3JZ0A

Linb complexed with clindamycin and ampcpp
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
266
structure length
266
Chain Sequence
b'LKQKELIANVKNLTESDERITACMMYGSFTKGEGDQYSDIEFYIFLKHSITSNFDSSNWLFDVAPYLMLYKNEYGTEVVIFDNLIRGEFHFLSEKDMNIIPSFKDSGYIPDTKAMLIYDETGQLENYLSEISGARPNRLTEENANFLLCNFSNLWLMGINVLKRGEYARSLELLSQLQKNTLQLIRMAEKNADNWLNMSKNLEKEISLENYKKFAKTTARLDKVELFEAYKNSLLLVMDLQSHLIEQYNLKVTHDILERLLNYISE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lincosamide nucleotidyltransferase
publication title Structure and mechanism of the lincosamide antibiotic adenylyltransferase LinB.
pubmed doi rcsb
source organism Enterococcus faecium
molecule tags Transferase/antibiotic
total genus 106
structure length 266
sequence length 266
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 3jz0A02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 3jz0A01
4RQ1A 3GM3A 4YMNA 4FHPA 7ICVA 4IQWA 4EP7A 4QZAA 2BCSA 4E8FA 9ICAA 9ICHA 5DDYA 4M0AA 4X0BA 3RJFA 4I2CA 3JPQA 4FH5A 4M5DA 4R65A 3OGUA 1ZZPA 3AQKA 5CWRA 3RQEA 9ICRA 4FHXA 4FHYA 8ICNA 4QZGA 4RQ4A 5J2IA 3AU6A 1KTMA 3JPSA 8ICWA 2HHPA 8ICGA 9ICCA 4YMOA 1YLQA 9ICEA 2BCQA 2GWSA 3V72A 9ICBA 4RWPA 3MDCA 4WC6A 1ZQWA 2JX0A 1JN3A 3PMNA 1XSNA 4KLDA 4PGYA 8ICQA 3PMLA 1ZQUA 3HX0A 4PH5A 4UBCA 1ZQBA 4KLTA 4M47A 4GXIA 4WCWA 2DVIA 3C2MA 4WBZA 3L8JA 3B0YA 2ZH9A 1R8AA 3TFSA 8ICEA 4NLZA 1TV9A 1ZQPA 5DB7A 1OW6A 4I2HA 2DRBA 5HREA 3H39A 4XQ8A 5IIMA 3RH4A 1BPEA 4X4UA 4X0AA 4NLNA 5CR0A 4MFAA 1MQ2A 5DB9A 3MFNA 4IQVA 4R64A 3H37A 5HC9A 1UEVA 1XSPA 4R32A 5IIJA 3OVAA 4O5KA 3ISCA 3V7LA 3RJHA 1ZQSA 4I2AA 4PHDA 3L8IA 1Q78A 3JPOA 1BPDA 4UD5A 9ICWA 4EBKA 4TURA 8ICSA 4WC2A 4PGQA 4XA5A 2ISPA 3UPQA 3JPRA 1OU5A 2NRKA 3OV7A 5J2HA 4IG8A 4P4PA 4YD2A 1VJ7A 1MIWA 4X4RA 4P2HA 4YD1A 2M2WA 1JQRA 2O1PA 3OUYB 5F28E 4UAZA 7ICQA 3WFQE 1TFWA 3NYBA 7ICPA 4YN4A 8ICBA 8ICHA 2DR7A 7ICSA 4QZEA 3OUYA 5DKWA 5BOLA 1ZQNA 7ICTA 1KNYA 1WWPA 2ZHBA 2VANA 9ICXA 1R89A 4GXJA 4XEKA 9ICLA 4Z6EA 4NXZA 4R66A 4I28A 3GM1A 4P4MA 4LVSA 4RQ3A 3V7KA 4UB5A 1BPXA 9ICPA 1HUZA 2JPUA 2PFQA 1ZJMA 4WC5A 2ZH5A 7ICFA 2BCUA 5BOMA 3K7DA 4RPZA 4X4NA 4LZDA 2DR8A 5D4BA 2M2TA 4ATBB 4I27A 4M04A 4Z6CA 3C2LA 4RQ8A 4M2YA 5HRFA 5DDMA 5J2AA 4QZHA 4S3NA 3GDXA 4I2EA 4ATBA 3C8GD 4NLKA 5J2EA 4RQ5A 5HRLA 4WC0A 4F5NA 5J2FA 1KEJA 4I2JA 3GM2A 4F5OA 7ICRA 2ISOA 4NM1A 2LK4A 7ICJA 3RJKA 4EBJA 1JAJA 4QZ8A 3MDAA 2PBEA 3TULA 4MFFA 3C8GB 1NO5A 8ICAA 4XUSA 5DECA 1ZQXA 1PX5A 3C8GA 5DBBA 5HRKA 3MGIA 1WOTA 3HJ1A 1HUOA 4PGXA 3RJIA 3LK9A 2L6GA 7ICEA 3LQCB 1ZJNA 4WC3A 9ICOA 4R63A 1OW7A 4UAWA 4DOBA 4M9JA 4O9MA 7ICIA 3TFRA 3UXNA 4KLOA 4M9LA 4FHVA 3UPSA 5J2BA 4K4IA 7ICUA 2ID1A 2ZH1A 5HRBA 3HIYA 8ICCA 1ZQGA 2I9GA 1ZQRA 4LZGA 7ICOA 4RPXA 4KLQA 4RQ6A 1WTYA 4MF8A 4K4GA 5J2DA 3JPPA 2KK1A 1O3UA 1ZQFA 2Q00A 3UQ0A 3C5FA 2FMPA 4NKUA 1ZQTA 4UB4A 5J0SA 4KLHA 3K75D 5IILA 4IQTA 3U0CA 2ZH4A 3WFSC 2W9MA 1KDHA 4MFCA 9ICGA 3BRJA 3RJEA 8ICYA 4RQ0A 7ICHA 4NQFA 4RPYA 4I2GA 4JWNA 5HHIA 9ICNA 1V4AA 1K40A 2PXIA 2IHMA 9ICTA 4X4OA 4KLLA 2ZHAA 2M2UA 5EOZA 4E7XA 3RJGA 5HRHA 4F5PA 2DRAA 3V7JA 4WC7A 3JPTA 5HHHA 4XEVA 4X4QA 4Z6DA 5DB8A 2BCRA 1ZQQA 8ICZA 4KLIA 4UAYA 1R8BA 8ICIA 5J0PA 3JPNA 5J0OA 4PHEA 4PHPA 3HWTA 4QZ9A 4RT3A 4RWOA 1OW8A 7ICNA 5CA7A 9ICJA 1F5AA 8ICJA 5D49A 8ICPA 2ZH7A 8ICLA 3OVSA 1UETA 3RH5A 3ISDA 4O5CA 3U3FA 4UB2A 3AQNA 1ZQMA 5J0YA 1ZQKA 5IIIA 4QZCA 4M9NA 4X4PA 2ZH8A 2ZH3A 5J0XA 2BE3A 2L6HA 2O5AA 4FH3A 1ZQDA 5J2GA 1BPBA 2ZH6A 1PV3A 3C2KA 3UXPA 3WFOA 