A;  4O5K A;  4I2B A;  4RPZ A;  1NOM A;  5J0O A;  2M2U A;  3V72 A;  7ICT A;  3MDA A;  5HRK A;  4K4H A;  3OVS A;  1ZQS A;  2ZHB A;  2BCU A;  4IQT A;  4Z6C A;  4RWO A;  4YD2 A;  4DOA A;  3JPO A;  2IHM A;  3OVB A;  4TUQ A;  4ATB B;  3UXP A;  1VJ7 A;  3UPQ A;  4QZA A;  3RJI A;  3JPN A;  2RFF A;  3ISD A;  5HRG A;  5D46 A;  4MF8 A;  1UET A;  1ZQG A;  4I2F A;  5EOZ A;  1UEU A;  1JQR A;  4WCW A;  5CHG A;  4UB1 A;  4WC1 A;  3PML A;  8ICX A;  3JYY A;  4I2G A;  7ICI A;  4X4N A;  4X4R A;  4UB5 A;  9ICS A;  4I2D A;  4PGY A;  5DKW A;  5BOM A;  4UBB A;  7ICJ A;  5DED A;  4UAZ A;  2I9G A;  5J2B A;  4AT9 B;  7ICS A;  1ZQW A;  2PBE A;  5J0W A;  3WFQ E;  8ICA A;  4LZD A;  7ICH A;  4FH5 A;  3RH4 A;  4YD1 A;  1ZQF A;  4O5C A;  4AT7 A;  1MIW A;  2ZH7 A;  1PX5 A;  4M5D A;  5J2C A;  1OU5 A;  1ZQK A;  4E8F A;  4F5Q A;  3PNC A;  5J2I A;  2ZH2 A;  3OV7 A;  3JPP A;  4Z6F A;  4JWM A;  4X4S A;  3C2L A;  1ZQP A;  3AQM A;  5J0T A;  1ZQR A;  9ICA A;  4X4V A;  2PXI A;  4QZF A;  5D4B A;  1R8A A;  4DOB A;  4QZ8 A;  4UAW A;  5IIM A;  4AT8 B;  3LQC B;  3WFR E;  4RWP A;  2PFQ A;  4QZB A;  3AU6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...