5DEDA

Crystal structure of the small alarmone synthethase 1 from bacillus subtilis bound to its product pppgpp
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
198
structure length
196
Chain Sequence
b'DKQWERFLVPYRQAVEELKVKLKGIRTLYEYEDDHSPIEFVTGRVKPVASILEKARRKSIPLHEIETMQDIAGLRIMCQFVDDIQIVKEMLFARKDFTVVDQRDYIAEHKESGYRSYHLVVLYPLQTVSGEKHVLVEIQIRTLAMNFWATIEHSLNYKYSGNIPEKVKLRLQRASEAASRLDEEMSEIRGEVQEAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP pyrophosphokinase YjbM
publication title Catalytic mechanism and allosteric regulation of an oligomeric (p)ppGpp synthetase by an alarmone.
pubmed doi rcsb
source organism Bacillus subtilis py79
molecule tags Transferase
total genus 62
structure length 196
sequence length 198
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.6.5: GTP diphosphokinase.
pdb deposition date 2015-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04607 RelA_SpoT Region found in RelA / SpoT proteins
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.860 Mainly Alpha Orthogonal Bundle Helix Hairpins Nucleotidyltransferase 5dedA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 5dedA01
5J2JA 5J2CA 1KEJA 4K4GA 3HWTA 7ICEA 3B0XA 8ICIA 2ZH5A 4KLUA 4UB4A 8ICMA 4QZFA 4X4SA 3AQNA 3C2KA 5J29A 5HRFA 9ICVA 4WC0A 4NKTA 3JPQA 8ICLA 4XQ7A 4UAZA 4DOCA 7ICSA 4UBBA 5J2EA 5DB7A 1NO5A 1TFYA 3V7KA 1BPBA 3B0YA 4PHAA 5HRDA 1BPDA 3OUYA 1ZQRA 1JN3A 9ICGA 4UBCA 4I29A 3RJIA 5D46A 9ICFA 1BPXA 5DBBA 1ZQWA 1V4AA 9ICQA 3HJ4A 5HRKA 1ZQNA 3RJKA 5IINA 1ZQVA 9ICRA 4I2JA 8ICSA 4M9LA 1ZQDA 1BPEA 3PNCA 7ICFA 3L9DA 1ZQSA 5D49A 4X4VA 3PMLA 4I2CA 5HRHA 4KLMA 2ZH7A 3LQCB 3RH4A 4RPZA 4RQ2A 7ICHA 2FMPA 4X0AA 3H39A 1ZQLA 2DR5A 4YN4A 3PMNA 4I2EA 1VJ7A 4RQ8A 3C2LA 4FHWA 1FA0A 3H37A 4E8FA 1ZQTA 3MBYA 4I2IA 5J0PA 7ICIA 4M9GA 5F2VO 1ZQFA 2M2WA 2DVIA 4AT7B 4YD1A 1ZJNA 4X4RA 3OVBA 4DOAA 8ICPA 4WBZA 4RWOA 3JPTA 9ICOA 4WCWA 9ICNA 5CR0A 5IIOA 2ZH1A 5BOLA 4AT8A 3OVSA 2ZHBA 2ZH2A 4M04A 5BPCA 4RQ3A 8ICZA 4KLEA 5CWRA 3HJ1A 2FMQA 8ICUA 4XA5A 4X4TA 4RWNA 3TFSA 1JQRA 1UEUA 4RQ7A 3JPNA 9ICCA 5IIJA 5HREA 4R66A 4RQ0A 4M9JA 4EBKA 5IILA 7ICNA 4Z6CA 4NKUA 1ZQZA 3OUYB 5J0SA 4RQ6A 4MFFA 4UB1A 3WFSC 3JYYA 2BCQA 1TVAA 4QZIA 5DB9A 5J2DA 3LK9A 5HR9A 4KLJA 4JWNA 4F5OA 5DBAA 2NRKA 4QZEA 8ICCA 5DDMA 1ZQGA 3AUOA 1ZQCA 4XUSA 1MIVA 8ICAA 4QZAA 3WFPA 9ICXA 3UQ2A 9ICMA 4IQUA 2GWSA 4GXJA 7ICKA 1XSLA 4PGYA 4YMNA 5J2FA 3UPSA 4M9HA 4YMOA 4FHVA 4O5CA 4QZBA 4QZ9A 4RWQA 9ICEA 4RQ5A 3JPPA 2I9GA 4TUPA 1XSPA 3H3AA 5D4BA 5J0YA 2ISOA 4P2HA 2PBEA 3RJFA 3UPQA 2ISPA 1R8BA 1JAJA 1TFWA 4I2HA 1NOMA 1ZQYA 8ICVA 8ICQA 4YD2A 2PFNA 4I2AA 9ICTA 4PGXA 1RZTA 8ICKA 4AT8B 2HHPA 4KLGA 1ZQQA 2DR7A 4QZ8A 5CJ7A 4TUSA 9ICPA 4KLHA 3JPRA 4UD4A 4RT3A 1ZQIA 3V72A 5DEDA 2BPGA 4UB5A 1ZQXA 3WFQE 3ISBA 5J0RA 1BPZA 5IIMA 2ZH9A 5EOZA 4IQVA 2PFPA 4DO9A 9ICBA 5HRIA 3AQKA 7ICMA 5J0OA 4UAWA 3AU6A 2RFFA 4M2YA 1R89A 5DB8A 4MFCA 4X0BA 4RT2A 5HRGA 4LT6A 2VANA 3UQ0A 1F5AA 4UAYA 1ZQJA 1ZQBA 7ICUA 4M0AA 4NY8A 7ICRA 1WOTA 4RWPA 2ZH3A 4Z6FA 4NLKA 8ICEA 4JWMA 4LZDA 2BCUA 2BE3A 4EP7A 3V7JA 3UXPA 5CA7A 9ICWA 4F5RA 1UETA 4WC6A 4I2BA 1ZQHA 5TZVA 9ICSA 3JZ0A 5IIKA 2BCRA 7ICQA 3WFOA 4NLNA 2DRBA 4YCXA 3MGHA 5DDYA 2DRAA 1KNYA 4I2FA 5J0XA 8ICNA 4TURA 4Z6EA 4IQWA 4F5NA 5DECA 8ICYA 1UEVA 3AQMA 2PFQA 4RQ1A 4QZGA 4M47A 3H38A 4PHPA 5HHIA 1MQ3A 4KLIA 3K75D 4P4OA 1R8AA 5HRBA 5J2BA 4M9NA 4UB3A 4MFAA 3MDAA 3TFRA 4QZCA 4O9MA 4R65A 4RPXA 5CB1A 1TV9A 4I2DA 5DBCA 3NYBA 7ICVA 5J2IA 3ISCA 2DR8A 2P66A 3JPSA 2ZHAA 5J2KA 1ZJMA 4WC5A 4EBJA 3WFRE 4UD5A 1JMSA 7ICOA 2Q66A 8ICHA 4ATBA 4AT9A 1PX5A 2PXIA 4FHPA 4O5KA 7ICTA 3AQLA 9ICJA 3C18A 1ZQUA 5J0WA 4FH3A 3AU2A 4Z6DA 4KLDA 7ICLA 4YMMA 4F5PA 8ICOA 1ZQOA 4WC7A 4P4PA 5J0QA 3V7LA 4MF8A 4PHDA 2W9MA 4NLZA 2ID1A 8ICFA 5J2HA 4WC1A 8ICXA 4I28A 9ICIA 2ZH6A 3OGUA 8ICRA 1ZQPA 1ZQMA 4R64A 4NM1A 3MDCA 8ICBA 9ICKA 4UB2A 4KLSA 3RJHA 4KLLA 7ICPA 4KLQA 4O5EA 3UXOA 1HUOA 9ICUA 3JPOA 1R8CA 4QZDA 4PPXA 1RPLA 4PGQA 4X4NA 2BCVA 4QZHA 4PHEA 4I2GA 4X4PA 1XSNA 7ICJA 4M5DA 2ZH4A 4LZGA 9ICHA 3GDXA 4RQ4A 5BOMA 4R63A 8ICJA 1KDHA 4KLTA 3RH6A 4X4QA 2BPCA 4WC3A 3OVAA 5DKWA 3RH5A 4LVSA 2O5AA 2M2TA 4I27A 1VFGA 1ZQAA 4K4IA 4XRHA 5HC9A 3RJEA 4GXIA 4KLFA 8ICTA 5CP2A 3RJJA 5IIIA 4F5QA 2FMSA 4X5VA 2M2VA 4RPYA 2DR9A 4NM2A 5J0UA 9ICLA 3C66A 3C5GA 3OV7A 4KLOA 2ZH8A 4FO6A 1ZQKA 4ATBB 4AT9B 1YLQA 4S3NA 4NXZA 2BPFA 4E80A 4IG8A 4WC2A 4GXKA 5CHGA 2M2UA 3C5FA 3C2MA 5J0TA 3UXNA 4K4HA 4WC4A 1MIYA 1Q78A 8ICWA 2PFOA 7ICGA 5HHHA 4E7XA 4PH5A 2BCSA 1Q79A 3HIYA 3ISDA 4XQ8A 1MQ2A 4P4MA 4X4UA 5J2GA 3HW8A 4MF2A 4WBYA 3RJGA 1OU5A 1HUZA 4FHYA 4FHXA 4IQTA 1BPYA 1MIWA 2O1PA 5DB6A 9ICAA 4FH5A 5HRLA 3MGIA 2IHMA 4DOBA 4AT7A 8ICGA 1ZQEA 4TUQA 5J2AA 4X4OA 3HX0A
chains in the Genus database with same CATH superfamily
4Z2WA 2X7RB 2Q67A 1SF9A 5A9GA 4G27B 3ETDA 2FYUH 4TUYB 4NXWA 4K4GA 4GX5A 3WFVA 5KMGA 3B0XA 3T4DA 3CCMV 2H8PC 3VBBA 3HKEB 3HKBB 1M57C 3TJTA 5JQGB 1THZA 3C2KA 1V9PA 3G4SV 3Q4HB 5ITZA 5HRFA 4ZOLB 2YICA 8ICLA 2YI9A 4XQ7A 2JDIG 5H6QA 2LJ2A 5J2EA 3M8AA 4FK5C 3B0YA 2VQFB 4O67A 5HRDA 1JN3A 1P4RA 4J7JA 4WBNB 3RJIA 2CUGA 1W59A 4DO2A 4O4JB 3T4ZA 4UCTA 1BPXA 5H9CA 3P3PA 2W0XA 4PDRA 3OWGA 1JFFB 9ICQA 5JCOA 1VQ7V 4DR3B 1JPXA 2GUZA 2QE7G 3TXSA 3CC7V 3R65A 5B1AC 1R3JC 2GV9A 4KHPO 3T1HB 4TSFG 3JD2A 2N04A 3ABTA 7ICFA 1EN6A 2QM8A 1FFTB 4I2CA 4AQYO 3JASA 3RVZA 3HKEA 5HRHA 4I9WA 4I55B 2L35A 5JQGA 2P7TC 2FMPA 1Z5WA 3PMNA 1HNWO 2YC0A 2AZ0A 4UFZA 4MVMA 4FLXA 4B3RO 4DV3O 1S5HC 1UJWB 3I56V 4UB8Z 1K4DC 2IJHA 1ZQTA 3DC5A 3EHBB 1H2KA 1EM1A 3CX5F 1NR1A 4DV4O 2DVIA 2UXXA 2M2WA 4AT7B 5IYZA 3A0BZ 4WBNA 4X4RA 2N74A 1YTFD 8ICPA 4WBZA 4B3MB 4LFAB 4NXNB 3E89A 2F93B 2EIJB 1OCRC 3OVSA 2GA9D 5B5EZ 4RQ3A 3RN4A 3HJ1A 1PNLA 1GM9A 3TFSA 4CH3A 1G4YB 4RQ7A 5E79Z 4QPKA 1FKAO 4RQ0A 1B04A 1KUQA 2Y69B 3K06A 4EBKA 3QF7A 1K92A 4I55A 5K1PA 1Q8IA 2B9ZA 5LL6Y 5IILA 7ICNA 1AR5A 5JJJB 2Q4PA 1SA0B 2PZSA 1VF6A 4O4IA 3OUYB 1NJIW 3H01A 2W6JG 2Y0PA 5KLVH 3EF2A 2DWEC 3LK9A 5J2DA 1BQ0A 3LNMB 5D62A 4KLJA 1Q6UA 2A7WA 3SPGA 2B1GA 2NRKA 2GTAA 3IC7A 1Q86W 4DW1A 4MTOA 5DDMA 4IIJB 1AP5A 2DOSA 3H1IH 4XUSA 1F7YA 5EBLC 1KQSU 5FPRA 4LP8A 3W7WA 3WFPA 4QZAA 2ZINA 3AK3A 1XEQA 1V55C 4PA6A 1AJNA 4IHJA 1RPOA 3ZMZA 4B7KA 4K0KO 3HPLC 3MAQA 3UCSC 4GXJA 2CH7A 4ASUG 1B6QA 1MA1A 3C90A 2B56A 3UPSA 3K08A 4LF4B 3S3WA 1VQLV 2RMKB 4O5CA 5CMUA 2DQ0A 4X88A 3TXQA 1RM1B 2V7QG 4LEVA 5FL7G 5J2UB 1SA0A 1WB7A 2B51A 2ISOA 4RAIA 4P2HA 2PBEA 4J7KA 2R72A 2W6IG 3T1YB 4EGWA 1JAJA 4DR7B 2XHBA 1ZQYA 8ICVA 4YD2A 1Y6XA 5L3BA 4PGXA 5KUKA 4YIOA 1P7GA 2IJIA 4AT8B 1QR9A 1ZQQA 2DR7A 2MK3A 5CJ7A 4IIJA 4LWSB 5KHJA 4KLHA 3JPRA 1R3KC 4P9OA 1N34B 3PHZA 5LHGA 4WF9V 3KG2A 3V72A 2LW1A 1XL4A 5KHGA 4K35A 3OTOO 2F4VB 3ISBA 4JI5O 1BPZA 5JJNB 3BA9A 4QE7A 4IQVA 4DO9A 2ZE5A 2QM4A 4ABMA 4UAWA 3AU6A 5EIBC 4M2YA 3RYCB 1H38A 4EFBA 3KZIZ 4JGSA 3AG4C 2VQEB 5LMNO 1IVSA 4WQLA 1D5AA 4NR1A 1N32O 3E8FA 4LT6A 2VANA 3UQ0A 5IT9N 2NNUA 5LGNA 1DTOA 1I08A 3K0DA 3RWRD 4M0AA 4NY8A 1GKFA 1HDJA 3GWOA 2ZH3A 1AR1B 8ICEA 4JWMA 1SZXA 3OFNG 4JAAA 2BE3A 1H8HG 4PV1B 2NR5A 4TOIA 3OR6C 4LWSA 5CA7A 1W0JG 3W7UA 4MSWC 4K9AA 1UETA 4JASA 4WC6A 4I2BA 1GRJA 7ICQA 1H2LA 4UVCA 3WFOA 1QLEB 3OAAG 1QQCA 1VQKV 1R6TA 2WLIB 5J0XA 1IBKO 8ICNA 2FTKA 1TAEA 3ASNC 1LR1A 3GB7C 4IQWA 2HP8A 3UQ8A 1VQMV 