1BPYA 2PFOA 4O5EA 9ICIA 2P66A 3AU2A 4I2FA 5DB6A 3RQFA 2BPCA 7ICLA 5CP2A 4QZIA 4DOCA 1TVAA 1ZQLA 4I2DA 5D46A 4KLGA 4TUPA 3B71A 4DO9A 4IQUA 2YWAA 4UB1A 1ZQZA 2BPFA 4WBYA 5IINA 3ISBA 5J2CA 2FMQA 2BCVA 3AQMA 4RWQA 2DR9A 5J0RA 5HRDA 4F5RA 1NOMA 4NY8A 4WC4A 4NKTA 4XEFA 4Z6FA 3H38A 1TFYA 1UFBA 8ICUA 3AJMA 8ICVA 4QZDA 8ICFA 1Q79A 5HRGA 2ZH2A 4KLSA 5F2VO 1ZQAA 9ICKA 1FA0A 4UD4A 4QZBA 4RT2A 1VFGA 4I2IA 3RQGA 5DBAA 1K05A 4JWMA 4KLJA 5J0WA 1RZTA 1ZQIA 3C5GA 5J0QA 5CB1A 4AT9B 4X4VA 1RPLA 1ZQHA 8ICOA 4X4SA 4RQ2A 1WOLA 3WFRE 9ICFA 5HR9A 4I2BA 4UBBA 4NM2A 3PNCA 7ICKA 8ICKA 4AT9A 4YCXA 4K4HA 3RH6A 3C18A 4WC1A 5J0TA 5CJ7A 3UQ2A 5J2KA 2DR5A 1MIYA 9ICQA 1JOGA 4YMMA 3O10A 4RQ7A 5DEDA 2RFFA 1R8CA 1ZQEA 5BPCA 9ICUA 3AQLA 8ICXA 5J0UA 4UB3A 4XQ7A 4P4OA 1ZQYA 4GXKA 5J2JA 1ZQJA 3C66A 4KLFA 4M9HA 4FO6A 4I29A 2Q66A 3WFPA 8ICMA 5IIOA 2PFPA 8ICRA 1QVXA 3HW8A 1ZQOA 4MF2A 9ICSA 4X4TA 1MQ3A 3B0XA 3RJJA 3JYYA 2M2VA 3MGHA 7ICGA 9ICMA 5J29A 4FHWA 1BPZA 4TUQA 2BPGA 3H3AA 4TUSA 4PPXA 4X5VA 1K04A 4AT8B 4LT6A 3L9DA 1JMSA 5IIKA 4XRHA 3MBYA 4KLUA 7ICMA 3HJ4A 5HRIA 1XSLA 2PFNA 5CHGA 2HSBA 4AT8A 2FMSA 4KLEA 1ZQVA 9ICVA 4RWNA 4DOAA 8ICTA 4QZFA 4M9GA 3AUOA 4F5QA 3S9OA 1MIVA 4AT7B 5DBCA 1UEUA 1ZQCA 5TZVA 4KLMA 2L6FA 4AT7A 3OVBA 3UXOA 4E80A 3JZ0A 4PHAA
chains in the Genus database with same CATH superfamily
1NFOA 4XPXA 5KYWB 3DE9A 3T4RA 4IQWA 4QZAA 3IQTA 5JP7A 2WVQA 2XSEA 3Q7GA 4I2CA 1BR1A 3DE8A 1ZZPA 3AQKA 3LLIA 5AGFA 4FHXA 5F5FA 1VLTA 3CAXA 3RKOF 4N6CA 4U5CE 3I5QA 1KTMA 1WASA 8ICWA 2PX3A 5L0CA 2FCLA 1YLQA 2OJQA 4OIRF 4RWPA 1ZW3A 3O6XA 2J7PD 3U3BA 3PDMP 1AVOB 3PMLA 3ECSA 3HX0A 4PH5A 5A6JA 5HSWA 3TOMA 2GAQA 1Z5ZA 3ZSUA 4EHPA 3B0YA 1R8AA 4NLZA 5L3QA 1OW6A 4XQ8A 4N06A 1AEPA 4QI0A 3EG9B 4MFAA 4R64A 3H37A 1J8MF 3RVZA 2P6VA 4WH5A 2YZSA 5IIJA 4PJLA 3ZIBA 3LS0A 3ISCA 2WZFA 1YAUO 1ZQSA 4I2AA 3US6A 2R9RB 1ORSC 4J7YA 4K8VA 3OA1A 3QTHA 3GODA 3JPOA 3SXMA 5JRAA 4UD5A 4TURA 1Q0FA 4WC2A 1S7ZA 2OKUA 3JPRA 3OV7A 3AG2C 3EH1A 3KL4A 5T3TA 2BBHA 4P2HA 2AP3A 2HZ8A 3OUYB 5F28E 1B68A 4XQ1A 1TFWA 7ICPA 2KSFA 2EIKC 5D92A 8ICBA 8ICHA 2DR7A 7ICSA 1WN0A 3S27A 7ICTA 3LS1A 1KNYA 2G62A 1OXKA 3GANA 4BEJA 4GXJA 4CDVA 4NXZA 4R66A 4KC9A 4I28A 1E84A 1E85A 2EINC 3VYWA 3V7KA 3HTKC 1BPXA 1T5OA 4IARA 4YN0B 5JVEA 2G3KA 3K7DA 3S84A 4X4NA 4X0RA 2DR8A 1ZHWA 3O39A 5KYXB 3EGXB 5D62A 2OEVA 4S3NA 4FAPB 5J2EA 4RQ5A 4WC0A 1EI7A 3TK0A 5J2FA 3AG1C 3GM2A 3NWIA 1NU9C 3N24A 2LK4A 1HE1A 1JAJA 1RJ9B 2YLIA 1OR2A 4J30B 5DECA 1FNTc 3QW0A 2J9VA 1ZQXA 1PX5A 1H6GA 3Q6NA 3C8GA 3ABKC 4C7OB 3HJ1A 3MCRA 1Y6DA 2Y3GA 2OQMA 4BJ6C 3FAPB 4LERA 3LNRA 4O6NA 3W2VA 4M9JA 4DOBA 7ICIA 1D0YA 2B4VA 2J46A 3TFRA 4KLOA 3UPSA 3EFOB 1VB5A 2ZH1A 3ER8C 5E3CA 5COMA 1ZQRA 1YVIA 4DJ9A 7ICOA 5L0JA 4KLQA 3G50A 3DZAA 4ONSA 1M57C 5DLJA 4N6HA 1I4ZA 4MF8A 4PR9A 1FTSA 5JSLA 5J2DA 2Q00A 3UQ0A 2R7VA 3DAFA 3M4BA 3WFSC 4I0UA 4EIYA 2R7XA 3OEOA 3DKAA 2LFFA 3BRJA 4XLPF 3EHMA 4RQ0A 4JWNA 4U9EA 5HHIA 1K40A 2W9YA 9ICTA 1IW7F 2PX0A 3K1HA 2WL8A 3LAYA 4EV6A 2ZHAA 2P61A 1TKNA 3WODF 3RJGA 1JAFA 5HRHA 3V7JA 4XEVA 3U2MA 1OW8A 7ICNA 5CA7A 2ZPAA 9ICJA 4U5EE 5D49A 4YT8A 1QZXA 1UETA 3RH5A 2Y3DA 3RIPA 3IQCA 3ZG1A 2R7QA 2O5AA 4FH3A 4P9TA 4BJ5C 3C2KA 2PNOA 3UXPA 4MVOA 1BPYA 2PFOA 5D63A 2R7WA 3T9OA 2J8WA 3F47A 4K1OA 4CS9C 1O5HA 4JLXA 5DB6A 2YRFA 2R7TA 1ZQLA 4I2DA 5L3VA 1D0ZA 4KLGA 4TUPA 1JPJA 4FESA 5FZTA 2YWAA 3ER9B 1FMWA 4JJFA 3C62A 1GQAA 5HV9A 5CI9A 3VM6A 3JSZA 5J2CA 2A1DD 2YLDA 4BEMJ 5J0RA 4F5RA 2X51A 4NY8A 8ICUA 3AJMA 8ICVA 4LDKA 1HW2A 1CGOA 9ICKA 1FA0A 3RQGA 5J0WA 1ZQIA 5J0QA 5CB1A 1MMDA 4X4SA 2BE5F 2OU6A 1BDJB 3NMJA 5HR9A 4I2BA 1FMVA 1G4WR 4AT9A 1RCPA 3RH6A 3C18A 2DR5A 3SP1A 3O10A 5DEDA 5B1AC 2NUTB 1GGQA 3I4UA 1ZQEA 4EBBA 2KW3C 4UB3A 4P4OA 5J2JA 1ZQJA 4IB4A 2H7BA 4G7HF 5L0IA 3X2QC 4DBRA 3HNJA 2Q66A 3RF3A 3EGDB 2PFPA 3HW8A 1ZQOA 3LNMB 3B0XA 1CPQA 4MVUA 4DOZA 3JYYA 3MGHA 1OXBA 4JTAB 3NKEA 2XLWA 1E86A 2BPGA 4OAGA 3H3AA 3RFYA 4X5VA 3F46A 2Q4FA 4AT8B 4LT6A 3L9DA 4FO1A 1JMSA 2KC3A 4I3MA 2PFNA 3B29A 5CHGA 2P1AA 3M1CB 2AU5A 4U5FE 2YHSA 1RKCA 3B0UX 1SR2A 5TZVA 2AWCA 2L6FA 2CNWA 2B0JA 4E7ZA 4AT7A 3OVBA 3JZ0A 2H7OA 2OEXA 4RQ1A 1ZU4A 2VASA 4YMNA 5F5HA 3SXKA 4EP7A 3N0TA 5KYWA 4LEYA 5B3IA 3WG7C 3SXYA 3W2WA 2VCCA 4C3DA 4M5DA 4R65A 4PJMA 3ZTMA 1T01A 5CWRA 3RQEA 9ICRA 3LUTB 8ICNA 2XL8A 3MYIA 2ZXOA 4RQ4A 2LQGA 3A9CA 4CS8A 5E33A 1ORJA 2IM8A 4NXVA 2Q9BA 2HHPA 3G4ZA 9ICCA 4YMOA 4CIPA 2MWQA 4OIOF 3V72A 3MDCA 3KYIA 1ZQWA 4CIHA 2GFHA 1LM3B 3PMRA 4KLTA 4M47A 3ERCC 2DVIA 2IYLD 4WBZA 2ZH9A 4A2NB 8ICEA 4G78A 1TV9A 1ZQPA 5DB7A 2XLMA 2HMQA 4JEBA 4OIPF 4CSAA 2DRBA 3H39A 1BPEA 1JRAA 4X4UA 4X0AA 3B0PA 5CR0A 2YL3A 3GORA 4K96A 1MQ2A 4NTBA 4K98A 5DB9A 1OKKA 4G7OF 1ZVZA 3EG9A 3HKKA 1XSPA 3WAQA 4R32A 1U0BB 3QZCA 1JMWA 4K97A 1NZEA 4YK5A 2DB4A 1YLMA 3U9JA 2IXMA 4D4XA 3B0VC 4Z9JA 9ICWA 4DRIB 4DRHB 4O7GA 4PGQA 2ISPA 4HEAJ 4KBLA 4YD2A 4P4PA 2X0CA 2HV7A 1VJ7A 2M2WA 1JQRA 2O1PA 5EHHA 4B6IA 3CZ6A 3OUYA 2A69F 5DKWA 1ZQNA 4K9AA 4JZAA 2ZHBA 3DMDA 2UUIA 5EK0A 9ICLA 4YT2A 4HE8D 4P4MA 2W4BA 1QQ3A 4F4BA 3HNLA 2WZGA 3RW0A 4CJOA 2A6HF 2ZD9A 3EJNA 2JPUA 2PFQA 2M4EA 4XLNF 5KYNA 2ICWG 7ICFA 5BOMA 2C04A 4I44A 4U5BE 5D4BA 1LE2A 2M2TA 1I4YA 4ATBB 4M04A 5HRFA 5J2AA 3S28A 5KYXA 3EGXA 4NLKA 4LACB 3WHNA 4D4NA 4F5NA 3NKDA 5A69A 4I2JA 1TWAA 3JTLO 2ISOA 7ICJA 3QW1A 4QZ8A 4MFFA 3VF0A 8ICAA 1JR8A 1LVKA 2MYSA 3DM5A 1RJ9A 1U89A 4PJJA 4PGXA 1TWHA 2L6GA 1Q0KA 4K7BA 7ICEA 2A68F 4C7OA 3LQCB 1ZJNA 3NKUA 2PF4E 4R63A 1OW7A 2H7VC 4UAWA 4MS2A 4FHVA 3JSEO 4K4IA 4DRJB 4UDVA 3ZDLA 4LZGA 3EFOA 3G4XA 5KYYB 4LEWA 2KK1A 1Q0GA 1VYIA 2FMPA 2GAFD 4JIOA 5J0SA 3I5PA 4KLHA 3K75D 4IQTA 3U0CA 4MTGA 1HE9A 1A41A 5B3PA 3NYMA 3C8ZA 2VCBA 4MFCA 3AG3C 3OWGA 4QDLA 4NXTA 7ICHA 5COGA 3U9MA 1F1MA 2AVKA 4JKVA 3TD7A 5EOZA 4E7XA 1XZQA 4AE4B 3JPTA 1GS9A 4X4QA 2BCRA 1ZQQA 1OCCC 2CNWD 1R8BA 8ICIA 3CQZA 2YL1A 5AC4A 3DXJF 1TWGA 2XRHA 2ZH7A 2F22A 4NCQA 1VTMP 3ISDA 4UB2A 1JPNA 3AQNA 5FCLA 1Y4CA 2ZH3A 1ZQDA 5A6BA 4IAQA 2IUBA 5DS6A 9ICIA 4YL0A 2YLGA 4PACA 2J0WA 2GWWA 1BR4A 2P66A 1WGWA 4WABA 3FOOA 4ER9A 3UR3C 3Q6MA 3RQFA 7ICLA 2AWYA 4P6IC 5CP2A 1NFNA 5D46A 1QKRA 4DO9A 2IXNA 2EWRA 1VOMA 3K1IA 4U5DE 4IQUA 2Q9AA 3T6GB 1CPRA 2BPFA 2UUHA 1D0XA 2QE9A 2Y39A 3K6BA 2QUPA 2XLOA 1A0BA 4O79A 3C7JA 3H38A 4Z6FA 4QZDA 8ICFA 3W8IA 4KLSA 2OJED 4JJGA 4QZBA 1FFTC 4I2IA 2R03A 3IQ6A 2D4UA 1NLXA 1MQVA 1OKKD 1RPLA 1M56C 3V5XA 1HMDA 2V26A 4LEVA 4K4HA 3QMKA 1QPUA 5CJ7A 5J2KA 9ICQA 3M15A 1JOGA 4NTAA 1TFOB 2Y69C 1APCA 9ICUA 3AQLA 1Z7Qc 2NUTA 5J0UA 4XQ7A 4JCHA 4GXKA 3C66A 2LFDA 4JRZA 1ZU5A 1T6UA 8ICMA 5IIOA 9ICSA 1BBHA 3EGDA 4IAOA 1M2VA 3MLGA 7ICGA 2Z15A 5J29A 1R5ID 1WATA 4NXXA 2M64A 4TUSA 4LLEA 2Y3BA 3FVYA 4CX9A 2W4MA 1D1AA 2NUPB 4MKPA 1XSLA 4MNDA 4AT8A 4OIQF 4RWNA 4CS8C 1HMOA 3DWWA 4MVRA 1XZPA 3AUOA 3S9OA 1MIVA 3PHZA 3EPVA 5DBCA 3EQLF 2XM0A 4LDQA 2O9XA 2QLAA 1HW1A 3LEOA 3UXOA 4G0HA 4PHAA 4FX5A 1VLSA 3GM3A 3FDQA 4FHPA 2LCHA 1LIHA 3NVOA 4O69A 2HN2A 2PP4A 2BCSA 4OAFA 3OWTA 4E8FA 9ICHA 5DDYA 1PD1A 3ATPA 4O68A 1MNDA 3OGUA 