1NR7A 4DV1B 3RYCA 3AQMA 5JVDB 1N8RW 4JLZA 3H38A 4EEBA 1MQ3A 4P4OA 4WFGA 3P3NA 3ZBHA 2ZIOA 4M9NA 3SYOA 1P7BA 3MDAA 3TFRA 1ZWIC 1E1QG 5IY5B 1F4MA 3OTOB 5CB1A 1PNMA 3QO5A 7ICVA 5J2IA 1X4TA 2DR8A 3CCSV 3JPSA 1HP8A 3PJSK 2ARHA 5KA5A 2ZHAA 5J2KA 4LF6B 3DXRB 1H2SB 2E74B 4EBJA 4UD5A 3SJBC 7ICOA 2YI8A 5LA6A 4AT9A 1PX5A 2PXIA 3ZN0A 1NVPB 3AQLA 1YJNV 1XHZA 3AU2A 1K73W 2IM9A 3FYIB 5CFUA 4EEDA 3BVOA 3V7LA 3STZC 2ID1A 4X9QA 4N7RA 4MVZA 3BPZA 3CCQV 4OAFA 5JVDA 2JIZG 3HB3B 1FD9A 3O9OA 4PA7A 1US6A 9ICKA 4UB2A 2YEVB 4IYIA 1XMQB 5D5QA 3KCXA 4NXVA 4O5EA 2QEXV 1X59A 1XDCA 1PKXA 5KAFZ 3CCJV 1W2BU 2RN9A 3OMIB 3L70H 4PHEA 2HHHO 4IL6Z 2F43G 1SQGA 1H8EG 3DXRA 3B09A 2QSAA 2DYSC 5BY1A 3G80A 2RQ6A 4RQ4A 5B1BC 1R1BA 8ICJA 2IU3A 4EV6A 2ZT9B 3STLC 2ZR2A 2JEUA 4O2BB 3JD0A 2BPCA 5LOVB 3W7SA 3LSQA 2FL4A 1VFGA 1QLNA 3U0ZA 4Q20A 5HC9A 1YIJV 3CK6A 4KLFA 4O4LA 1VQ8V 4GUNA 4UVAA 3RJJA 1YSCA 4GCZA 4LF7B 2YEVA 4FLUA 2ITCC 2ZNJA 4DRXB 4RPYA 4NM2A 9ICLA 4JI2O 3C5GA 3OV7A 5B3PA 4PDLA 2ZH8A 4HAMA 2BTQB 4PDVA 2QWOB 1KD1W 4NXTA 1O9HA 4HZ3A 5CA0B 4WC2A 4GXKA 2M2UA 3C5FA 3CHXA 3C2MA 5J0TA 2IJJA 5J9PC 2JEXA 2QDOA 4GX1A 4LF8B 1SERA 3NKUA 2EJRA 5HHHA 2OCHA 4PH5A 3HIYA 5LOVA 2ZR3A 4WFAV 4P4MA 3K3WA 4K9BA 3SR2C 5J2GA 3HW8A 3SYCA 1NBMG 4WBYA 1SS3A 2MW2B 3MHHC 4JYBA 1AILA 3MHSC 2IW5A 4BW9A 4FHXA 2KKWA 1N36B 4RQFA 1T5EA 2IU0A 4DRXA 1GM8A 1PD3A 3TGUH 4B3SO 3E2EA 5L3FA 1ZX3A 3E83A 2FB5A 3AG2C 2FCLA 5IYBO 4FM0A 7ICJA 2ZD9A 4TT3G 5CA0A 3APQA 3IFXA 1KEJA 4GKKB 2E5LO 7ICEA 1K4CC 4DV6O 4PA4A 2ZIMA 4LEYA 1VEWA 2ETNA 3ER9B 2YSUB 2RDCA 2WLJA 2EULA 3K57A 1VQ4V 3AQNA 4UCOA 2DN9A 4JI3B 3JPQA 1OZ0A 2X6AA 3VQXA 4E4EA 1AJQA 1Q82W 1Z5VA 2JGUA 4UAZA 7ICSA 2LP7A 5L3DA 2QKSA 4HBNA 5CFSA 1BPBA 3HKDB 1ZQRA 4BW5A 4U3JB 4I0XB 4I29A 1MZFA 4I50B 2YIAA 4JI0O 4GT1A 9ICFA 2HFEC 1JA8A 2GBOA 1IXMA 4UV8A 5B1NA 3OE7G 1V54C 1OCRB 3LNNA 4O4HA 1ZQNA 3RJKA 4LCUC 5CB4B 1HNZO 2WA4A 3CP1A 3MD0A 2Y4TA 4I2JA 3BFRA 4K3AA 3PNCA 2ADPA 4JI4O 3PMLA 2VWKA 4JV5O 4JAUA 4MT8A 4DR1B 2IHOA 4YJ3B 4K8ZA 4RPZA 3ABKC 1P49A 4JYYA 3K5LA 4X0AA 4LFCO 5D63A 1S77D 1ZQLA 4PI0A 1RSOA 1N4CA 4NVPA 4I2EA 4UCRA 1AROP 1YVWA 2PY5A 1FA0A 1KYOF 3H37A 3RGBA 1Q3EA 5J0PA 2Q9LA 4UCSA 3NWIA 7ICIA 5KAIZ 1TGOA 4M9GA 3HKDA 2OIEA 2QKCA 3LSUA 3OTFA 1U96A 4I50A 1IBLO 4RWOA 2DMXA 3CYOA 4NYKA 4YXWG 2BOBC 4R6ZA 4X66B 2GSMB 5IIOA 2ZH1A 5BOLA 4GYCB 3ZRWA 1V55B 5KMGB 5BPCA 2ZHBA 2ZH2A 4JI8B 5CB4A 4KLEA 4H44B 1CXZB 5JH7A 8ICUA 4DK1A 4RWNA 4JAVA 4FZ1A 4ZKIA 3CJHB 4JLXA 3JPNA 5IWAB 2HEPA 4WFEA 5IIJA 5ITZB 2E3CA 5HREA 4R66A 4M9JA 3B4SA 3ZHVA 3FB5C 2UUAB 3AK1A 4XDLA 3R66A 4D7TA 3B2EE 4YJ3A 1E79G 1FAFA 1KKCA 2UXNA 3FYEB 4J9ZB 4E2LA 3JATA 1ZQZA 2JRIA 5FNVA 4AILC 4I4TA 1BZKA 5J0SA 2VS0A 3JYYA 2BCQA 5GONB 4QZIA 4RUEA 3G67A 3QNEA 4LF9O 1FXKC 3K0GA 4MTFA 5DBAA 4QZEA 4DR4O 5LP6A 8ICCA 5CN0A 5BR8B 1NVPD 4LF5O 5GTIZ 1ZQCA 8ICAA 3H9VA 1S0VA 3SJAC 4JI1O 9ICMA 3JASB 1KP3A 1XOUA 3JD3A 4DR2B 2ADQB 5IYCO 3ZS8C 1M56C 3CJHA 4PGYA 4MVSA 2R9RB 2ZM6O 2P67A 4M9HA 4LH7A 3RYHA 4B3TB 1JOYA 2UXBB 1WP8A 1EN5A 1VP7A 2YIBD 1FS0G 4OX9O 3H3AA 4JYAO 3AG4B 5D4BA 4X1YA 5J0YA 3RJFA 4FVMA 5IYZB 4YY3O 1R8BA 5TISZ 5GONA 1NOMA 8ICQA 2A0LA 4I2AA 4QIWF 3KCYA 2B4VA 5K1XA 8ICKA 3L71H 4KLGA 1A32A 4X62B 4Q6GA 1AI6A 4BIUA 4QZ8A 1FXHA 4TUSA 1AP6A 9ICPA 2IH3C 4DV2B 1KU9A 4RT3A 4X64O 5DEDA 1PNKA 3UO2A 2EWRA 2BPGA 4UCUA 1BGYH 4X89A 4PD4F 4UB5A 1BT8A 4X65O 2XOKG 5JJEB 3ZIAG 1FPOA 4JI6B 3TK1A 1XUQA 2ZH9A 3ICXA 5EOZA 4O4IB 3AQKA 5J0OA 4MS2A 3ZCCA 3CRRA 4X1KB 2RFFA 2P06A 1S3JA 3WU2Z 1OCOC 1SQVH 5DB8A 2A9HA 1OCZC 2P6JA 4JYCA 3DTUB 5HRGA 3LDDA 5B1OA 1FXVA 1URFA 2E75B 1ZQJA 7ICUA 1WB8A 1PL4A 2QKAA 4H0LB 2WWWA 2E76B 4Z1MG 4RWPA 3ETEA 4PA3A 1XNQO 4NLKA 4PHZA 4IHJB 3C3TA 4NXXA 4EP7A 2RNBA 2JS5A 3B77A 2CH7B 4K8XA 4F5RA 1PM9A 2XAQA 4K98A 1M1KW 1ZQHA 1RP3B 4MW8A 3DSQA 9ICSA 5GTHZ 2RCVA 3ZEDA 2LFRA 4TQFA 2DRAA 4J11A 1S72V 4DW0A 1KNYA 1WP7A 4DK0A 4I2FA 4RO2A 5IYDO 2UXCO 4TURA 4WFFA 4F5NA 3CB2A 5DECA 3HR0A 4L8JA 4X1KA 2JK5C 4KL1A 3UKMA 2Q5ZA 4PHPA 4KHPB 5LP6C 1R8AA 2OIGA 4CS2A 4NTYA 4MFAA 4DV7O 4QZCA 4O9MA 3JD1A 4AQYB 4I2DA 1J5EO 3CMAV 3JD4A 2UXDO 4OAIZ 1ZJMA 1HNWB 5B3SB 4B3RB 1N0JA 4DV3B 3W7TA 1N0NA 1JMSA 2DYSB 2EX3A 8ICHA 4ATBA 1WLEA 2Q7EA 2CTWA 4FHPA 1MABG 3LDEA 4UXNA 1ZQUA 4DV4B 4FH3A 4JI7O 2NLJC 1L0LH 4LFBO 4YMMA 4F5PA 3CSXA 1GM7A 2XTAA 4TQDA 5EC1C 2W9MA 5IJ9B 1WPXA 4QE9A 3OUFA 2LQTA 4P9PA 2EINC 4I0UA 4I28A 9ICIA 3OGUA 2OYQA 1I94O 4R64A 3IAYA 4XBFA 2Z0AA 1TUBB 3ZX6A 4DUYO 1HWYA 3CRQA 3OD4A 8ICBA 1K9MW 3RYFB 1IBMO 4KLQA 3UXOA 2YXYA 1HNXO 1DF5A 1ROPA 1GAXA 1RPLA 2OWOA 4X4NA 2BCVA 4CC6A 3N2GB 4I2GA 4IGGA 4B08A 1XSNA 2WAMA 2UU9O 2ZH4A 4WFHA 2Q0AA 9ICHA 3K5NA 3A0RA 4UUJC 2WSSG 4DV5O 5JTGA 2P90A 4MVUA 1Y66A 1YITV 3AK2A 4LVSA 2X6BA 2Y48A 4KFMA 2M2TA 2Q68A 5LGTA 1ZQAA 4PDMA 5IJ9A 2IJKA 4XRHA 4K4IA 3TCUA 3AEIA 3GVMA 1IZ3A 2ZNIA 4K0KB 1MSWD 5CP2A 4JF3A 5FLXN 1TUBA 3DGEA 1KECA 4X5VA 3RYFA 1YCIA 2D2CB 2DR9A 2EJ7A 1ORQC 5J0UA 4JPRA 5H5NA 2A79B 2CK3G 3D3QA 4MTGA 5LA6B 4AT9B 2Y4UA 1ZAUA 1YLQA 3N2GA 4NXZA 2BPFA 3MDSA 4DR6O 5D61A 4E80A 3U10A 5HFMA 4FO1A 3J81N 2QR4A 3SPCA 3B8NA 1Q78A 3JAWB 5KUMA 1NZ6A 5LMUO 5CA3A 4E7XA 4DUZO 2WLKA 4ZI7B 2RJZA 4EKWA 2CGOA 3ZJZA 4X4UA 2EIMC 4YHHO 1M5IA 1BS3A 2F95B 2HJFC 2IH1C 4OPAA 4KUMA 1WAZA 1XMOO 1OU5A 3FAVB 3F5WC 4JI5B 1DK1A 4G2KA 4IQTA 2JGDB 1L8DA 4QPJA 3K5MA 3AG7A 2O1PA 4GKJO 2IBZH 4FH5A 1UFIA 2DWDC 2IHMA 1AI5A 2HR3A 1V54B 3H1JH 1M4UA 5LMNB 8ICGA 4TUQA 1N32B 3A8TA 1SKVA 4D7SA 1N33O 2UUBO 2ZDIC 2V1DA 3UO3A 1XNRO 4CH4A 5J2CA 3OR7C 1SC5B 1GTOA 3CEIA 3HWTA 2ZH5A 3S3XA 4K96A 2YXLA 4NXMO 3JAWA 3BEHA 4K8VA 4UB4A 8ICMA 4QZFA 4O4LB 2KB1A 4J42A 4ZI7A 9ICVA 4WC0A 2XAGA 3BABA 5EYPB 2Y69C 4EEQA 1YEWA 2EBOA 3ABLC 3UT5B 4CS4A 1TFYA 4EFEA 1CPYA 3FAVA 3V7KA 2YDEA 4BAYA 1BPDA 3JAKB 4UBCA 4J10A 3ZHUA 2M7WA 5LHHA 2JGDA 2ZE8A 4LR3A 1IBKB 5D46A 5DBBA 2CGNA 4RWUA 4F6RB 1JCHA 3B40A 1V4AA 4J41A 5HRKA 2ILMA 3E8BA 2FMLA 2R70A 5IINA 1ZQVA 1AI7A 1LUVA 1BQZA 2PF4E 4NTWA 1JVMA 2HKOA 1BPEA 4GZRB 2R9AA 3L9DA 1ZQSA 5D49A 2WLHA 4KLMA 3LQCB 5KX5A 2CDYA 1FJGO 1Y76A 2HN2A 4K99A 5BZBA 2UUCO 3H39A 2DR5A 4YN4A 5EYPA 3ZHQA 1RM1C 3RW0A 1VJ7A 4RQ8A 3C2LA 4FHWA 1GN2A 2QM7A 1WA8A 4LH6A 3UT5A 5IJ0B 4I2IA 2PI4A 3K59A 5F2VO 2HJDA 3JAKA 4YD1A 3CRCA 3OVBA 1KP2A 1KKDA 3B8MA 1ZL8B 5GW7A 5LYJB 3JPTA 4F6RA 1CP9A 1FFXB 4WCWA 4UVBA 9ICNA 5CR0A 1PPJH 1SQXH 2KG7A 1XILA 3AG1C 2H94A 8ICZA 5CWRA 2FMQA 1XREA 2ZCEA 1M57B 1M56B 4P30A 4TV8A 2QWNB 4MTXA 1NH2B 2QWQB 2DW4A 4YJ2A 3EFFK 3BY6A 4KP4A 3BRCA 3SGIA 1JQ0A 4DXWA 3SYQA 3ZMUA 4Z6CA 2HHHB 4U7OA 2AZ2A 4HX0A 1EBOA 4RQ6A 1AJPA 1OHHG 3AG3C 3WFSC 5EBWC 5B66Z 1TVAA 1YJ9V 5DB9A 2B5UA 5HR9A 4DR5O 3OEHG 4JWNA 2BOCC 2QGNA 1FXKA 5IJ0A 4F5OA 2Q69A 4O4HB 3FB7C 1ZQGA 4IT5A 1NU1H 3SPJA 3HKCB 1ZL8A 5LGUA 5B1AB 5LYJA 1K34A 2ODMA 3M99B 1FFXA 3K7DA 9ICXA 1GMGA 2ATKC 3CC4V 4LEZA 4X1IB 1VQNV 4OPHA 3ZHTA 4DV0O 2GHYA 1XSLA 3D3IA 3ZMVA 4NKGB 4YMNA 1BSMA 5J2FA 4BWAA 1GN4A 5L3GA 4JI2B 1IDSA 1Q81W 1RSOB 4QZBA 4CH5A 2I9GA 4TUPA 1OCOB 1OCZB 5IDJA 3NXSA 3SYPA 3RFRA 3UPQA 1HR0O 4UCVA 3NVOA 2WLMA 2O57A 9ICTA 1F23A 1MOFA 1RZTA 1NTKH 2OCCC 3ZRWB 1WPBA 2OT5A 2QWRB 2DJVA 2YXHA 4BIZA 5JH7B 3J7AU 5IY5C 3HKCA 4R8CA 3ZMTA 1K3EA 5EBMC 1K5QA 4AI8A 1ZQIA 3FB8C 4BIOA 1VQPV 4X1IA 1BCCH 3D8CA 5CBGA 3CPWU 5BXZA 5LHIA 5IIMA 1YJWV 