1EQ1A 4CSAC 5E3AA 3EF2A 4WQKA 4I1OB 4FHYA 2A0UA 5BQGA 1PD0A 3UMHA 1UG7A 3AU6A 3UNGC 4CJGA 3QVYA 4AL1A 2J9BA 8ICGA 2XXAB 4JEAA 2GWSA 3ZVRA 4WC6A 1JN3A 3PMNA 2FGYA 2D5RB 4KLDA 4PGYA 8ICQA 1O87A 1EKYA 2PFDA 2IXPA 4RDAA 1ORYA 4GXIA 4JVSA 3L8JA 5GPGB 3TFSA 3E70C 1SYQA 4HX0A 2J0XA 4I2HA 4Z9IA 5HREA 4NY3A 4L6RA 5IIMA 3RH4A 2R05A 5A6KA 2LSEA 3R2PA 4JURI 3W8HA 3MFNA 4IQVA 5HC9A 1UEVA 1YA9A 3OVAA 3V7LA 1TR2A 3RJHA 4IRUA 3ZC4A 4PHDA 4NXWA 3AOUA 1DOWA 1Q78A 4DVYP 1G8XA 4XWJA 2EPMX 4KM5A 2BBJA 1OQCA 3DI5A 4XA5A 3SYNA 3UPQA 3MBGA 4EGWA 4IG8A 3SZRA 2VC9A 1MIWA 4X4RA 4MVMA 1ZW2A 1A7DA 3T6BA 4UAZA 3NYBA 4LLCA 4GYTA 3ITFA 5BOLA 2ZXWC 1EA8A 2EIJC 1NBBA 3NYJA 3UGPA 9ICXA 1E2XA 1CGME 2CW0F 2EPLX 4Z6EA 3GM1A 1XWJA 2I15A 3ZTZA 2YKZA 5A6BD 4K99A 3KMIA 5T1DB 5KYUB 1HUZA 4WC5A 2XS8A 4K0DA 2ZH5A 3TQOA 4RPZA 4LZDA 4I27A 4Z6CA 3C2LA 1FAPB 5DDMA 4PFPA 4QZHA 3GDXA 4I2EA 4ATBA 3C8GD 2V3CC 3UMIA 3AQBA 4U5GA 7ICRA 2E87A 1E83A 3H2UA 1T6QA 4Q7CA 4EKWA 5D61A 3RJKA 4EBJA 4MTOA 2EILC 3AGTA 3JCUQ 3MDAA 3TULA 3IEEA 4XUSA 1VMAA 3JYHA 2DYSC 4KNVA 3SXZA 5JUAA 3MGIA 2R7OA 4WGZA 2GDCA 4MW3A 3U8PA 4EWCA 4NXUA 4WC3A 9ICOA 3W4YA 3UXNA 4BJTA 4M9LA 5J2BA 2ID1A 3JT1A 3M4CA 3X1OA 1SF8A 8ICCA 3FAJA 3DJNB 1ZQGA 2I9GA 4HFKB 4RPXA 1W2WA 1YJGA 5D91A 4RQ6A 4H54A 1WTYA 4LDRA 3IQ5A 2R25A 3KPHA 5CFTA 3BEHA 3JPPA 1O3UA 5KYYA 1ZQFA 4YL3A 3QVZA 1ZQTA 3PHF2 3ASOC 4H4KC 4E0HA 2HN1A 1ZHXA 4JCZA 2C03A 3DJUB 3L0IA 4J7TA 5DS5A 3RJEA 4NQFA 4RPYA 4I2GA 3CK6A 4IJJA 3UMKA 1V4AA 5CFSA 5JT4A 4MVZA 4C3BA 5L0FA 4ULWA 2IHMA 4X4OA 1Q0MA 4WGYA 4KLLA 2M2UA 4PFOA 1Z23A 1V54C 4F5PA 1H9GA 1G4US 2QY9A 3LESA 4DBQA 4Z6DA 4E7SA 4JC7A 4AE4A 3K1IC 1U6HA 4PHPA 3HWTA 1LPEA 4QZ9A 4RWOA 4DVZA 2R02A 3KYJA 1F5AA 1GPJA 8ICPA 3VRCA 3U8VA 3OVSA 1I5NA 2J9UA 1ZQMA 5IIIA 4QZCA 4X4PA 2ZH8A 4JW1A 5J0XA 1T6IA 4EEDA 1TQGA 4G7ZF 3FXHA 1KU2A 3NRHA 5J2GA 5L0HA 2J45A 5L0GA 4JLZA 4KI2A 2BPCA 4QZIA 2GA9D 5E2QA 4W8PA 4E0IA 1LI5A 4AK9A 5BQHA 2HKVA 4WBYA 5AC5A 4KNWA 3ISBA 1NU7D 3CSKA 3IHUA 2FMQA 2BCVA 4CDAA 4RWQA 2XLDA 2ZXRA 2DR9A 5HRDA 2HFIA 4NKTA 4XEFA 4OAIZ 1UFBA 2OCCC 1ZHTA 1V55C 2ZH2A 4WQLA 5F2VO 4EUKB 4IWBA 4YT5A 4ULVA 1HY5A 3L1MA 5B3SC 4JWMA 1K05A 4KLJA 3C5GA 2ETSA 1Q0DA 2KGOA 5COFA 4RBNA 2RD9A 4FWVA 3WFRE 4UBBA 3PNCA 7ICKA 8ICKA 2VCAA 4WC1A 3FMSA 2NSFA 4DXWA 4ZLCA 1MIYA 3A11A 2RFFA 4XJEA 4A4AA 1J8YF 3NG1A 1DOVA 4BJ1A 4JTDB 1YDIA 4LEZA 4CBEA 4OD4A 3E9VA 1L3PA 1L7CA 5L0DA 2IOQA 1RKEB 2EPKX 3UGOA 4MW8A 3AG4C 4GQHA 1LS1A 8ICRA 1QVXA 1V74B 4MF2A 2CYDA 1RXQA 1Z63A 1BZ4A 4O6MA 4WOYA 2P0NA 3NDBB 3MX3A 4FHWA 4OAHA 4QI2A 1BPZA 4TUQA 3SEOA 4K9BA 2CCYA 4GEHA 4JE9A 4O67A 1N1CA 5IIKA 4XRHA 3MBYA 7ICMA 2DI3A 5HRIA 1M2OA 4KLEA 2NUPA 8ICTA 2B51A 3TJ6A 4N7RA 2A0BA 4JTCB 3KKBA 4ZLDA 1YYXA 7ICVA 3V5YA 5CI8A 4MVQA 9ICAA 3ZQYA 4M0AA 4X0BA 3RJFA 3T6JA 3JPQA 3NMIA 1FR0A 4FH5A 2XM4A 3FHDA 4CDYA 2YQYA 3DAGA 2FFHA 2NSGA 4QZGA 5BUOA 3CEXA 5CIVA 3EHNA 4P9FA 5J2IA 3U5SA 3EZIA 2CDQA 3ZWIA 3JPSA 1FFHA 4NC3A 9ICEA 3RYLA 2XLHA 2BCQA 9ICBA 2L9JA 2JX0A 2XXAA 4NTFA 1XSNA 4C3EA 4MVSA 1ZQUA 4UBCA 1ZQBA 2KQ9A 256BA 1D1CA 1CGNA 4WCWA 3C2MA 1MMAA 5BQIA 4J32B 2IBFA 2HUJA 3RVYA 2L81A 3FOPA 4M63A 4RD9A 2R7RA 3SNHA 4NLNA 1IZMA 3HNKA 1MNEA 1D1BA 3LEVA 1OCRC 3PCVA 3C63A 1Z6AA 5CFUA 4O5KA 1OR3A 2GA0A 2XL6A 2OG2A 3L8IA 2HMZA 2J9WA 1PCXA 1T9KA 1BPDA 3HNIA 4EBKA 1VYKA 8ICSA 4OD5A 1OU5A 2EPOA 2NRKA 5J2HA 2KNHA 5EGYA 4XPWA 2RSEB 2ZXPA 4YD1A 3ABLC 3GEHA 7ICQA 3WFQE 2JD3A 2H8AA 2HSQA 4YN4A 3TJ5A 1QLEC 4QZEA 4PK4A 1ZYRF 2YEVA 1WWPA 3ABMC 2VANA 3DM9B 2L7AA 1R89A 2WZLA 4XEKA 1SZIA 1YZAA 4LVSA 4RQ3A 4MQ9F 4UB5A 9ICPA 2EIMC 1ZJMA 4E17A 1H7IA 2BCUA 1R4TA 5KYUA 5TJ5E 4BG0A 5DS4A 1LE4A 1C17M 3IPMO 1A7EA 3O55A 5A6AA 4RQ8A 4M2YA 1QSPA 2LIGA 3R7CA 3L34A 3M79A 3J06A 5HRLA 3S90A 2HJMA 3HJCA 1KEJA 4F5OA 3V5ZA 4NM1A 2HS5A 3V7OA 4WJ0A 3LJBA 4AX2A 2VB6A 2PBEA 3C8GB 1NO5A 4KB6A 4OINF 2Q3TA 1YYJA 5DBBA 2A6EF 5HRKA 1LI7A 1WOTA 1HUOA 1OCZC 3RJIA 3LK9A 3H65A 1M6TA 2TMVP 1VK5A 4YL1A 3NMKA 4O9MA 3LLKA 2KJGA 2QNLA 2J7PA 7ICUA 5HRBA 3HIYA 4N4WA 5B3QA 2FAPB 1NSGB 3VAYA 1A7VA 4YT4A 2W45A 4K4GA 2B0HA 3KH2A 3NYLA 3ASNC 3EZHA 3C5FA 4NKUA 1LKXA 1ZHYA 4UB4A 5IILA 2I8BA 5B1BC 2ZH4A 3H2VA 2W9MA 4YWQA 4BJ6A 1KDHA 2EPNA 2HJ3A 9ICGA 8ICYA 2WVNA 9ICNA 4W8KA 4XPYA 2Y3HA 2PXIA 1M2VB 3GEIA 3ZQVA 4YJWA 3AQCA 5T3WA 2LD6A 2DRAA 4WC7A 5HHHA 2WB7A 5DB8A 5DQTA 1BR2A 2XS1A 8ICZA 4KLIA 4UAYA 3K33A 5J0PA 3JPNA 5J0OA 4PHEA 4RT3A 4AL0A 2NG1A 2ASRA 2OOCA 2Q9CA 8ICJA 5JS5A 8ICLA 3Q7LA 3S29A 2R7UA 4U9DA 4O5CA 3U3FA 1ZQKA 5J0YA 4M9NA 3GEEA 2L6HA 2BE3A 3EH2A 3POVA 1BPBA 5IY5C 2IHOA 2ZH6A 1PV3A 3WFOA 4O5EA 3HLZA 3AU2A 1OCOC 4I2FA 4E18A 2XLVA 1G5ZA 3MYFA 1TVAA 4DOCA 4Z9HA 3B71A 1YARO 2XLEA 4UB1A 2QTVA 1ZQZA 5K0IA 5IINA 1H9TA 2BC5A 3AQMA 4PJNA 3RH3A 2BL2A 1NOMA 4WC4A 3DD7A 4MTFA 1TFYA 3AGUA 4Q4ZF 3B9QA 2P7VA 2YVKA 1Q79A 3JCFA 1YA7O 5HRGA 4EEBA 1ZQAA 4UD4A 4BJ5A 4RT2A 1VFGA 4O6YA 5DBAA 1TWCA 2Q7RA 1RZTA 3N2ZB 3JRMO 4AT9B 4X4VA 1ZQHA 8ICOA 4CS9A 2B56A 4RQ2A 1WOLA 2CGEA 9ICFA 5DVWA 1ST6A 4NM2A 2WVOA 4YCXA 4O6AA 5J0TA 4I1MA 1S05A 3UQ2A 3JRTA 1AUEA 4YMMA 4RQ7A 1C02A 1NG1A 1MMNA 1YZCA 1R8CA 5BPCA 2G3VA 2R7SA 8ICXA 3S0XA 2YL0A 1GM5A 1ZQYA 2KYHA 4KLFA 2DYRC 5DQZA 4FO6A 4I29A 4M9HA 2XL4A 4CS7A 3WFPA 3GWNA 3U2LA 4X4TA 1RKEA 1MQ3A 1RMVA 2YL7A 1TFKB 3RJJA 4U5HA 3GWLA 5CHEA 2M2VA 5JLIA 9ICMA 5JTGA 2NPUA 2VH3A 4BPMA 2LP4A 1MMGA 4PPXA 1LS4A 3TOLA 4Q5SF 1K04A 4IGGA 4KLUA 3HJ4A 1SMYF 2HSBA 1ZHZA 2FMSA 1ZQVA 9ICVA 2MHRA 4DOAA 1Z3IX 4HFFB 4QZFA 4M9GA 2HV6A 4F5QA 3K66A 4AT7B 2DGJA 4ANJA 2IXOA 1UEUA 1ZQCA 4KLMA 4E80A 4XTKA 1C03A
chains in the Genus database with same CATH topology
4RQ1A 3GM3A 4YMNA 4FHPA 7ICVA 4IQWA 4EP7A 4QZAA 2BCSA 4E8FA 9ICAA 9ICHA 5DDYA 4M0AA 4X0BA 3RJFA 4I2CA 3JPQA 4FH5A 4M5DA 4R65A 3OGUA 1ZZPA 3AQKA 5CWRA 3RQEA 9ICRA 4FHXA 4FHYA 8ICNA 4QZGA 4RQ4A 5J2IA 3AU6A 1KTMA 3JPSA 8ICWA 2HHPA 8ICGA 9ICCA 4YMOA 1YLQA 9ICEA 2BCQA 2GWSA 3V72A 9ICBA 4RWPA 3MDCA 4WC6A 1ZQWA 2JX0A 1JN3A 3PMNA 1XSNA 4KLDA 4PGYA 8ICQA 3PMLA 1ZQUA 3HX0A 4PH5A 4UBCA 1ZQBA 4KLTA 4M47A 4GXIA 4WCWA 2DVIA 3C2MA 4WBZA 3L8JA 3B0YA 2ZH9A 1R8AA 3TFSA 8ICEA 4NLZA 1TV9A 1ZQPA 5DB7A 1OW6A 4I2HA 2DRBA 5HREA 3H39A 4XQ8A 5IIMA 3RH4A 1BPEA 4X4UA 4X0AA 4NLNA 5CR0A 4MFAA 1MQ2A 5DB9A 3MFNA 4IQVA 4R64A 3H37A 5HC9A 1UEVA 1XSPA 4R32A 5IIJA 3OVAA 4O5KA 3ISCA 3V7LA 3RJHA 1ZQSA 4I2AA 4PHDA 3L8IA 1Q78A 3JPOA 1BPDA 4UD5A 9ICWA 4EBKA 4TURA 8ICSA 4WC2A 4PGQA 4XA5A 2ISPA 3UPQA 3JPRA 1OU5A 2NRKA 3OV7A 5J2HA 4IG8A 4P4PA 4YD2A 1VJ7A 1MIWA 4X4RA 4P2HA 4YD1A 2M2WA 1JQRA 2O1PA 3OUYB 5F28E 4UAZA 7ICQA 3WFQE 1TFWA 3NYBA 7ICPA 4YN4A 8ICBA 8ICHA 2DR7A 7ICSA 4QZEA 3OUYA 5DKWA 5BOLA 1ZQNA 7ICTA 1KNYA 1WWPA 2ZHBA 2VANA 9ICXA 1R89A 4GXJA 4XEKA 9ICLA 4Z6EA 4NXZA 4R66A 4I28A 3GM1A 4P4MA 4LVSA 4RQ3A 3V7KA 4UB5A 1BPXA 9ICPA 1HUZA 2JPUA 2PFQA 1ZJMA 4WC5A 2ZH5A 7ICFA 2BCUA 5BOMA 3K7DA 4RPZA 4X4NA 4LZDA 2DR8A 5D4BA 2M2TA 4ATBB 4I27A 4M04A 4Z6CA 3C2LA 4RQ8A 4M2YA 5HRFA 5DDMA 5J2AA 4QZHA 4S3NA 3GDXA 4I2EA 4ATBA 3C8GD 4NLKA 