2H3OA 2Q7HA 3F7YC 2PFPA 3JATB 5FNVB 1AR4A 4GX2A 4I4TB 4B3SB 7ICMA 2WA3A 3JALB 1TVKA 1XBLA 1R89A 4MFCA 3WG7C 4QNHB 3J80N 4RT2A 1BHAA 1G6UA 1I0HA 2XNDG 4UAYA 5LP6B 1ZQBA 3CCEV 2E5LB 1TA8A 2YUAA 4DV6B 1Z2GA 2K1EA 1B3QA 1MZEA 1WOTA 4Z6FA 3ZMSA 3ETQA 1ZUQA 3KKYA 4LZDA 3F7VC 3VQWA 1ZSPA 3ABMC 1XHXA 9ICWA 1VQ9V 2VRZA 5TZVA 2BSKB 5EC2C 3RYHB 2EILC 2DRBA 2JJ2G 1OCCC 1SQPH 2NN4A 4C7UA 2VQFO 4MKPA 2G38A 3ETGA 4JI0B 2EIKC 4X1YB 4JTAB 5D5PA 3BA8A 5B3QA 3ZHSA 3JALA 1S5JA 4OGQB 1UEVA 4FMTA 5DN6G 4DR3O 4RQ1A 2EINB 2LO1A 1VF7A 1HNZB 4QZGA 1VIBA 2JJ1G 5HHIA 5CBHA 3K75D 3T1HO 5J2BA 3ASOC 3H1KH 4F6EA 2ZE7A 2CE4A 4LNUB 4R65A 4JI4B 4JV5B 1VQOV 4RPXA 5DM6V 2DQ3A 5DBCA 3IJ4A 4F4LA 3ISCA 1Q6IA 2AHYA 2P66A 2N05A 4LFCB 1QVGU 4WC5A 5C93A 1O9GA 4ZBMA 4ZIBA 3WFRE 1YZBA 2P4KA 1NS1A 2Q66A 4I5SA 1IXBA 2BSKA 1BE3H 2PTMA 1AB3A 4FFBB 3C18A 5J0WA 1M90W 5HFLA 4Z6DA 2ZE6A 1L1FA 7ICLA 3D36C 5KA6A 1S5LZ 2ITDC 1BMFG 4O2AB 4WC7A 4N21A 1IBLB 4B3MO 1GO3F 5J0QA 4LFAO 4H37A 2DYRC 5CBFA 1XI1A 3ZN1A 4NXNO 5J2HA 4WC1A 1JX9A 2QTOA 2ZH6A 8ICRA 3QG5A 4NM1A 2CTPA 2M6YA 4LNUA 1HUOA 9ICUA 3JPOA 3G71V 4QZDA 4PPXA 4PGQA 4MVRA 4NB5A 2K9PA 2F23A 1SETA 4WFBV 3H1HH 1VMGA 3GDXA 3ML0A 2LFSA 5A2QN 4LF9B 5BOMA 4YIPA 4R63A 1LUWA 1W0KG 3ASNB 1SQFA 4FFBA 4KLTA 4H13B 5LBQA 4DR4B 3RH6A 1DLBA 2KQXA 4WC3A 4TUYA 4LF5B 4O2AA 1OJHA 5H2FZ 2A3QA 3E22B 5AG2A 2LW7A 3HKBA 3CRMA 1QHTA 2EIMB 3NR7A 3P30A 4JI1B 3RJEA 4GXIA 2KSDA 4U7NA 3Q4HA 4UV9A 4ZOLA 1YDXA 4F5QA 2FMSA 5LXTB 4O69A 2ZM6B 2P4VA 4FLVA 4LF4O 3C66A 1J95A 1SESA 3A2FA 1B06A 4OX9B 1NTZH 3SYAA 4ATBB 3E35A 4MW3A 1NH2D 4JYAB 5KHHA 3OW2U 1YHQV 1BL8A 4QGPA 2QA4V 2XAFA 4O4JA 1Q90D 2X0LA 4YY3B 4IG8A 2CTRA 1JFFA 5BMVB 3T1YO 4GX0A 4DR7O 3UXNA 4K4HA 1BHBA 2ZKOA 4WC4A 4FLWA 1XL6A 4L87A 2PFOA 7ICGA 1GN3A 2AW9A 3L72H 3E8GA 1S76D 1Q79A 2P22C 1I5XA 1RFYA 3ISDA 4XQ8A 1Q6HA 2R9IA 2VWJA 1K5SA 4J9YB 3E22A 3N27A 4X64B 1PV0A 1N34O 2EZPA 4MF2A 3RJGA 3WB0A 3ABLB 2F1MA 3A0HZ 4DYLA 4X65B 1K8AW 1HUZA 2F4VO 3CXHF 5LXTA 2AXTZ 1EFRG 4D6TH 4I7ZB 3QVNA 2PGGA 4DOBA 4HNAB 2XASA 3JSLA 4AT7A 1ZQEA 1ZTEA 1AVMA 2VQEO 3K9AA 5B1BB 5J2AA 4X4OA 5J2JA 2GTSA 2ZDIA 2ZXWC 1AI4A 5IE9A 3SJQC 5BMVA 3CC2V 2B1IA 4P2ZA 1Q43A 3W7XA 8ICIA 4KLUA 1SRYA 1XNQB 1EN4A 3EVKA 4X4SA 3K58A 3N2KB 5J29A 4NKTA 3OGCC 4WQKA 5CA1B 2CAZC 4DOCA 4R7CA 1L0NH 2XT9A 1GN6A 1TUEB 4UBBA 1K97A 1YI2V 2JVDA 1NO5A 4LBEC 5DB7A 2PYLA 1Q5OA 5KHKA 4PHAA 1WN7A 3OUYA 1U97A 9ICGA 3JSNA 3X2QC 3QO8A 4CZZA 2UXCB 1ZQWA 3LUTB 3RBZA 4HNAA 5JCOC 3IC9A 3HJ4A 4DV1O 3AG1B 3OT7A 3OMNB 9ICRA 1Y4MA 8ICSA 2PYJA 4M9LA 1ZQDA 4DV7B 2IUBA 1EZVH 4UB6Z 3BAAA 4X4VA 5L3CA 1J5EB 4XDJA 4A5UB 2ZH7A 3RH4A 4RQ2A 1PL0A 7ICHA 3N2KA 2UXDB 4ICGA 3CMEV 3L75H 3VQVA 3AG3B 4LF6O 1NT2B 1QVFU 5CA1A 4E8FA 1VF5B 1F4NA 3MBYA 3OUSA 5J2UA 4OAGA 1YXBA 1H2MA 4JI7B 5CFTA 1ZQFA 4LFBB 3AG2B 1VARA 1ZJNA 4DOAA 4MVQA 2HN1A 1QBZA 2YIDA 9ICOA 1QU7A 1YF2A 2Q8VA 5EZYB 1SQQH 4FJCC 4AT8A 4M04A 1JMKC 1I94B 4XA5A 4X4TA 1JQRA 3CCLV 4DUYB 3T2MA 1GH6A 1UEUA 1IBMB 9ICCA 1XMQO 3CD6V 3FD9A 1HNXB 1KBHA 4R50A 2YS8A 2FKXA 1R6NA 2QTSA 1ENVA 3JCZA 1VF6C 4NKUA 1EZJA 3FB6C 3QO7A 2L6LA 4MFFA 4UB1A 2UU9B 3WB1A 2D3OW 4RQEA 3K9SA 2Q7GA 4DV5B 4Z1VA 4OAHA 4O68A 3ZRSA 4RUFA 1D2DA 4CBCA 1OV9A 1LNQA 2OCCB 4OXSA 4W4KA 3U11A 3AUOA 1M9NA 4J7ZA 4J80A 5FPOA 1WNSA 1R3IC 5EIBD 1MIVA 2EIJC 5EZYA 3UQ2A 4B7EA 4FM2A 4IQUA 4JZ2A 1K33A 1JJOA 3FKSG 2GWSA 3APOA 3EXAA 2QJ1A 7ICKA 3K04A 5KX5B 1Y76B 3JYCA 4LF7O 3T1CA 3ABKB 4O6AA 3THOA 3JAMN 1MSDA 2OTJV 4YMOA 4QZ9A 4RWQA 9ICEA 3JPPA 2C2AA 5KHIA 1WA8B 1D5NA 1XSPA 1NKDA 3WG7B 2BBJA 3OGIB 1COWG 2WLIA 4DR6B 4NXUA 5H6RA 3I55V 2WLNA 4FLYA 2ISPA 5JWPA 1TFWA 4I2HA 1Y67A 3CCUV 1IX9A 3SPIA 2PFNA 4LF8O 5LMUB 2KG7B 2Z5UA 2HHPA 4DUZB 3E8HA 3TETA 2V4DA 1DF4A 1R73A 3ZHRA 3ABMB 2AHZA 4UD4A 4YHHB 4TV8B 2XAJA 1G8MA 3UM7A 1XMOB 2EILB 3M7MX 4YJ2B 3SPHA 1OCCB 4GLXA 1ZQXA 1NTMH 2Q73A 3WFQE 5B3SC 1DGSA 5J0RA 1XQ8A 1N36O 2DE0X 3G6BA 4GKJB 2EIKB 3FFQA 9ICBA 2HG5C 5HRIA 1NQTA 1F51A 3ER8C 1MMMA 3GWKC 2QWPB 4FFKA 1RPRA 2PI5A 1FXKB 4X0BA 1N33B 2UUBB 1I7FA 3SJCC 1F5AA 1XNRB 1SZTA 4G28B 3ASOB 2GAFD 4GKKO 5J2TB 3CXCU 2CTQA 7ICRA 4NTXA 5E1AC 3WB2A 2F66C 4TWKA 3CCRV 4NXMB 2XAHA 4JTDB 1WJZA 2AGAA 2BCUA 2YIBA 4H33A 1G1XB 1H2GA 3V7JA 2X6CA 3UXPA 1R6KA 4JI3O 3SDLA 4EB6B 3RYIB 3VQYA 2BCCH 3JZ0A 5IIKA 2BCRA 1QNMA 1YTFB 4NLNA 1VQ5V 4YCXA 3MGHA 5DDYA 1KB9F 3E86A 1HW7A 1QCEA 1R3LC 3BCCH 2LGQA 3H1LH 3I5DA 4X20B 4CS3A 4KXRA 4Z6EA 2PUSA 4FIPC 2DYRB 1I5YA 3CE2A 8ICYA 4JZGA 4O2BA 2OTLV 2PFQA 3K03A 4M47A 4X8AA 4KLIA 4PI2A 5HRBA 1IURA 4UB3A 4XJEA 3ZRXA 5J2TA 1TV9A 1GK9A 4FLZA 4DR1O 3NYBA 1MG1A 1FJGB 2UUCB 4CH6A 4LEWA 4BR6A 1M93A 3OM3B 3RVYA 4EB6A 4CC5A 3LSSA 3RYIA 2BTQA 3O65A 4O5KA 1QLEC 7ICTA 3QTCA 3LDCA 9ICJA 1P84F 1TVKB 2Q6AA 1KC8W 4KLDA 2Y0IA 2BBHA 3D36A 4FM1A 1ZQOA 8ICOA 4P4PA 4X20A 1KMIZ 3ABUA 4QJFB 4JTCB 4MF8A 2Z3YA 4PHDA 4NLZA 4X66O 8ICFA 5EK0A 2W0FC 4WH5A 2HLDG 8ICXA 3FX7A 4JI8O 3ERCC 4LC1A 1ZQPA 1ZQMA 3MDCA 4IYHA 2JS3A 3RJHA 3K79A 5IWAO 4KLLA 3L73H 4KLSA 7ICPA 1R8CA 4ZHQB 2HVJC 2UUAO 1Y74B 4PELA 4QZHA 3G6EV 4X4PA 1CEZA 2WPDG 4M5DA 2HVKC 2WLLB 4U3FH 4LZGA 2LGWA 4DR5B 1UPGA 4FZ0A 1KDHA 3OMAB 4X4QA 2GDSA 2P5OA 3ZRVA 5DKWA 3OVAA 5BR8O 1NI8A 1PP9H 3RH5A 2O5AA 4WOYA 5C8YB 4I27A 5L3EA 4TV9B 1FYJA 8ICTA 4DV0B 2ZQMA 4DR2O 5IIIA 4XDKA 3RT3C 2Q0OC 2BTOA 4MVOA 2M2VA 3L74H 1E1RG 4FPPA 1JJ2U 3CRAA 4ZHQA 4KLOA 3JARB 4B3TO 2UXBO 3JCFA 4FO6A 1ZQKA 1VQ6V 1Y74A 4U3JA 4I0XA 3CWBH 4S3NA 2EZOA 3CS5A 3PN1A 2ZXWB 5CHGA 2XUMA 1HR0B 2WLLA 1Q7YW 4N23A 3P32A 1MIYA 8ICWA 4I9QA 1H2NA 3JCUZ 4AHCA 4PJ0Z 4X62O 3CCVV 1K7DA 2BCSA 3F5TA 3IGAC 1ZLZA 3DC6A 1QR8A 1MQ2A 5C8YA 4PA9A 4DV2O 3C3SA 4HYOA 4TV9A 4WCEV 3OEEG 3K5OA 1MNGA 3VOUA 4KM5A 4W4LA 1JR9A 4FHYA 4KB6A 3X2QB 4JI6O 1BPYA 1MIWA 5DB6A 9ICAA 4FLTA 2A06H 5HRLA 3MGIA 1GPJA 3JARA 3BHPA 1SQBH 3MCRA 5CHEA 4K97A 2GUZB 4FHVA 4RQ5A 3HX0A
chains in the Genus database with same CATH topology
5J2JA 5J2CA 1KEJA 4K4GA 3HWTA 7ICEA 3B0XA 8ICIA 2ZH5A 4KLUA 4UB4A 8ICMA 4QZFA 4X4SA 3AQNA 3C2KA 5J29A 5HRFA 9ICVA 4WC0A 4NKTA 3JPQA 8ICLA 4XQ7A 4UAZA 4DOCA 7ICSA 4UBBA 5J2EA 5DB7A 1NO5A 1TFYA 3V7KA 1BPBA 3B0YA 4PHAA 5HRDA 1BPDA 3OUYA 1ZQRA 1JN3A 9ICGA 4UBCA 4I29A 3RJIA 5D46A 9ICFA 1BPXA 5DBBA 1ZQWA 1V4AA 9ICQA 3HJ4A 5HRKA 1ZQNA 3RJKA 5IINA 1ZQVA 9ICRA 4I2JA 8ICSA 4M9LA 1ZQDA 1BPEA 3PNCA 7ICFA 3L9DA 1ZQSA 5D49A 4X4VA 3PMLA 4I2CA 5HRHA 4KLMA 2ZH7A 3LQCB 3RH4A 4RPZA 4RQ2A 7ICHA 2FMPA 4X0AA 3H39A 1ZQLA 2DR5A 4YN4A 3PMNA 4I2EA 1VJ7A 4RQ8A 3C2LA 4FHWA 1FA0A 3H37A 4E8FA 1ZQTA 3MBYA 4I2IA 5J0PA 7ICIA 4M9GA 5F2VO 1ZQFA 2M2WA 2DVIA 4AT7B 4YD1A 1ZJNA 4X4RA 3OVBA 4DOAA 8ICPA 4WBZA 4RWOA 3JPTA 9ICOA 4WCWA 9ICNA 5CR0A 5IIOA 2ZH1A 5BOLA 4AT8A 3OVSA 2ZHBA 2ZH2A 4M04A 5BPCA 4RQ3A 8ICZA 4KLEA 5CWRA 3HJ1A 2FMQA 8ICUA 4XA5A 4X4TA 4RWNA 3TFSA 1JQRA 1UEUA 4RQ7A 3JPNA 9ICCA 5IIJA 5HREA 4R66A 4RQ0A 4M9JA 4EBKA 5IILA 7ICNA 4Z6CA 4NKUA 1ZQZA 3OUYB 5J0SA 4RQ6A 4MFFA 4UB1A 3WFSC 3JYYA 2BCQA 1TVAA 4QZIA 5DB9A 5J2DA 3LK9A 5HR9A 4KLJA 4JWNA 4F5OA 5DBAA 2NRKA 4QZEA 8ICCA 5DDMA 1ZQGA 3AUOA 1ZQCA 4XUSA 1MIVA 8ICAA 4QZAA 3WFPA 9ICXA 3UQ2A 9ICMA 4IQUA 2GWSA 4GXJA 7ICKA 1XSLA 4PGYA 4YMNA 5J2FA 3UPSA 4M9HA 4YMOA 4FHVA 4O5CA 4QZBA 4QZ9A 4RWQA 9ICEA 4RQ5A 3JPPA 2I9GA 4TUPA 1XSPA 3H3AA 5D4BA 5J0YA 2ISOA 4P2HA 2PBEA 3RJFA 3UPQA 2ISPA 