5J2EA 4RQ5A 5HRLA 4WC0A 4F5NA 5J2FA 1KEJA 4I2JA 3GM2A 4F5OA 7ICRA 2ISOA 4NM1A 2LK4A 7ICJA 3RJKA 4EBJA 1JAJA 4QZ8A 3MDAA 2PBEA 3TULA 4MFFA 3C8GB 1NO5A 8ICAA 4XUSA 5DECA 1ZQXA 1PX5A 3C8GA 5DBBA 5HRKA 3MGIA 1WOTA 3HJ1A 1HUOA 4PGXA 3RJIA 3LK9A 2L6GA 7ICEA 3LQCB 1ZJNA 4WC3A 9ICOA 4R63A 1OW7A 4UAWA 4DOBA 4M9JA 4O9MA 7ICIA 3TFRA 3UXNA 4KLOA 4M9LA 4FHVA 3UPSA 5J2BA 4K4IA 7ICUA 2ID1A 2ZH1A 5HRBA 3HIYA 8ICCA 1ZQGA 2I9GA 1ZQRA 4LZGA 7ICOA 4RPXA 4KLQA 4RQ6A 1WTYA 4MF8A 4K4GA 5J2DA 3JPPA 2KK1A 1O3UA 1ZQFA 2Q00A 3UQ0A 3C5FA 2FMPA 4NKUA 1ZQTA 4UB4A 5J0SA 4KLHA 3K75D 5IILA 4IQTA 3U0CA 2ZH4A 3WFSC 2W9MA 1KDHA 4MFCA 9ICGA 3BRJA 3RJEA 8ICYA 4RQ0A 7ICHA 4NQFA 4RPYA 4I2GA 4JWNA 5HHIA 9ICNA 1V4AA 1K40A 2PXIA 2IHMA 9ICTA 4X4OA 4KLLA 2ZHAA 2M2UA 5EOZA 4E7XA 3RJGA 5HRHA 4F5PA 2DRAA 3V7JA 4WC7A 3JPTA 5HHHA 4XEVA 4X4QA 4Z6DA 5DB8A 2BCRA 1ZQQA 8ICZA 4KLIA 4UAYA 1R8BA 8ICIA 5J0PA 3JPNA 5J0OA 4PHEA 4PHPA 3HWTA 4QZ9A 4RT3A 4RWOA 1OW8A 7ICNA 5CA7A 9ICJA 1F5AA 8ICJA 5D49A 8ICPA 2ZH7A 8ICLA 3OVSA 1UETA 3RH5A 3ISDA 4O5CA 3U3FA 4UB2A 3AQNA 1ZQMA 5J0YA 1ZQKA 5IIIA 4QZCA 4M9NA 4X4PA 2ZH8A 2ZH3A 5J0XA 2BE3A 2L6HA 2O5AA 4FH3A 1ZQDA 5J2GA 1BPBA 2ZH6A 1PV3A 3C2KA 3UXPA 3WFOA 1BPYA 2PFOA 4O5EA 9ICIA 2P66A 3AU2A 4I2FA 5DB6A 3RQFA 2BPCA 7ICLA 5CP2A 4QZIA 4DOCA 1TVAA 1ZQLA 4I2DA 5D46A 4KLGA 4TUPA 3B71A 4DO9A 4IQUA 2YWAA 4UB1A 1ZQZA 2BPFA 4WBYA 5IINA 3ISBA 5J2CA 2FMQA 2BCVA 3AQMA 4RWQA 2DR9A 5J0RA 5HRDA 4F5RA 1NOMA 4NY8A 4WC4A 4NKTA 4XEFA 4Z6FA 3H38A 1TFYA 1UFBA 8ICUA 3AJMA 8ICVA 4QZDA 8ICFA 1Q79A 5HRGA 2ZH2A 4KLSA 5F2VO 1ZQAA 9ICKA 1FA0A 4UD4A 4QZBA 4RT2A 1VFGA 4I2IA 3RQGA 5DBAA 1K05A 4JWMA 4KLJA 5J0WA 1RZTA 1ZQIA 3C5GA 5J0QA 5CB1A 4AT9B 4X4VA 1RPLA 1ZQHA 8ICOA 4X4SA 4RQ2A 1WOLA 3WFRE 9ICFA 5HR9A 4I2BA 4UBBA 4NM2A 3PNCA 7ICKA 8ICKA 4AT9A 4YCXA 4K4HA 3RH6A 3C18A 4WC1A 5J0TA 5CJ7A 3UQ2A 5J2KA 2DR5A 1MIYA 9ICQA 1JOGA 4YMMA 3O10A 4RQ7A 5DEDA 2RFFA 1R8CA 1ZQEA 5BPCA 9ICUA 3AQLA 8ICXA 5J0UA 4UB3A 4XQ7A 4P4OA 1ZQYA 4GXKA 5J2JA 1ZQJA 3C66A 4KLFA 4M9HA 4FO6A 4I29A 2Q66A 3WFPA 8ICMA 5IIOA 2PFPA 8ICRA 1QVXA 3HW8A 1ZQOA 4MF2A 9ICSA 4X4TA 1MQ3A 3B0XA 3RJJA 3JYYA 2M2VA 3MGHA 7ICGA 9ICMA 5J29A 4FHWA 1BPZA 4TUQA 2BPGA 3H3AA 4TUSA 4PPXA 4X5VA 1K04A 4AT8B 4LT6A 3L9DA 1JMSA 5IIKA 4XRHA 3MBYA 4KLUA 7ICMA 3HJ4A 5HRIA 1XSLA 2PFNA 5CHGA 2HSBA 4AT8A 2FMSA 4KLEA 1ZQVA 9ICVA 4RWNA 4DOAA 8ICTA 4QZFA 4M9GA 3AUOA 4F5QA 3S9OA 1MIVA 4AT7B 5DBCA 1UEUA 1ZQCA 5TZVA 4KLMA 2L6FA 4AT7A 3OVBA 3UXOA 4E80A 3JZ0A 4PHAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RQ1 A;  3GM3 A;  4YMN A;  4FHP A;  7ICV A;  4IQW A;  4EP7 A;  4QZA A;  2BCS A;  4E8F A;  9ICA A;  9ICH A;  5DDY A;  4M0A A;  4X0B A;  3RJF A;  4I2C A;  3JPQ A;  4FH5 A;  4M5D A;  4R65 A;  3OGU A;  1ZZP A;  3AQK A;  5CWR A;  3RQE A;  9ICR A;  4FHX A;  4FHY A;  8ICN A;  4QZG A;  4RQ4 A;  5J2I A;  3AU6 A;  1KTM A;  3JPS A;  8ICW A;  2HHP A;  8ICG A;  9ICC A;  4YMO A;  1YLQ A;  9ICE A;  2BCQ A;  2GWS A;  3V72 A;  9ICB A;  4RWP A;  3MDC A;  4WC6 A;  1ZQW A;  2JX0 A;  1JN3 A;  3PMN A;  1XSN A;  4KLD A;  4PGY A;  8ICQ A;  3PML A;  1ZQU A;  3HX0 A;  4PH5 A;  4UBC A;  1ZQB A;  4KLT A;  4M47 A;  4GXI A;  4WCW A;  2DVI A;  3C2M A;  4WBZ A;  3L8J A;  3B0Y A;  2ZH9 A;  1R8A A;  3TFS A;  8ICE A;  4NLZ A;  1TV9 A;  1ZQP A;  5DB7 A;  1OW6 A;  4I2H A;  2DRB A;  5HRE A;  3H39 A;  4XQ8 A;  5IIM A;  3RH4 A;  1BPE A;  4X4U A;  4X0A A;  4NLN A;  5CR0 A;  4MFA A;  1MQ2 A;  5DB9 A;  3MFN A;  4IQV A;  4R64 A;  3H37 A;  5HC9 A;  1UEV A;  1XSP A;  4R32 A;  5IIJ A;  3OVA A;  4O5K A;  3ISC A;  3V7L A;  3RJH A;  1ZQS A;  4I2A A;  4PHD A;  3L8I A;  1Q78 A;  3JPO A;  1BPD A;  4UD5 A;  9ICW A;  4EBK A;  4TUR A;  8ICS A;  4WC2 A;  4PGQ A;  4XA5 A;  2ISP A;  3UPQ A;  3JPR A;  1OU5 A;  2NRK A;  3OV7 A;  5J2H A;  4IG8 A;  4P4P A;  4YD2 A;  1VJ7 A;  1MIW A;  4X4R A;  4P2H A;  4YD1 A;  2M2W A;  1JQR A;  2O1P A;  3OUY B;  5F28 E;  4UAZ A;  7ICQ A;  3WFQ E;  1TFW A;  3NYB A;  7ICP A;  4YN4 A;  8ICB A;  8ICH A;  2DR7 A;  7ICS A;  4QZE A;  3OUY A;  5DKW A;  5BOL A;  1ZQN A;  7ICT A;  1KNY A;  1WWP A;  2ZHB A;  2VAN A;  9ICX A;  1R89 A;  4GXJ A;  4XEK A;  9ICL A;  4Z6E A;  4NXZ A;  4R66 A;  4I28 A;  3GM1 A;  4P4M A;  4LVS A;  4RQ3 A;  3V7K A;  4UB5 A;  1BPX A;  9ICP A;  1HUZ A;  2JPU A;  2PFQ A;  1ZJM A;  4WC5 A;  2ZH5 A;  7ICF A;  2BCU A;  5BOM A;  3K7D A;  4RPZ A;  4X4N A;  4LZD A;  2DR8 A;  5D4B A;  2M2T A;  4ATB B;  4I27 A;  4M04 A;  4Z6C A;  3C2L A;  4RQ8 A;  4M2Y A;  5HRF A;  5DDM A;  5J2A A;  4QZH A;  4S3N A;  3GDX A;  4I2E A;  4ATB A;  3C8G D;  4NLK A;  5J2E A;  4RQ5 A;  5HRL A;  4WC0 A;  4F5N A;  5J2F A;  1KEJ A;  4I2J A;  3GM2 A;  4F5O A;  7ICR A;  2ISO A;  4NM1 A;  2LK4 A;  7ICJ A;  3RJK A;  4EBJ A;  1JAJ A;  4QZ8 A;  3MDA A;  2PBE A;  3TUL A;  4MFF A;  3C8G B;  1NO5 A;  8ICA A;  4XUS A;  5DEC A;  1ZQX A;  1PX5 A;  3C8G A;  5DBB A;  5HRK A;  3MGI A;  1WOT A;  3HJ1 A;  1HUO A;  4PGX A;  3RJI A;  3LK9 A;  2L6G A;  7ICE A;  3LQC B;  1ZJN A;  4WC3 A;  9ICO A;  4R63 A;  1OW7 A;  4UAW A;  4DOB A;  4M9J A;  4O9M A;  7ICI A;  3TFR A;  3UXN A;  4KLO A;  4M9L A;  4FHV A;  3UPS A;  5J2B A;  4K4I A;  7ICU A;  2ID1 A;  2ZH1 A;  5HRB A;  3HIY A;  8ICC A;  1ZQG A;  2I9G A;  1ZQR A;  4LZG A;  7ICO A;  4RPX A;  4KLQ A;  4RQ6 A;  1WTY A;  4MF8 A;  4K4G A;  5J2D A;  3JPP A;  2KK1 A;  1O3U A;  1ZQF A;  2Q00 A;  3UQ0 A;  3C5F A;  2FMP A;  4NKU A;  1ZQT A;  4UB4 A;  5J0S A;  4KLH A;  3K75 D;  5IIL A;  4IQT A;  3U0C A;  2ZH4 A;  3WFS C;  2W9M A;  1KDH A;  4MFC A;  9ICG A;  3BRJ A;  3RJE A;  8ICY A;  4RQ0 A;  7ICH A;  4NQF A;  4RPY A;  4I2G A;  4JWN A;  5HHI A;  9ICN A;  1V4A A;  1K40 A;  2PXI A;  2IHM A;  9ICT A;  4X4O A;  4KLL A;  2ZHA A;  2M2U A;  5EOZ A;  4E7X A;  3RJG A;  5HRH A;  4F5P A;  2DRA A;  3V7J A;  4WC7 A;  3JPT A;  5HHH A;  4XEV A;  4X4Q A;  4Z6D A;  5DB8 A;  2BCR A;  1ZQQ A;  8ICZ A;  4KLI A;  4UAY A;  1R8B A;  8ICI A;  5J0P A;  3JPN A;  5J0O A;  4PHE A;  4PHP A;  3HWT A;  4QZ9 A;  4RT3 A;  4RWO A;  1OW8 A;  7ICN A;  5CA7 A;  9ICJ A;  1F5A A;  8ICJ A;  5D49 A;  8ICP A;  2ZH7 A;  8ICL A;  3OVS A;  1UET A;  3RH5 A;  3ISD A;  4O5C A;  3U3F A;  4UB2 A;  3AQN A;  1ZQM A;  5J0Y A;  1ZQK A;  5III A;  4QZC A;  4M9N A;  4X4P A;  2ZH8 A;  2ZH3 A;  5J0X A;  2BE3 A;  2L6H A;  2O5A A;  4FH3 A;  1ZQD A;  5J2G A;  1BPB A;  2ZH6 A;  1PV3 A;  3C2K A;  3UXP A;  3WFO A;  1BPY A;  2PFO A;  4O5E A;  9ICI A;  2P66 A;  3AU2 A;  4I2F A;  5DB6 A;  3RQF A;  2BPC A;  7ICL A;  5CP2 A;  4QZI A;  4DOC A;  1TVA A;  1ZQL A;  4I2D A;  5D46 A;  4KLG A;  4TUP A;  3B71 A;  4DO9 A;  4IQU A;  2YWA A;  4UB1 A;  1ZQZ A;  2BPF A;  4WBY A;  5IIN A;  3ISB A;  5J2C A;  2FMQ A;  2BCV A;  3AQM A;  4RWQ A;  2DR9 A;  5J0R A;  5HRD A;  4F5R A;  1NOM A;  4NY8 A;  4WC4 A;  4NKT A;  4XEF A;  4Z6F A;  3H38 A;  1TFY A;  1UFB A;  8ICU A;  3AJM A;  8ICV A;  4QZD A;  8ICF A;  1Q79 A;  5HRG A;  2ZH2 A;  4KLS A;  5F2V O;  1ZQA A;  