1R8BA 1JAJA 1TFWA 4I2HA 1NOMA 1ZQYA 8ICVA 8ICQA 4YD2A 2PFNA 4I2AA 9ICTA 4PGXA 1RZTA 8ICKA 4AT8B 2HHPA 4KLGA 1ZQQA 2DR7A 4QZ8A 5CJ7A 4TUSA 9ICPA 4KLHA 3JPRA 4UD4A 4RT3A 1ZQIA 3V72A 5DEDA 2BPGA 4UB5A 1ZQXA 3WFQE 3ISBA 5J0RA 1BPZA 5IIMA 2ZH9A 5EOZA 4IQVA 2PFPA 4DO9A 9ICBA 5HRIA 3AQKA 7ICMA 5J0OA 4UAWA 3AU6A 2RFFA 4M2YA 1R89A 5DB8A 4MFCA 4X0BA 4RT2A 5HRGA 4LT6A 2VANA 3UQ0A 1F5AA 4UAYA 1ZQJA 1ZQBA 7ICUA 4M0AA 4NY8A 7ICRA 1WOTA 4RWPA 2ZH3A 4Z6FA 4NLKA 8ICEA 4JWMA 4LZDA 2BCUA 2BE3A 4EP7A 3V7JA 3UXPA 5CA7A 9ICWA 4F5RA 1UETA 4WC6A 4I2BA 1ZQHA 5TZVA 9ICSA 3JZ0A 5IIKA 2BCRA 7ICQA 3WFOA 4NLNA 2DRBA 4YCXA 3MGHA 5DDYA 2DRAA 1KNYA 4I2FA 5J0XA 8ICNA 4TURA 4Z6EA 4IQWA 4F5NA 5DECA 8ICYA 1UEVA 3AQMA 2PFQA 4RQ1A 4QZGA 4M47A 3H38A 4PHPA 5HHIA 1MQ3A 4KLIA 3K75D 4P4OA 1R8AA 5HRBA 5J2BA 4M9NA 4UB3A 4MFAA 3MDAA 3TFRA 4QZCA 4O9MA 4R65A 4RPXA 5CB1A 1TV9A 4I2DA 5DBCA 3NYBA 7ICVA 5J2IA 3ISCA 2DR8A 2P66A 3JPSA 2ZHAA 5J2KA 1ZJMA 4WC5A 4EBJA 3WFRE 4UD5A 1JMSA 7ICOA 2Q66A 8ICHA 4ATBA 4AT9A 1PX5A 2PXIA 4FHPA 4O5KA 7ICTA 3AQLA 9ICJA 3C18A 1ZQUA 5J0WA 4FH3A 3AU2A 4Z6DA 4KLDA 7ICLA 4YMMA 4F5PA 8ICOA 1ZQOA 4WC7A 4P4PA 5J0QA 3V7LA 4MF8A 4PHDA 2W9MA 4NLZA 2ID1A 8ICFA 5J2HA 4WC1A 8ICXA 4I28A 9ICIA 2ZH6A 3OGUA 8ICRA 1ZQPA 1ZQMA 4R64A 4NM1A 3MDCA 8ICBA 9ICKA 4UB2A 4KLSA 3RJHA 4KLLA 7ICPA 4KLQA 4O5EA 3UXOA 1HUOA 9ICUA 3JPOA 1R8CA 4QZDA 4PPXA 1RPLA 4PGQA 4X4NA 2BCVA 4QZHA 4PHEA 4I2GA 4X4PA 1XSNA 7ICJA 4M5DA 2ZH4A 4LZGA 9ICHA 3GDXA 4RQ4A 5BOMA 4R63A 8ICJA 1KDHA 4KLTA 3RH6A 4X4QA 2BPCA 4WC3A 3OVAA 5DKWA 3RH5A 4LVSA 2O5AA 2M2TA 4I27A 1VFGA 1ZQAA 4K4IA 4XRHA 5HC9A 3RJEA 4GXIA 4KLFA 8ICTA 5CP2A 3RJJA 5IIIA 4F5QA 2FMSA 4X5VA 2M2VA 4RPYA 2DR9A 4NM2A 5J0UA 9ICLA 3C66A 3C5GA 3OV7A 4KLOA 2ZH8A 4FO6A 1ZQKA 4ATBB 4AT9B 1YLQA 4S3NA 4NXZA 2BPFA 4E80A 4IG8A 4WC2A 4GXKA 5CHGA 2M2UA 3C5FA 3C2MA 5J0TA 3UXNA 4K4HA 4WC4A 1MIYA 1Q78A 8ICWA 2PFOA 7ICGA 5HHHA 4E7XA 4PH5A 2BCSA 1Q79A 3HIYA 3ISDA 4XQ8A 1MQ2A 4P4MA 4X4UA 5J2GA 3HW8A 4MF2A 4WBYA 3RJGA 1OU5A 1HUZA 4FHYA 4FHXA 4IQTA 1BPYA 1MIWA 2O1PA 5DB6A 9ICAA 4FH5A 5HRLA 3MGIA 2IHMA 4DOBA 4AT7A 8ICGA 1ZQEA 4TUQA 5J2AA 4X4OA 3HX0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J2J A;  5J2C A;  1KEJ A;  4K4G A;  3HWT A;  7ICE A;  3B0X A;  8ICI A;  2ZH5 A;  4KLU A;  4UB4 A;  8ICM A;  4QZF A;  4X4S A;  3AQN A;  3C2K A;  5J29 A;  5HRF A;  9ICV A;  4WC0 A;  4NKT A;  3JPQ A;  8ICL A;  4XQ7 A;  4UAZ A;  4DOC A;  7ICS A;  4UBB A;  5J2E A;  5DB7 A;  1NO5 A;  1TFY A;  3V7K A;  1BPB A;  3B0Y A;  4PHA A;  5HRD A;  1BPD A;  3OUY A;  1ZQR A;  1JN3 A;  9ICG A;  4UBC A;  4I29 A;  3RJI A;  5D46 A;  9ICF A;  1BPX A;  5DBB A;  1ZQW A;  1V4A A;  9ICQ A;  3HJ4 A;  5HRK A;  1ZQN A;  3RJK A;  5IIN A;  1ZQV A;  9ICR A;  4I2J A;  8ICS A;  4M9L A;  1ZQD A;  1BPE A;  3PNC A;  7ICF A;  3L9D A;  1ZQS A;  5D49 A;  4X4V A;  3PML A;  4I2C A;  5HRH A;  4KLM A;  2ZH7 A;  3LQC B;  3RH4 A;  4RPZ A;  4RQ2 A;  7ICH A;  2FMP A;  4X0A A;  3H39 A;  1ZQL A;  2DR5 A;  4YN4 A;  3PMN A;  4I2E A;  1VJ7 A;  4RQ8 A;  3C2L A;  4FHW A;  1FA0 A;  3H37 A;  4E8F A;  1ZQT A;  3MBY A;  4I2I A;  5J0P A;  7ICI A;  4M9G A;  5F2V O;  1ZQF A;  2M2W A;  2DVI A;  4AT7 B;  4YD1 A;  1ZJN A;  4X4R A;  3OVB A;  4DOA A;  8ICP A;  4WBZ A;  4RWO A;  3JPT A;  9ICO A;  4WCW A;  9ICN A;  5CR0 A;  5IIO A;  2ZH1 A;  5BOL A;  4AT8 A;  3OVS A;  2ZHB A;  2ZH2 A;  4M04 A;  5BPC A;  4RQ3 A;  8ICZ A;  4KLE A;  5CWR A;  3HJ1 A;  2FMQ A;  8ICU A;  4XA5 A;  4X4T A;  4RWN A;  3TFS A;  1JQR A;  1UEU A;  4RQ7 A;  3JPN A;  9ICC A;  5IIJ A;  5HRE A;  4R66 A;  4RQ0 A;  4M9J A;  4EBK A;  5IIL A;  7ICN A;  4Z6C A;  4NKU A;  1ZQZ A;  3OUY B;  5J0S A;  4RQ6 A;  4MFF A;  4UB1 A;  3WFS C;  3JYY A;  2BCQ A;  1TVA A;  4QZI A;  5DB9 A;  5J2D A;  3LK9 A;  5HR9 A;  4KLJ A;  4JWN A;  4F5O A;  5DBA A;  2NRK A;  4QZE A;  8ICC A;  5DDM A;  1ZQG A;  3AUO A;  1ZQC A;  4XUS A;  1MIV A;  8ICA A;  4QZA A;  3WFP A;  9ICX A;  3UQ2 A;  9ICM A;  4IQU A;  2GWS A;  4GXJ A;  7ICK A;  1XSL A;  4PGY A;  4YMN A;  5J2F A;  3UPS A;  4M9H A;  4YMO A;  4FHV A;  4O5C A;  4QZB A;  4QZ9 A;  4RWQ A;  9ICE A;  4RQ5 A;  3JPP A;  2I9G A;  4TUP A;  1XSP A;  3H3A A;  5D4B A;  5J0Y A;  2ISO A;  4P2H A;  2PBE A;  3RJF A;  3UPQ A;  2ISP A;  1R8B A;  1JAJ A;  1TFW A;  4I2H A;  1NOM A;  1ZQY A;  8ICV A;  8ICQ A;  4YD2 A;  2PFN A;  4I2A A;  9ICT A;  4PGX A;  1RZT A;  8ICK A;  4AT8 B;  2HHP A;  4KLG A;  1ZQQ A;  2DR7 A;  4QZ8 A;  5CJ7 A;  4TUS A;  9ICP A;  4KLH A;  3JPR A;  4UD4 A;  4RT3 A;  1ZQI A;  3V72 A;  5DED A;  2BPG A;  4UB5 A;  1ZQX A;  3WFQ E;  3ISB A;  5J0R A;  1BPZ A;  5IIM A;  2ZH9 A;  5EOZ A;  4IQV A;  2PFP A;  4DO9 A;  9ICB A;  5HRI A;  3AQK A;  7ICM A;  5J0O A;  4UAW A;  3AU6 A;  2RFF A;  4M2Y A;  1R89 A;  5DB8 A;  4MFC A;  4X0B A;  4RT2 A;  5HRG A;  4LT6 A;  2VAN A;  3UQ0 A;  1F5A A;  4UAY A;  1ZQJ A;  1ZQB A;  7ICU A;  4M0A A;  4NY8 A;  7ICR A;  1WOT A;  4RWP A;  2ZH3 A;  4Z6F A;  4NLK A;  8ICE A;  4JWM A;  4LZD A;  2BCU A;  2BE3 A;  4EP7 A;  3V7J A;  3UXP A;  5CA7 A;  9ICW A;  4F5R A;  1UET A;  4WC6 A;  4I2B A;  1ZQH A;  5TZV A;  9ICS A;  3JZ0 A;  5IIK A;  2BCR A;  7ICQ A;  3WFO A;  4NLN A;  2DRB A;  4YCX A;  3MGH A;  5DDY A;  2DRA A;  1KNY A;  4I2F A;  5J0X A;  8ICN A;  4TUR A;  4Z6E A;  4IQW A;  4F5N A;  5DEC A;  8ICY A;  1UEV A;  3AQM A;  2PFQ A;  4RQ1 A;  4QZG A;  4M47 A;  3H38 A;  4PHP A;  5HHI A;  1MQ3 A;  4KLI A;  3K75 D;  4P4O A;  1R8A A;  5HRB A;  5J2B A;  4M9N A;  4UB3 A;  4MFA A;  3MDA A;  3TFR A;  4QZC A;  4O9M A;  4R65 A;  4RPX A;  5CB1 A;  1TV9 A;  4I2D A;  5DBC A;  3NYB A;  7ICV A;  5J2I A;  3ISC A;  2DR8 A;  2P66 A;  3JPS A;  2ZHA A;  5J2K A;  1ZJM A;  4WC5 A;  4EBJ A;  3WFR E;  4UD5 A;  1JMS A;  7ICO A;  2Q66 A;  8ICH A;  4ATB A;  4AT9 A;  1PX5 A;  2PXI A;  4FHP A;  4O5K A;  7ICT A;  3AQL A;  9ICJ A;  3C18 A;  1ZQU A;  5J0W A;  4FH3 A;  3AU2 A;  4Z6D A;  4KLD A;  7ICL A;  4YMM A;  4F5P A;  8ICO A;  1ZQO A;  4WC7 A;  4P4P A;  5J0Q A;  3V7L A;  4MF8 A;  4PHD A;  2W9M A;  4NLZ A;  2ID1 A;  8ICF A;  5J2H A;  4WC1 A;  8ICX A;  4I28 A;  9ICI A;  2ZH6 A;  3OGU A;  8ICR A;  1ZQP A;  1ZQM A;  4R64 A;  4NM1 A;  3MDC A;  8ICB A;  9ICK A;  4UB2 A;  4KLS A;  3RJH A;  4KLL A;  7ICP A;  4KLQ A;  4O5E A;  3UXO A;  1HUO A;  9ICU A;  3JPO A;  1R8C A;  4QZD A;  4PPX A;  1RPL A;  4PGQ A;  4X4N A;  2BCV A;  4QZH A;  4PHE A;  4I2G A;  4X4P A;  1XSN A;  7ICJ A;  4M5D A;  2ZH4 A;  4LZG A;  9ICH A;  3GDX A;  4RQ4 A;  5BOM A;  4R63 A;  8ICJ A;  1KDH A;  4KLT A;  3RH6 A;  4X4Q A;  2BPC A;  4WC3 A;  3OVA A;  5DKW A;  3RH5 A;  4LVS A;  2O5A A;  2M2T A;  4I27 A;  1VFG A;  1ZQA A;  4K4I A;  4XRH A;  5HC9 A;  3RJE A;  4GXI A;  4KLF A;  8ICT A;  5CP2 A;  3RJJ A;  5III A;  4F5Q A;  2FMS A;  4X5V A;  2M2V A;  4RPY A;  2DR9 A;  4NM2 A;  5J0U A;  9ICL A;  3C66 A;  3C5G A;  3OV7 A;  4KLO A;  2ZH8 A;  4FO6 A;  1ZQK A;  4ATB B;  4AT9 B;  1YLQ A;  4S3N A;  4NXZ A;  2BPF A;  4E80 A;  4IG8 A;  4WC2 A;  4GXK A;  5CHG A;  2M2U A;  3C5F A;  3C2M A;  5J0T A;  3UXN A;  4K4H A;  4WC4 A;  1MIY A;  1Q78 A;  8ICW A;  2PFO A;  7ICG A;  5HHH A;  4E7X A;  4PH5 A;  2BCS A;  1Q79 A;  3HIY A;  3ISD A;  4XQ8 A;  1MQ2 A;  4P4M A;  4X4U A;  5J2G A;  3HW8 A;  4MF2 A;  4WBY A;  3RJG A;  1OU5 A;  1HUZ A;  4FHY A;  4FHX A;  4IQT A;  1BPY A;  1MIW A;  2O1P A;  5DB6 A;  9ICA A;  4FH5 A;  5HRL A;  3MGI A;  2IHM A;  4DOB A;  4AT7 A;  8ICG A;  1ZQE A;  4TUQ A;  5J2A A;  4X4O A;  3HX0 A; 
#chains in the Genus database with same CATH topology
 4Z2W A;  2X7R B;  2Q67 A;  1SF9 A;  5A9G A;  4G27 B;  3ETD A;  2FYU H;  4TUY B;  4NXW A;  4K4G A;  4GX5 A;  3WFV A;  5KMG A;  3B0X A;  3T4D A;  3CCM V;  2H8P C;  3VBB A;  3HKE B;  3HKB B;  1M57 C;  3TJT A;  5JQG B;  1THZ A;  3C2K A;  1V9P A;  3G4S V;  3Q4H B;  5ITZ A;  5HRF A;  4ZOL B;  2YIC A;  8ICL A;  2YI9 A;  4XQ7 A;  2JDI G;  5H6Q A;  2LJ2 A;  5J2E A;  3M8A A;  4FK5 C;  3B0Y A;  2VQF B;  4O67 A;  5HRD A;  1JN3 A;  1P4R A;  4J7J A;  4WBN B;  3RJI A;  2CUG A;  1W59 A;  4DO2 A;  4O4J B;  3T4Z A;  4UCT A;  1BPX A;  5H9C A;  3P3P A;  2W0X A;  4PDR A;  3OWG A;  1JFF B;  9ICQ A;  5JCO A;  1VQ7 V;  4DR3 B;  1JPX A;  2GUZ A;  2QE7 G;  3TXS A;  3CC7 V;  3R65 A;  5B1A C;  1R3J C;  2GV9 A;  4KHP O;  3T1H B;  4TSF G;  3JD2 A;  2N04 A;  3ABT A;  7ICF A;  1EN6 A;  2QM8 A;  1FFT B;  4I2C A;  4AQY O;  3JAS A;  3RVZ A;  3HKE A;  5HRH A;  4I9W A;  4I55 B;  2L35 A;  5JQG A;  2P7T C;  2FMP A;  1Z5W A;  3PMN A;  1HNW O;  2YC0 A;  2AZ0 A;  4UFZ A;  4MVM A;  4FLX A;  4B3R O;  4DV3 O;  1S5H C;  1UJW B;  3I56 V;  4UB8 Z;  1K4D C;  2IJH A;  1ZQT A;  3DC5 A;  3EHB B;  1H2K A;  1EM1 A;  3CX5 F;  1NR1 A;  4DV4 O;  2DVI A;  2UXX A;  2M2W A;  4AT7 B;  5IYZ A;  3A0B Z;  4WBN A;  4X4R A;  2N74 A;  1YTF D;  8ICP A;  4WBZ A;  4B3M B;  4LFA B;  4NXN B;  3E89 A;  2F93 B;  2EIJ B;  1OCR C;  3OVS A;  2GA9 D;  5B5E Z;  4RQ3 A;  3RN4 A;  3HJ1 A;  1PNL A;  1GM9 A;  3TFS A;  4CH3 A;  1G4Y B;  4RQ7 A;  5E79 Z;  4QPK A;  1FKA O;  4RQ0 A;  1B04 A;  1KUQ A;  2Y69 B;  3K06 A;  4EBK A;  3QF7 A;  1K92 A;  4I55 A;  5K1P A;  1Q8I A;  2B9Z A;  5LL6 Y;  5IIL A;  7ICN A;  1AR5 A;  5JJJ B;  2Q4P A;  1SA0 B;  2PZS A;  1VF6 A;  4O4I A;  3OUY B;  1NJI W;  3H01 A;  2W6J G;  2Y0P A;  5KLV H;  3EF2 A;  2DWE C;  3LK9 A;  5J2D A;  1BQ0 A;  3LNM B;  5D62 A;  4KLJ A;  1Q6U A;  2A7W A;  3SPG A;  2B1G A;  2NRK A;  2GTA A;  3IC7 A;  1Q86 W;  4DW1 A;  4MTO A;  5DDM A;  4IIJ B;  1AP5 A;  2DOS A;  3H1I H;  4XUS A;  1F7Y A;  5EBL C;  1KQS U;  5FPR A;  4LP8 A;  3W7W A;  3WFP A;  4QZA A;  2ZIN A;  3AK3 A;  1XEQ A;  1V55 C;  4PA6 A;  1AJN A;  4IHJ A;  1RPO A;  3ZMZ A;  4B7K A;  4K0K O;  3HPL C;  3MAQ A;  3UCS C;  4GXJ A;  2CH7 A;  4ASU G;  1B6Q A;  1MA1 A;  3C90 A;  2B56 A;  3UPS A;  3K08 A;  4LF4 B;  3S3W A;  1VQL V;  2RMK B;  4O5C A;  5CMU A;  2DQ0 A;  4X88 A;  3TXQ A;  1RM1 B;  2V7Q G;  4LEV A;  5FL7 G;  5J2U B;  1SA0 A;  1WB7 A;  2B51 A;  2ISO A;  4RAI A;  4P2H A;  2PBE A;  4J7K A;  2R72 A;  2W6I G;  3T1Y B;  4EGW A;  1JAJ A;  4DR7 B;  2XHB A;  1ZQY A;  8ICV A;  4YD2 A;  1Y6X A;  5L3B A;  4PGX A;  5KUK A;  4YIO A;  1P7G A;  2IJI A;  4AT8 B;  1QR9 A;  1ZQQ A;  2DR7 A;  2MK3 A;  5CJ7 A;  4IIJ A;  4LWS B;  5KHJ A;  4KLH A;  3JPR A;  1R3K C;  4P9O A;  1N34 B;  3PHZ A;  5LHG A;  4WF9 V;  3KG2 A;  3V72 A;  2LW1 A;  1XL4 A;  5KHG A;  4K35 A;  3OTO O;  2F4V B;  3ISB A;  4JI5 O;  1BPZ A;  5JJN B;  3BA9 A;  4QE7 A;  4IQV A;  4DO9 A;  2ZE5 A;  2QM4 A;  4ABM A;  4UAW A;  3AU6 A;  5EIB C;  4M2Y A;  3RYC B;  1H38 A;  4EFB A;  3KZI Z;  4JGS A;  3AG4 C;  2VQE B;  5LMN O;  1IVS A;  4WQL A;  1D5A A;  4NR1 A;  1N32 O;  3E8F A;  4LT6 A;  2VAN A;  3UQ0 A;  5IT9 N;  2NNU A;  5LGN A;  1DTO A;  1I08 A;  3K0D A;  3RWR D;  4M0A A;  4NY8 A;  1GKF A;  1HDJ A;  3GWO A;  2ZH3 A;  1AR1 B;  8ICE A;  4JWM A;  1SZX A;  3OFN G;  4JAA A;  2BE3 A;  1H8H G;  4PV1 B;  2NR5 A;  4TOI A;  3OR6 C;  4LWS A;  5CA7 A;  1W0J G;  3W7U A;  4MSW C;  4K9A A;  1UET A;  4JAS A;  4WC6 A;  4I2B A;  1GRJ A;  7ICQ A;  1H2L A;  4UVC A;  3WFO A;  1QLE B;  3OAA G;  1QQC A;  1VQK V;  1R6T A;  2WLI B;  5J0X A;  1IBK O;  8ICN A;  2FTK A;  1TAE A;  3ASN C;  1LR1 A;  3GB7 C;  4IQW A;  2HP8 A;  3UQ8 A;  1VQM V;  1NR7 A;  4DV1 B;  3RYC A;  3AQM A;  5JVD B;  1N8R W;  4JLZ A;  3H38 A;  4EEB A;  1MQ3 A;  4P4O A;  4WFG A;  3P3N A;  3ZBH A;  2ZIO A;  4M9N A;  3SYO A;  1P7B A;  3MDA A;  3TFR A;  1ZWI C;  1E1Q G;  5IY5 B;  1F4M A;  3OTO B;  5CB1 A;  1PNM A;  3QO5 A;  7ICV A;  5J2I A;  1X4T A;  2DR8 A;  3CCS V;  3JPS A;  1HP8 A;  3PJS K;  2ARH A;  5KA5 A;  2ZHA A;  5J2K A;  4LF6 B;  3DXR B;  1H2S B;  2E74 B;  4EBJ A;  4UD5 A;  3SJB C;  7ICO A;  2YI8 A;  5LA6 A;  4AT9 A;  1PX5 A;  2PXI A;  3ZN0 A;  1NVP B;  3AQL A;  1YJN V;  1XHZ A;  3AU2 A;  1K73 W;  2IM9 A;  3FYI B;  5CFU A;  4EED A;  3BVO A;  3V7L A;  3STZ C;  2ID1 A;  4X9Q A;  4N7R A;  4MVZ A;  3BPZ A;  3CCQ V;  4OAF A;  5JVD A;  2JIZ G;  3HB3 B;  1FD9 A;  3O9O A;  4PA7 A;  1US6 A;  9ICK A;  4UB2 A;  2YEV B;  4IYI A;  1XMQ B;  5D5Q A;  3KCX A;  4NXV A;  4O5E A;  2QEX V;  1X59 A;  1XDC A;  1PKX A;  5KAF Z;  3CCJ V;  1W2B U;  2RN9 A;  3OMI B;  3L70 H;  4PHE A;  2HHH O;  4IL6 Z;  2F43 G;  1SQG A;  1H8E G;  3DXR A;  3B09 A;  2QSA A;  2DYS C;  5BY1 A;  3G80 A;  2RQ6 A;  4RQ4 A;  5B1B C;  1R1B A;  8ICJ A;  2IU3 A;  4EV6 A;  2ZT9 B;  3STL C;  2ZR2 A;  2JEU A;  4O2B B;  3JD0 A;  2BPC A;  5LOV B;  3W7S A;  3LSQ A;  2FL4 A;  1VFG A;  1QLN A;  3U0Z A;  4Q20 A;  5HC9 A;  1YIJ V;  3CK6 A;  4KLF A;  4O4L A;  1VQ8 V;  4GUN A;  4UVA A;  3RJJ A;  1YSC A;  4GCZ A;  4LF7 B;  2YEV A;  4FLU A;  2ITC C;  2ZNJ A;  4DRX B;  4RPY A;  4NM2 A;  9ICL A;  4JI2 O;  3C5G A;  3OV7 A;  5B3P A;  4PDL A;  2ZH8 A;  4HAM A;  2BTQ B;  4PDV A;  2QWO B;  1KD1 W;  4NXT A;  1O9H A;  4HZ3 A;  5CA0 B;  4WC2 A;  4GXK A;  2M2U A;  3C5F A;  3CHX A;  3C2M A;  5J0T A;  2IJJ A;  5J9P C;  2JEX A;  2QDO A;  4GX1 A;  4LF8 B;  1SER A;  3NKU A;  2EJR A;  5HHH A;  2OCH A;  4PH5 A;  3HIY A;  5LOV A;  2ZR3 A;  4WFA V;  4P4M A;  3K3W A;  4K9B A;  3SR2 C;  5J2G A;  3HW8 A;  3SYC A;  1NBM G;  4WBY A;  1SS3 A;  2MW2 B;  3MHH C;  4JYB A;  1AIL A;  3MHS C;  2IW5 A;  4BW9 A;  4FHX A;  2KKW A;  1N36 B;  4RQF A;  1T5E A;  2IU0 A;  4DRX A;  1GM8 A;  1PD3 A;  3TGU H;  4B3S O;  3E2E A;  5L3F A;  1ZX3 A;  3E83 A;  2FB5 A;  3AG2 C;  2FCL A;  5IYB O;  4FM0 A;  7ICJ A;  2ZD9 A;  4TT3 G;  5CA0 A;  3APQ A;  3IFX A;  1KEJ A;  4GKK B;  2E5L O;  7ICE A;  1K4C C;  4DV6 O;  4PA4 A;  2ZIM A;  4LEY A;  1VEW A;  2ETN A;  3ER9 B;  2YSU B;  2RDC A;  2WLJ A;  2EUL A;  3K57 A;  1VQ4 V;  3AQN A;  4UCO A;  2DN9 A;  4JI3 B;  3JPQ A;  1OZ0 A;  2X6A A;  3VQX A;  4E4E A;  1AJQ A;  1Q82 W;  1Z5V A;  2JGU A;  4UAZ A;  7ICS A;  2LP7 A;  5L3D A;  2QKS A;  4HBN A;  5CFS A;  1BPB A;  3HKD B;  1ZQR A;  4BW5 A;  4U3J B;  4I0X B;  4I29 A;  1MZF A;  4I50 B;  2YIA A;  4JI0 O;  4GT1 A;  9ICF A;  2HFE C;  1JA8 A;  2GBO A;  1IXM A;  4UV8 A;  5B1N A;  3OE7 G;  1V54 C;  1OCR B;  3LNN A;  4O4H A;  1ZQN A;  3RJK A;  4LCU C;  5CB4 B;  1HNZ O;  2WA4 A;  3CP1 A;  3MD0 A;  2Y4T A;  4I2J A;  3BFR A;  4K3A A;  3PNC A;  2ADP A;  4JI4 O;  3PML A;  2VWK A;  4JV5 O;  4JAU A;  4MT8 A;  4DR1 B;  2IHO A;  4YJ3 B;  4K8Z A;  4RPZ A;  3ABK C;  1P49 A;  4JYY A;  3K5L A;  4X0A A;  4LFC O;  5D63 A;  1S77 D;  1ZQL A;  4PI0 A;  1RSO A;  1N4C A;  4NVP A;  4I2E A;  4UCR A;  1ARO P;  1YVW A;  2PY5 A;  1FA0 A;  1KYO F;  3H37 A;  3RGB A;  1Q3E A;  5J0P A;  2Q9L A;  4UCS A;  3NWI A;  7ICI A;  5KAI Z;  1TGO A;  4M9G A;  3HKD A;  2OIE A;  2QKC A;  3LSU A;  3OTF A;  1U96 A;  4I50 A;  1IBL O;  4RWO A;  2DMX A;  3CYO A;  4NYK A;  4YXW G;  2BOB C;  4R6Z A;  4X66 B;  2GSM B;  5IIO A;  2ZH1 A;  5BOL A;  4GYC B;  3ZRW A;  1V55 B;  5KMG B;  5BPC A;  2ZHB A;  2ZH2 A;  4JI8 B;  5CB4 A;  4KLE A;  4H44 B;  1CXZ B;  5JH7 A;  8ICU A;  4DK1 A;  4RWN A;  4JAV A;  4FZ1 A;  4ZKI A;  3CJH B;  4JLX A;  3JPN A;  5IWA B;  2HEP A;  4WFE A;  5IIJ A;  5ITZ B;  2E3C A;  5HRE A;  4R66 A;  4M9J A;  3B4S A;  3ZHV A;  3FB5 C;  2UUA B;  3AK1 A;  4XDL A;  3R66 A;  4D7T A;  3B2E E;  4YJ3 A;  1E79 G;  1FAF A;  1KKC A;  2UXN A;  3FYE B;  4J9Z B;  4E2L A;  3JAT A;  1ZQZ A;  2JRI A;  5FNV A;  4AIL C;  4I4T A;  1BZK A;  5J0S A;  2VS0 A;  3JYY A;  2BCQ A;  5GON B;  4QZI A;  4RUE A;  3G67 A;  3QNE A;  4LF9 O;  1FXK C;  3K0G A;  4MTF A;  5DBA A;  4QZE A;  4DR4 O;  5LP6 A;  8ICC A;  5CN0 A;  5BR8 B;  1NVP D;  4LF5 O;  5GTI Z;  1ZQC A;  8ICA A;  3H9V A;  1S0V A;  3SJA C;  4JI1 O;  9ICM A;  3JAS B;  1KP3 A;  1XOU A;  3JD3 A;  4DR2 B;  2ADQ B;  5IYC O;  3ZS8 C;  1M56 C;  3CJH A;  4PGY A;  4MVS A;  2R9R B;  2ZM6 O;  2P67 A;  4M9H A;  4LH7 A;  3RYH A;  4B3T B;  1JOY A;  2UXB B;  1WP8 A;  1EN5 A;  1VP7 A;  2YIB D;  1FS0 G;  4OX9 O;  3H3A A;  4JYA O;  3AG4 B;  5D4B A;  4X1Y A;  5J0Y A;  3RJF A;  4FVM A;  5IYZ B;  4YY3 O;  1R8B A;  5TIS Z;  5GON A;  1NOM A;  8ICQ A;  2A0L A;  4I2A A;  4QIW F;  3KCY A;  2B4V A;  5K1X A;  8ICK A;  3L71 H;  4KLG A;  1A32 A;  4X62 B;  4Q6G A;  1AI6 A;  4BIU A;  4QZ8 A;  1FXH A;  4TUS A;  1AP6 A;  9ICP A;  2IH3 C;  4DV2 B;  1KU9 A;  4RT3 A;  4X64 O;  5DED A;  1PNK A;  3UO2 A;  2EWR A;  2BPG A;  4UCU A;  1BGY H;  4X89 A;  4PD4 F;  4UB5 A;  1BT8 A;  4X65 O;  2XOK G;  5JJE B;  3ZIA G;  1FPO A;  4JI6 B;  3TK1 A;  1XUQ A;  2ZH9 A;  3ICX A;  5EOZ A;  4O4I B;  3AQK A;  5J0O A;  4MS2 A;  3ZCC A;  3CRR A;  4X1K B;  2RFF A;  2P06 A;  1S3J A;  3WU2 Z;  1OCO C;  1SQV H;  5DB8 A;  2A9H A;  1OCZ C;  2P6J A;  4JYC A;  3DTU B;  5HRG A;  3LDD A;  5B1O A;  1FXV A;  1URF A;  2E75 B;  1ZQJ A;  7ICU A;  1WB8 A;  1PL4 A;  2QKA A;  4H0L B;  2WWW A;  2E76 B;  4Z1M G;  4RWP A;  3ETE A;  4PA3 A;  1XNQ O;  4NLK A;  4PHZ A;  4IHJ B;  3C3T A;  4NXX A;  4EP7 A;  2RNB A;  2JS5 A;  3B77 A;  2CH7 B;  4K8X A;  4F5R A;  1PM9 A;  2XAQ A;  4K98 A;  1M1K W;  1ZQH A;  1RP3 B;  4MW8 A;  3DSQ A;  9ICS A;  5GTH Z;  2RCV A;  3ZED A;  2LFR A;  4TQF A;  2DRA A;  4J11 A;  1S72 V;  4DW0 A;  1KNY A;  1WP7 A;  4DK0 A;  4I2F A;  4RO2 A;  5IYD O;  2UXC O;  4TUR A;  4WFF A;  4F5N A;  3CB2 A;  5DEC A;  3HR0 A;  4L8J A;  4X1K A;  2JK5 C;  4KL1 A;  3UKM A;  2Q5Z A;  4PHP A;  4KHP B;  5LP6 C;  1R8A A;  2OIG A;  4CS2 A;  4NTY A;  4MFA A;  4DV7 O;  4QZC A;  4O9M A;  3JD1 A;  4AQY B;  4I2D A;  1J5E O;  3CMA V;  3JD4 A;  2UXD O;  4OAI Z;  1ZJM A;  1HNW B;  5B3S B;  4B3R B;  1N0J A;  4DV3 B;  3W7T A;  1N0N A;  1JMS A;  2DYS B;  2EX3 A;  8ICH A;  4ATB A;  1WLE A;  2Q7E A;  2CTW A;  4FHP A;  1MAB G;  3LDE A;  4UXN A;  1ZQU A;  4DV4 B;  4FH3 A;  4JI7 O;  2NLJ C;  1L0L H;  4LFB O;  4YMM A;  4F5P A;  3CSX A;  1GM7 A;  2XTA A;  4TQD A;  5EC1 C;  2W9M A;  5IJ9 B;  1WPX A;  4QE9 A;  3OUF A;  2LQT A;  4P9P A;  2EIN C;  4I0U A;  4I28 A;  9ICI A;  3OGU A;  2OYQ A;  1I94 O;  4R64 A;  3IAY A;  4XBF A;  2Z0A A;  1TUB B;  3ZX6 A;  4DUY O;  1HWY A;  3CRQ A;  3OD4 A;  8ICB A;  1K9M W;  3RYF B;  1IBM O;  4KLQ A;  3UXO A;  2YXY A;  1HNX O;  1DF5 A;  1ROP A;  1GAX A;  1RPL A;  2OWO A;  4X4N A;  2BCV A;  4CC6 A;  3N2G B;  4I2G A;  4IGG A;  4B08 A;  1XSN A;  2WAM A;  2UU9 O;  2ZH4 A;  4WFH A;  2Q0A A;  9ICH A;  3K5N A;  3A0R A;  4UUJ C;  2WSS G;  4DV5 O;  5JTG A;  2P90 A;  4MVU A;  1Y66 A;  1YIT V;  3AK2 A;  4LVS A;  2X6B A;  2Y48 A;  4KFM A;  2M2T A;  2Q68 A;  5LGT A;  1ZQA A;  4PDM A;  5IJ9 A;  2IJK A;  4XRH A;  4K4I A;  3TCU A;  3AEI A;  3GVM A;  1IZ3 A;  2ZNI A;  4K0K B;  1MSW D;  5CP2 A;  4JF3 A;  5FLX N;  1TUB A;  3DGE A;  1KEC A;  4X5V A;  3RYF A;  1YCI A;  2D2C B;  2DR9 A;  2EJ7 A;  1ORQ C;  5J0U A;  4JPR A;  5H5N A;  2A79 B;  2CK3 G;  3D3Q A;  4MTG A;  5LA6 B;  4AT9 B;  2Y4U A;  1ZAU A;  1YLQ A;  3N2G A;  4NXZ A;  2BPF A;  3MDS A;  4DR6 O;  5D61 A;  4E80 A;  3U10 A;  5HFM A;  4FO1 A;  3J81 N;  2QR4 A;  3SPC A;  3B8N A;  1Q78 A;  3JAW B;  5KUM A;  1NZ6 A;  5LMU O;  5CA3 A;  4E7X A;  4DUZ O;  2WLK A;  4ZI7 B;  2RJZ A;  4EKW A;  2CGO A;  3ZJZ A;  4X4U A;  2EIM C;  4YHH O;  1M5I A;  1BS3 A;  2F95 B;  2HJF C;  2IH1 C;  4OPA A;  4KUM A;  1WAZ A;  1XMO O;  1OU5 A;  3FAV B;  3F5W C;  4JI5 B;  1DK1 A;  4G2K A;  4IQT A;  2JGD B;  1L8D A;  4QPJ A;  3K5M A;  3AG7 A;  2O1P A;  4GKJ O;  2IBZ H;  4FH5 A;  1UFI A;  2DWD C;  2IHM A;  1AI5 A;  2HR3 A;  1V54 B;  3H1J H;  1M4U A;  5LMN B;  8ICG A;  4TUQ A;  1N32 B;  3A8T A;  1SKV A;  4D7S A;  1N33 O;  2UUB O;  2ZDI C;  2V1D A;  3UO3 A;  1XNR O;  4CH4 A;  5J2C A;  3OR7 C;  1SC5 B;  1GTO A;  3CEI A;  3HWT A;  2ZH5 A;  3S3X A;  4K96 A;  2YXL A;  4NXM O;  3JAW A;  3BEH A;  4K8V A;  4UB4 A;  8ICM A;  4QZF A;  4O4L B;  2KB1 A;  4J42 A;  4ZI7 A;  9ICV A;  4WC0 A;  2XAG A;  3BAB A;  5EYP B;  2Y69 C;  4EEQ A;  1YEW A;  2EBO A;  3ABL C;  3UT5 B;  4CS4 A;  1TFY A;  4EFE A;  1CPY A;  3FAV A;  3V7K A;  2YDE A;  4BAY A;  1BPD A;  3JAK B;  4UBC A;  4J10 A;  3ZHU A;  2M7W A;  5LHH A;  2JGD A;  2ZE8 A;  4LR3 A;  1IBK B;  5D46 A;  5DBB A;  2CGN A;  4RWU A;  4F6R B;  1JCH A;  3B40 A;  1V4A A;  4J41 A;  5HRK A;  2ILM A;  3E8B A;  2FML A;  2R70 A;  5IIN A;  1ZQV A;  1AI7 A;  1LUV A;  1BQZ A;  2PF4 E;  4NTW A;  1JVM A;  2HKO A;  1BPE A;  4GZR B;  2R9A A;  3L9D A;  1ZQS A;  5D49 A;  2WLH A;  4KLM A;  3LQC B;  5KX5 A;  2CDY A;  1FJG O;  1Y76 A;  2HN2 A;  4K99 A;  5BZB A;  2UUC O;  3H39 A;  2DR5 A;  4YN4 A;  5EYP A;  3ZHQ A;  1RM1 C;  3RW0 A;  1VJ7 A;  4RQ8 A;  3C2L A;  4FHW A;  1GN2 A;  2QM7 A;  1WA8 A;  4LH6 A;  3UT5 A;  5IJ0 B;  4I2I A;  2PI4 A;  3K59 A;  5F2V O;  2HJD A;  3JAK A;  4YD1 A;  3CRC A;  3OVB A;  1KP2 A;  1KKD A;  3B8M A;  1ZL8 B;  5GW7 A;  5LYJ B;  3JPT A;  4F6R A;  1CP9 A;  1FFX B;  4WCW A;  4UVB A;  9ICN A;  5CR0 A;  1PPJ H;  1SQX H;  2KG7 A;  1XIL A;  3AG1 C;  2H94 A;  8ICZ A;  5CWR A;  2FMQ A;  1XRE A;  2ZCE A;  1M57 B;  1M56 B;  4P30 A;  4TV8 A;  2QWN B;  4MTX A;  1NH2 B;  2QWQ B;  2DW4 A;  4YJ2 A;  3EFF K;  3BY6 A;  4KP4 A;  3BRC A;  3SGI A;  1JQ0 A;  4DXW A;  3SYQ A;  3ZMU A;  4Z6C A;  2HHH B;  4U7O A;  2AZ2 A;  4HX0 A;  1EBO A;  4RQ6 A;  1AJP A;  1OHH G;  3AG3 C;  3WFS C;  5EBW C;  5B66 Z;  1TVA A;  1YJ9 V;  5DB9 A;  2B5U A;  5HR9 A;  4DR5 O;  3OEH G;  4JWN A;  2BOC C;  2QGN A;  1FXK A;  5IJ0 A;  4F5O A;  2Q69 A;  4O4H B;  3FB7 C;  1ZQG A;  4IT5 A;  1NU1 H;  3SPJ A;  3HKC B;  1ZL8 A;  5LGU A;  5B1A B;  5LYJ A;  1K34 A;  2ODM A;  3M99 B;  1FFX A;  3K7D A;  9ICX A;  1GMG A;  2ATK C;  3CC4 V;  4LEZ A;  4X1I B;  1VQN V;  4OPH A;  3ZHT A;  4DV0 O;  2GHY A;  1XSL A;  3D3I A;  3ZMV A;  4NKG B;  4YMN A;  1BSM A;  5J2F A;  4BWA A;  1GN4 A;  5L3G A;  4JI2 B;  1IDS A;  1Q81 W;  1RSO B;  4QZB A;  4CH5 A;  2I9G A;  4TUP A;  1OCO B;  1OCZ B;  5IDJ A;  3NXS A;  3SYP A;  3RFR A;  3UPQ A;  1HR0 O;  4UCV A;  3NVO A;  2WLM A;  2O57 A;  9ICT A;  1F23 A;  1MOF A;  1RZT A;  1NTK H;  2OCC C;  3ZRW B;  1WPB A;  2OT5 A;  2QWR B;  2DJV A;  2YXH A;  4BIZ A;  5JH7 B;  3J7A U;  5IY5 C;  3HKC A;  4R8C A;  3ZMT A;  1K3E A;  5EBM C;  1K5Q A;  4AI8 A;  1ZQI A;  3FB8 C;  4BIO A;  1VQP V;  4X1I A;  1BCC H;  3D8C A;  5CBG A;  3CPW U;  5BXZ A;  5LHI A;  5IIM A;  1YJW V;  2H3O A;  2Q7H A;  3F7Y C;  2PFP A;  3JAT B;  5FNV B;  1AR4 A;  4GX2 A;  4I4T B;  4B3S B;  7ICM A;  2WA3 A;  3JAL B;  1TVK A;  1XBL A;  1R89 A;  4MFC A;  3WG7 C;  4QNH B;  3J80 N;  4RT2 A;  1BHA A;  1G6U A;  1I0H A;  2XND G;  4UAY A;  5LP6 B;  1ZQB A;  3CCE V;  2E5L B;  1TA8 A;  2YUA A;  4DV6 B;  1Z2G A;  2K1E A;  1B3Q A;  1MZE A;  1WOT A;  4Z6F A;  3ZMS A;  3ETQ A;  1ZUQ A;  3KKY A;  4LZD A;  3F7V C;  3VQW A;  1ZSP A;  3ABM C;  1XHX A;  9ICW A;  1VQ9 V;  2VRZ A;  5TZV A;  2BSK B;  5EC2 C;  3RYH B;  2EIL C;  2DRB A;  2JJ2 G;  1OCC C;  1SQP H;  2NN4 A;  4C7U A;  2VQF O;  4MKP A;  2G38 A;  3ETG A;  4JI0 B;  2EIK C;  4X1Y B;  4JTA B;  5D5P A;  3BA8 A;  5B3Q A;  3ZHS A;  3JAL A;  1S5J A;  4OGQ B;  1UEV A;  4FMT A;  5DN6 G;  4DR3 O;  4RQ1 A;  2EIN B;  2LO1 A;  1VF7 A;  1HNZ B;  4QZG A;  1VIB A;  2JJ1 G;  5HHI A;  5CBH A;  3K75 D;  3T1H O;  5J2B A;  3ASO C;  3H1K H;  4F6E A;  2ZE7 A;  2CE4 A;  4LNU B;  4R65 A;  4JI4 B;  4JV5 B;  1VQO V;  4RPX A;  5DM6 V;  2DQ3 A;  5DBC A;  3IJ4 A;  4F4L A;  3ISC A;  1Q6I A;  2AHY A;  2P66 A;  2N05 A;  4LFC B;  1QVG U;  4WC5 A;  5C93 A;  1O9G A;  4ZBM A;  4ZIB A;  3WFR E;  1YZB A;  2P4K A;  1NS1 A;  2Q66 A;  4I5S A;  1IXB A;  2BSK A;  1BE3 H;  2PTM A;  1AB3 A;  4FFB B;  3C18 A;  5J0W A;  1M90 W;  5HFL A;  4Z6D A;  2ZE6 A;  1L1F A;  7ICL A;  3D36 C;  5KA6 A;  1S5L Z;  2ITD C;  1BMF G;  4O2A B;  4WC7 A;  4N21 A;  1IBL B;  4B3M O;  1GO3 F;  5J0Q A;  4LFA O;  4H37 A;  2DYR C;  5CBF A;  1XI1 A;  3ZN1 A;  4NXN O;  5J2H A;  4WC1 A;  1JX9 A;  2QTO A;  2ZH6 A;  8ICR A;  3QG5 A;  4NM1 A;  2CTP A;  2M6Y A;  4LNU A;  1HUO A;  9ICU A;  3JPO A;  3G71 V;  4QZD A;  4PPX A;  4PGQ A;  4MVR A;  4NB5 A;  2K9P A;  2F23 A;  1SET A;  4WFB V;  3H1H H;  1VMG A;  3GDX A;  3ML0 A;  2LFS A;  5A2Q N;  4LF9 B;  5BOM A;  4YIP A;  4R63 A;  1LUW A;  1W0K G;  3ASN B;  1SQF A;  4FFB A;  4KLT A;  4H13 B;  5LBQ A;  4DR4 B;  3RH6 A;  1DLB A;  2KQX A;  4WC3 A;  4TUY A;  4LF5 B;  4O2A A;  1OJH A;  5H2F Z;  2A3Q A;  3E22 B;  5AG2 A;  2LW7 A;  3HKB A;  3CRM A;  1QHT A;  2EIM B;  3NR7 A;  3P30 A;  4JI1 B;  3RJE A;  4GXI A;  2KSD A;  4U7N A;  3Q4H A;  4UV9 A;  4ZOL A;  1YDX A;  4F5Q A;  2FMS A;  5LXT B;  4O69 A;  2ZM6 B;  2P4V A;  4FLV A;  4LF4 O;  3C66 A;  1J95 A;  1SES A;  3A2F A;  1B06 A;  4OX9 B;  1NTZ H;  3SYA A;  4ATB B;  3E35 A;  4MW3 A;  1NH2 D;  4JYA B;  5KHH A;  3OW2 U;  1YHQ V;  1BL8 A;  4QGP A;  2QA4 V;  2XAF A;  4O4J A;  1Q90 D;  2X0L A;  4YY3 B;  4IG8 A;  2CTR A;  1JFF A;  5BMV B;  3T1Y O;  4GX0 A;  4DR7 O;  3UXN A;  4K4H A;  1BHB A;  2ZKO A;  4WC4 A;  4FLW A;  1XL6 A;  4L87 A;  2PFO A;  7ICG A;  1GN3 A;  2AW9 A;  3L72 H;  3E8G A;  1S76 D;  1Q79 A;  2P22 C;  1I5X A;  1RFY A;  3ISD A;  4XQ8 A;  1Q6H A;  2R9I A;  2VWJ A;  1K5S A;  4J9Y B;  3E22 A;  3N27 A;  4X64 B;  1PV0 A;  1N34 O;  2EZP A;  4MF2 A;  3RJG A;  3WB0 A;  3ABL B;  2F1M A;  3A0H Z;  4DYL A;  4X65 B;  1K8A W;  1HUZ A;  2F4V O;  3CXH F;  5LXT A;  2AXT Z;  1EFR G;  4D6T H;  4I7Z B;  3QVN A;  2PGG A;  4DOB A;  4HNA B;  2XAS A;  3JSL A;  4AT7 A;  1ZQE A;  1ZTE A;  1AVM A;  2VQE O;  3K9A A;  5B1B B;  5J2A A;  4X4O A;  5J2J A;  2GTS A;  2ZDI A;  2ZXW C;  1AI4 A;  5IE9 A;  3SJQ C;  5BMV A;  3CC2 V;  2B1I A;  4P2Z A;  1Q43 A;  3W7X A;  8ICI A;  4KLU A;  1SRY A;  1XNQ B;  1EN4 A;  3EVK A;  4X4S A;  3K58 A;  3N2K B;  5J29 A;  4NKT A;  3OGC C;  4WQK A;  5CA1 B;  2CAZ C;  4DOC A;  4R7C A;  1L0N H;  2XT9 A;  1GN6 A;  1TUE B;  4UBB A;  1K97 A;  1YI2 V;  2JVD A;  1NO5 A;  4LBE C;  5DB7 A;  2PYL A;  1Q5O A;  5KHK A;  4PHA A;  1WN7 A;  3OUY A;  1U97 A;  9ICG A;  3JSN A;  3X2Q C;  3QO8 A;  4CZZ A;  2UXC B;  1ZQW A;  3LUT B;  3RBZ A;  4HNA A;  5JCO C;  3IC9 A;  3HJ4 A;  4DV1 O;  3AG1 B;  3OT7 A;  3OMN B;  9ICR A;  1Y4M A;  8ICS A;  2PYJ A;  4M9L A;  1ZQD A;  4DV7 B;  2IUB A;  1EZV H;  4UB6 Z;  3BAA A;  4X4V A;  5L3C A;  1J5E B;  4XDJ A;  4A5U B;  2ZH7 A;  3RH4 A;  4RQ2 A;  1PL0 A;  7ICH A;  3N2K A;  2UXD B;  4ICG A;  3CME V;  3L75 H;  3VQV A;  3AG3 B;  4LF6 O;  1NT2 B;  1QVF U;  5CA1 A;  4E8F A;  1VF5 B;  1F4N A;  3MBY A;  3OUS A;  5J2U A;  4OAG A;  1YXB A;  1H2M A;  4JI7 B;  5CFT A;  1ZQF A;  4LFB B;  3AG2 B;  1VAR A;  1ZJN A;  4DOA A;  4MVQ A;  2HN1 A;  1QBZ A;  2YID A;  9ICO A;  1QU7 A;  1YF2 A;  2Q8V A;  5EZY B;  1SQQ H;  4FJC C;  4AT8 A;  4M04 A;  1JMK C;  1I94 B;  4XA5 A;  4X4T A;  1JQR A;  3CCL V;  4DUY B;  3T2M A;  1GH6 A;  1UEU A;  1IBM B;  9ICC A;  1XMQ O;  3CD6 V;  3FD9 A;  1HNX B;  1KBH A;  4R50 A;  2YS8 A;  2FKX A;  1R6N A;  2QTS A;  1ENV A;  3JCZ A;  1VF6 C;  4NKU A;  1EZJ A;  3FB6 C;  3QO7 A;  2L6L A;  4MFF A;  4UB1 A;  2UU9 B;  3WB1 A;  2D3O W;  4RQE A;  3K9S A;  2Q7G A;  4DV5 B;  4Z1V A;  4OAH A;  4O68 A;  3ZRS A;  4RUF A;  1D2D A;  4CBC A;  1OV9 A;  1LNQ A;  2OCC B;  4OXS A;  4W4K A;  3U11 A;  3AUO A;  1M9N A;  4J7Z A;  4J80 A;  5FPO A;  1WNS A;  1R3I C;  5EIB D;  1MIV A;  2EIJ C;  5EZY A;  3UQ2 A;  4B7E A;  4FM2 A;  4IQU A;  4JZ2 A;  1K33 A;  1JJO A;  3FKS G;  2GWS A;  3APO A;  3EXA A;  2QJ1 A;  7ICK A;  3K04 A;  5KX5 B;  1Y76 B;  3JYC A;  4LF7 O;  3T1C A;  3ABK B;  4O6A A;  3THO A;  3JAM N;  1MSD A;  2OTJ V;  4YMO A;  4QZ9 A;  4RWQ A;  9ICE A;  3JPP A;  2C2A A;  5KHI A;  1WA8 B;  1D5N A;  1XSP A;  1NKD A;  3WG7 B;  2BBJ A;  3OGI B;  1COW G;  2WLI A;  4DR6 B;  4NXU A;  5H6R A;  3I55 V;  2WLN A;  4FLY A;  2ISP A;  5JWP A;  1TFW A;  4I2H A;  1Y67 A;  3CCU V;  1IX9 A;  3SPI A;  2PFN A;  4LF8 O;  5LMU B;  2KG7 B;  2Z5U A;  2HHP A;  4DUZ B;  3E8H A;  3TET A;  2V4D A;  1DF4 A;  1R73 A;  3ZHR A;  3ABM B;  2AHZ A;  4UD4 A;  4YHH B;  4TV8 B;  2XAJ A;  1G8M A;  3UM7 A;  1XMO B;  2EIL B;  3M7M X;  4YJ2 B;  3SPH A;  1OCC B;  4GLX A;  1ZQX A;  1NTM H;  2Q73 A;  3WFQ E;  5B3S C;  1DGS A;  5J0R A;  1XQ8 A;  1N36 O;  2DE0 X;  3G6B A;  4GKJ B;  2EIK B;  3FFQ A;  9ICB A;  2HG5 C;  5HRI A;  1NQT A;  1F51 A;  3ER8 C;  1MMM A;  3GWK C;  2QWP B;  4FFK A;  1RPR A;  2PI5 A;  1FXK B;  4X0B A;  1N33 B;  2UUB B;  1I7F A;  3SJC C;  1F5A A;  1XNR B;  1SZT A;  4G28 B;  3ASO B;  2GAF D;  4GKK O;  5J2T B;  3CXC U;  2CTQ A;  7ICR A;  4NTX A;  5E1A C;  3WB2 A;  2F66 C;  4TWK A;  3CCR V;  4NXM B;  2XAH A;  4JTD B;  1WJZ A;  2AGA A;  2BCU A;  2YIB A;  4H33 A;  1G1X B;  1H2G A;  3V7J A;  2X6C A;  3UXP A;  1R6K A;  4JI3 O;  3SDL A;  4EB6 B;  3RYI B;  3VQY A;  2BCC H;  3JZ0 A;  5IIK A;  2BCR A;  1QNM A;  1YTF B;  4NLN A;  1VQ5 V;  4YCX A;  3MGH A;  5DDY A;  1KB9 F;  3E86 A;  1HW7 A;  1QCE A;  1R3L C;  3BCC H;  2LGQ A;  3H1L H;  3I5D A;  4X20 B;  4CS3 A;  4KXR A;  4Z6E A;  2PUS A;  4FIP C;  2DYR B;  1I5Y A;  3CE2 A;  8ICY A;  4JZG A;  4O2B A;  2OTL V;  2PFQ A;  3K03 A;  4M47 A;  4X8A A;  4KLI A;  4PI2 A;  5HRB A;  1IUR A;  4UB3 A;  4XJE A;  3ZRX A;  5J2T A;  1TV9 A;  1GK9 A;  4FLZ A;  4DR1 O;  3NYB A;  1MG1 A;  1FJG B;  2UUC B;  4CH6 A;  4LEW A;  4BR6 A;  1M93 A;  3OM3 B;  3RVY A;  4EB6 A;  4CC5 A;  3LSS A;  3RYI A;  2BTQ A;  3O65 A;  4O5K A;  1QLE C;  7ICT A;  3QTC A;  3LDC A;  9ICJ A;  1P84 F;  1TVK B;  2Q6A A;  1KC8 W;  4KLD A;  2Y0I A;  2BBH A;  3D36 A;  4FM1 A;  1ZQO A;  8ICO A;  4P4P A;  4X20 A;  1KMI Z;  3ABU A;  4QJF B;  4JTC B;  4MF8 A;  2Z3Y A;  4PHD A;  4NLZ A;  4X66 O;  8ICF A;  5EK0 A;  2W0F C;  4WH5 A;  2HLD G;  8ICX A;  3FX7 A;  4JI8 O;  3ERC C;  4LC1 A;  1ZQP A;  1ZQM A;  3MDC A;  4IYH A;  2JS3 A;  3RJH A;  3K79 A;  5IWA O;  4KLL A;  3L73 H;  4KLS A;  7ICP A;  1R8C A;  4ZHQ B;  2HVJ C;  2UUA O;  1Y74 B;  4PEL A;  4QZH A;  3G6E V;  4X4P A;  1CEZ A;  2WPD G;  4M5D A;  2HVK C;  2WLL B;  4U3F H;  4LZG A;  2LGW A;  4DR5 B;  1UPG A;  4FZ0 A;  1KDH A;  3OMA B;  4X4Q A;  2GDS A;  2P5O A;  3ZRV A;  5DKW A;  3OVA A;  5BR8 O;  1NI8 A;  1PP9 H;  3RH5 A;  2O5A A;  4WOY A;  5C8Y B;  4I27 A;  5L3E A;  4TV9 B;  1FYJ A;  8ICT A;  4DV0 B;  2ZQM A;  4DR2 O;  5III A;  4XDK A;  3RT3 C;  2Q0O C;  2BTO A;  4MVO A;  2M2V A;  3L74 H;  1E1R G;  4FPP A;  1JJ2 U;  3CRA A;  4ZHQ A;  4KLO A;  3JAR B;  4B3T O;  2UXB O;  3JCF A;  4FO6 A;  1ZQK A;  1VQ6 V;  1Y74 A;  4U3J A;  4I0X A;  3CWB H;  4S3N A;  2EZO A;  3CS5 A;  3PN1 A;  2ZXW B;  5CHG A;  2XUM A;  1HR0 B;  2WLL A;  1Q7Y W;  4N23 A;  3P32 A;  1MIY A;  8ICW A;  4I9Q A;  1H2N A;  3JCU Z;  4AHC A;  4PJ0 Z;  4X62 O;  3CCV V;  1K7D A;  2BCS A;  3F5T A;  3IGA C;  1ZLZ A;  3DC6 A;  1QR8 A;  1MQ2 A;  5C8Y A;  4PA9 A;  4DV2 O;  3C3S A;  4HYO A;  4TV9 A;  4WCE V;  3OEE G;  3K5O A;  1MNG A;  3VOU A;  4KM5 A;  4W4L A;  1JR9 A;  4FHY A;  4KB6 A;  3X2Q B;  4JI6 O;  1BPY A;  1MIW A;  5DB6 A;  9ICA A;  4FLT A;  2A06 H;  5HRL A;  3MGI A;  1GPJ A;  3JAR A;  3BHP A;  1SQB H;  3MCR A;  5CHE A;  4K97 A;  2GUZ B;  4FHV A;  4RQ5 A;  3HX0 A; 
#chains in the Genus database with same CATH homology
 5J2J A;  5J2C A;  1KEJ A;  4K4G A;  3HWT A;  7ICE A;  3B0X A;  8ICI A;  2ZH5 A;  4KLU A;  4UB4 A;  8ICM A;  4QZF A;  4X4S A;  3AQN A;  3C2K A;  5J29 A;  5HRF A;  9ICV A;  4WC0 A;  4NKT A;  3JPQ A;  8ICL A;  4XQ7 A;  4UAZ A;  4DOC A;  7ICS A;  4UBB A;  5J2E A;  5DB7 A;  1NO5 A;  1TFY A;  3V7K A;  1BPB A;  3B0Y A;  4PHA A;  5HRD A;  1BPD A;  3OUY A;  1ZQR A;  1JN3 A;  9ICG A;  4UBC A;  4I29 A;  3RJI A;  5D46 A;  9ICF A;  1BPX A;  5DBB A;  1ZQW A;  1V4A A;  9ICQ A;  3HJ4 A;  5HRK A;  1ZQN A;  3RJK A;  5IIN A;  1ZQV A;  9ICR A;  4I2J A;  8ICS A;  4M9L A;  1ZQD A;  1BPE A;  3PNC A;  7ICF A;  3L9D A;  1ZQS A;  5D49 A;  4X4V A;  3PML A;  4I2C A;  5HRH A;  4KLM A;  2ZH7 A;  3LQC B;  3RH4 A;  4RPZ A;  4RQ2 A;  7ICH A;  2FMP A;  4X0A A;  3H39 A;  1ZQL A;  2DR5 A;  4YN4 A;  3PMN A;  4I2E A;  1VJ7 A;  4RQ8 A;  3C2L A;  4FHW A;  1FA0 A;  3H37 A;  4E8F A;  1ZQT A;  3MBY A;  4I2I A;  5J0P A;  7ICI A;  4M9G A;  5F2V O;  1ZQF A;  2M2W A;  2DVI A;  4AT7 B;  4YD1 A;  1ZJN A;  4X4R A;  3OVB A;  4DOA A;  8ICP A;  4WBZ A;  4RWO A;  3JPT A;  9ICO A;  4WCW A;  9ICN A;  5CR0 A;  5IIO A;  2ZH1 A;  5BOL A;  4AT8 A;  3OVS A;  2ZHB A;  2ZH2 A;  4M04 A;  5BPC A;  4RQ3 A;  8ICZ A;  4KLE A;  5CWR A;  3HJ1 A;  2FMQ A;  8ICU A;  4XA5 A;  4X4T A;  4RWN A;  3TFS A;  1JQR A;  1UEU A;  4RQ7 A;  3JPN A;  9ICC A;  5IIJ A;  5HRE A;  4R66 A;  4RQ0 A;  4M9J A;  4EBK A;  5IIL A;  7ICN A;  4Z6C A;  4NKU A;  1ZQZ A;  3OUY B;  5J0S A;  4RQ6 A;  4MFF A;  4UB1 A;  3WFS C;  3JYY A;  2BCQ A;  1TVA A;  4QZI A;  5DB9 A;  5J2D A;  3LK9 A;  5HR9 A;  4KLJ A;  4JWN A;  4F5O A;  5DBA A;  2NRK A;  4QZE A;  8ICC A;  5DDM A;  1ZQG A;  3AUO A;  1ZQC A;  4XUS A;  1MIV A;  8ICA A;  4QZA A;  3WFP A;  9ICX A;  3UQ2 A;  9ICM A;  4IQU A;  2GWS A;  4GXJ A;  7ICK A;  1XSL A;  4PGY A;  4YMN A;  5J2F A;  3UPS A;  4M9H A;  4YMO A;  4FHV A;  4O5C A;  4QZB A;  4QZ9 A;  4RWQ A;  9ICE A;  4RQ5 A;  3JPP A;  2I9G A;  4TUP A;  1XSP A;  3H3A A;  5D4B A;  5J0Y A;  2ISO A;  4P2H A;  2PBE A;  3RJF A;  3UPQ A;  2ISP A;  1R8B A;  1JAJ A;  1TFW A;  4I2H A;  1NOM A;  1ZQY A;  8ICV A;  8ICQ A;  4YD2 A;  2PFN A;  4I2A A;  9ICT A;  4PGX A;  1RZT A;  8ICK A;  4AT8 B;  2HHP A;  4KLG A;  1ZQQ A;  2DR7 A;  4QZ8 A;  5CJ7 A;  4TUS A;  9ICP A;  4KLH A;  3JPR A;  4UD4 A;  4RT3 A;  1ZQI A;  3V72 A;  5DED A;  2BPG A;  4UB5 A;  1ZQX A;  3WFQ E;  3ISB A;  5J0R A;  1BPZ A;  5IIM A;  2ZH9 A;  5EOZ A;  4IQV A;  2PFP A;  4DO9 A;  9ICB A;  5HRI A;  3AQK A;  7ICM A;  5J0O A;  4UAW A;  3AU6 A;  2RFF A;  4M2Y A;  1R89 A;  5DB8 A;  4MFC A;  4X0B A;  4RT2 A;  5HRG A;  4LT6 A;  2VAN A;  3UQ0 A;  1F5A A;  4UAY A;  1ZQJ A;  1ZQB A;  7ICU A;  4M0A A;  4NY8 A;  7ICR A;  1WOT A;  4RWP A;  2ZH3 A;  4Z6F A;  4NLK A;  8ICE A;  4JWM A;  4LZD A;  2BCU A;  2BE3 A;  4EP7 A;  3V7J A;  3UXP A;  5CA7 A;  9ICW A;  4F5R A;  1UET A;  4WC6 A;  4I2B A;  1ZQH A;  5TZV A;  9ICS A;  3JZ0 A;  5IIK A;  2BCR A;  7ICQ A;  3WFO A;  4NLN A;  2DRB A;  4YCX A;  3MGH A;  5DDY A;  2DRA A;  1KNY A;  4I2F A;  5J0X A;  8ICN A;  4TUR A;  4Z6E A;  4IQW A;  4F5N A;  5DEC A;  8ICY A;  1UEV A;  3AQM A;  2PFQ A;  4RQ1 A;  4QZG A;  4M47 A;  3H38 A;  4PHP A;  5HHI A;  1MQ3 A;  4KLI A;  3K75 D;  4P4O A;  1R8A A;  5HRB A;  5J2B A;  4M9N A;  4UB3 A;  4MFA A;  3MDA A;  3TFR A;  4QZC A;  4O9M A;  4R65 A;  4RPX A;  5CB1 A;  1TV9 A;  4I2D A;  5DBC A;  3NYB A;  7ICV A;  5J2I A;  3ISC A;  2DR8 A;  2P66 A;  3JPS A;  2ZHA A;  5J2K A;  1ZJM A;  4WC5 A;  4EBJ A;  3WFR E;  4UD5 A;  1JMS A;  7ICO A;  2Q66 A;  8ICH A;  4ATB A;  4AT9 A;  1PX5 A;  2PXI A;  4FHP A;  4O5K A;  7ICT A;  3AQL A;  9ICJ A;  3C18 A;  1ZQU A;  5J0W A;  4FH3 A;  3AU2 A;  4Z6D A;  4KLD A;  7ICL A;  4YMM A;  4F5P A;  8ICO A;  1ZQO A;  4WC7 A;  4P4P A;  5J0Q A;  3V7L A;  4MF8 A;  4PHD A;  2W9M A;  4NLZ A;  2ID1 A;  8ICF A;  5J2H A;  4WC1 A;  8ICX A;  4I28 A;  9ICI A;  2ZH6 A;  3OGU A;  8ICR A;  1ZQP A;  1ZQM A;  4R64 A;  4NM1 A;  3MDC A;  8ICB A;  9ICK A;  4UB2 A;  4KLS A;  3RJH A;  4KLL A;  7ICP A;  4KLQ A;  4O5E A;  3UXO A;  1HUO A;  9ICU A;  3JPO A;  1R8C A;  4QZD A;  4PPX A;  1RPL A;  4PGQ A;  4X4N A;  2BCV A;  4QZH A;  4PHE A;  4I2G A;  4X4P A;  1XSN A;  7ICJ A;  4M5D A;  2ZH4 A;  4LZG A;  9ICH A;  3GDX A;  4RQ4 A;  5BOM A;  4R63 A;  8ICJ A;  1KDH A;  4KLT A;  3RH6 A;  4X4Q A;  2BPC A;  4WC3 A;  3OVA A;  5DKW A;  3RH5 A;  4LVS A;  2O5A A;  2M2T A;  4I27 A;  1VFG A;  1ZQA A;  4K4I A;  4XRH A;  5HC9 A;  3RJE A;  4GXI A;  4KLF A;  8ICT A;  5CP2 A;  3RJJ A;  5III A;  4F5Q A;  2FMS A;  4X5V A;  2M2V A;  4RPY A;  2DR9 A;  4NM2 A;  5J0U A;  9ICL A;  3C66 A;  3C5G A;  3OV7 A;  4KLO A;  2ZH8 A;  4FO6 A;  1ZQK A;  4ATB B;  4AT9 B;  1YLQ A;  4S3N A;  4NXZ A;  2BPF A;  4E80 A;  4IG8 A;  4WC2 A;  4GXK A;  5CHG A;  2M2U A;  3C5F A;  3C2M A;  5J0T A;  3UXN A;  4K4H A;  4WC4 A;  1MIY A;  1Q78 A;  8ICW A;  2PFO A;  7ICG A;  5HHH A;  4E7X A;  4PH5 A;  2BCS A;  1Q79 A;  3HIY A;  3ISD A;  4XQ8 A;  1MQ2 A;  4P4M A;  4X4U A;  5J2G A;  3HW8 A;  4MF2 A;  4WBY A;  3RJG A;  1OU5 A;  1HUZ A;  4FHY A;  4FHX A;  4IQT A;  1BPY A;  1MIW A;  2O1P A;  5DB6 A;  9ICA A;  4FH5 A;  5HRL A;  3MGI A;  2IHM A;  4DOB A;  4AT7 A;  8ICG A;  1ZQE A;  4TUQ A;  5J2A A;  4X4O A;  3HX0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...