9ICK A;  1FA0 A;  4UD4 A;  4QZB A;  4RT2 A;  1VFG A;  4I2I A;  3RQG A;  5DBA A;  1K05 A;  4JWM A;  4KLJ A;  5J0W A;  1RZT A;  1ZQI A;  3C5G A;  5J0Q A;  5CB1 A;  4AT9 B;  4X4V A;  1RPL A;  1ZQH A;  8ICO A;  4X4S A;  4RQ2 A;  1WOL A;  3WFR E;  9ICF A;  5HR9 A;  4I2B A;  4UBB A;  4NM2 A;  3PNC A;  7ICK A;  8ICK A;  4AT9 A;  4YCX A;  4K4H A;  3RH6 A;  3C18 A;  4WC1 A;  5J0T A;  5CJ7 A;  3UQ2 A;  5J2K A;  2DR5 A;  1MIY A;  9ICQ A;  1JOG A;  4YMM A;  3O10 A;  4RQ7 A;  5DED A;  2RFF A;  1R8C A;  1ZQE A;  5BPC A;  9ICU A;  3AQL A;  8ICX A;  5J0U A;  4UB3 A;  4XQ7 A;  4P4O A;  1ZQY A;  4GXK A;  5J2J A;  1ZQJ A;  3C66 A;  4KLF A;  4M9H A;  4FO6 A;  4I29 A;  2Q66 A;  3WFP A;  8ICM A;  5IIO A;  2PFP A;  8ICR A;  1QVX A;  3HW8 A;  1ZQO A;  4MF2 A;  9ICS A;  4X4T A;  1MQ3 A;  3B0X A;  3RJJ A;  3JYY A;  2M2V A;  3MGH A;  7ICG A;  9ICM A;  5J29 A;  4FHW A;  1BPZ A;  4TUQ A;  2BPG A;  3H3A A;  4TUS A;  4PPX A;  4X5V A;  1K04 A;  4AT8 B;  4LT6 A;  3L9D A;  1JMS A;  5IIK A;  4XRH A;  3MBY A;  4KLU A;  7ICM A;  3HJ4 A;  5HRI A;  1XSL A;  2PFN A;  5CHG A;  2HSB A;  4AT8 A;  2FMS A;  4KLE A;  1ZQV A;  9ICV A;  4RWN A;  4DOA A;  8ICT A;  4QZF A;  4M9G A;  3AUO A;  4F5Q A;  3S9O A;  1MIV A;  4AT7 B;  5DBC A;  1UEU A;  1ZQC A;  5TZV A;  4KLM A;  2L6F A;  4AT7 A;  3OVB A;  3UXO A;  4E80 A;  3JZ0 A;  4PHA A; 
#chains in the Genus database with same CATH topology
 1NFO A;  4XPX A;  5KYW B;  3DE9 A;  3T4R A;  4IQW A;  4QZA A;  3IQT A;  5JP7 A;  2WVQ A;  2XSE A;  3Q7G A;  4I2C A;  1BR1 A;  3DE8 A;  1ZZP A;  3AQK A;  3LLI A;  5AGF A;  4FHX A;  5F5F A;  1VLT A;  3CAX A;  3RKO F;  4N6C A;  4U5C E;  3I5Q A;  1KTM A;  1WAS A;  8ICW A;  2PX3 A;  5L0C A;  2FCL A;  1YLQ A;  2OJQ A;  4OIR F;  4RWP A;  1ZW3 A;  3O6X A;  2J7P D;  3U3B A;  3PDM P;  1AVO B;  3PML A;  3ECS A;  3HX0 A;  4PH5 A;  5A6J A;  5HSW A;  3TOM A;  2GAQ A;  1Z5Z A;  3ZSU A;  4EHP A;  3B0Y A;  1R8A A;  4NLZ A;  5L3Q A;  1OW6 A;  4XQ8 A;  4N06 A;  1AEP A;  4QI0 A;  3EG9 B;  4MFA A;  4R64 A;  3H37 A;  1J8M F;  3RVZ A;  2P6V A;  4WH5 A;  2YZS A;  5IIJ A;  4PJL A;  3ZIB A;  3LS0 A;  3ISC A;  2WZF A;  1YAU O;  1ZQS A;  4I2A A;  3US6 A;  2R9R B;  1ORS C;  4J7Y A;  4K8V A;  3OA1 A;  3QTH A;  3GOD A;  3JPO A;  3SXM A;  5JRA A;  4UD5 A;  4TUR A;  1Q0F A;  4WC2 A;  1S7Z A;  2OKU A;  3JPR A;  3OV7 A;  3AG2 C;  3EH1 A;  3KL4 A;  5T3T A;  2BBH A;  4P2H A;  2AP3 A;  2HZ8 A;  3OUY B;  5F28 E;  1B68 A;  4XQ1 A;  1TFW A;  7ICP A;  2KSF A;  2EIK C;  5D92 A;  8ICB A;  8ICH A;  2DR7 A;  7ICS A;  1WN0 A;  3S27 A;  7ICT A;  3LS1 A;  1KNY A;  2G62 A;  1OXK A;  3GAN A;  4BEJ A;  4GXJ A;  4CDV A;  4NXZ A;  4R66 A;  4KC9 A;  4I28 A;  1E84 A;  1E85 A;  2EIN C;  3VYW A;  3V7K A;  3HTK C;  1BPX A;  1T5O A;  4IAR A;  4YN0 B;  5JVE A;  2G3K A;  3K7D A;  3S84 A;  4X4N A;  4X0R A;  2DR8 A;  1ZHW A;  3O39 A;  5KYX B;  3EGX B;  5D62 A;  2OEV A;  4S3N A;  4FAP B;  5J2E A;  4RQ5 A;  4WC0 A;  1EI7 A;  3TK0 A;  5J2F A;  3AG1 C;  3GM2 A;  3NWI A;  1NU9 C;  3N24 A;  2LK4 A;  1HE1 A;  1JAJ A;  1RJ9 B;  2YLI A;  1OR2 A;  4J30 B;  5DEC A;  1FNT c;  3QW0 A;  2J9V A;  1ZQX A;  1PX5 A;  1H6G A;  3Q6N A;  3C8G A;  3ABK C;  4C7O B;  3HJ1 A;  3MCR A;  1Y6D A;  2Y3G A;  2OQM A;  4BJ6 C;  3FAP B;  4LER A;  3LNR A;  4O6N A;  3W2V A;  4M9J A;  4DOB A;  7ICI A;  1D0Y A;  2B4V A;  2J46 A;  3TFR A;  4KLO A;  3UPS A;  3EFO B;  1VB5 A;  2ZH1 A;  3ER8 C;  5E3C A;  5COM A;  1ZQR A;  1YVI A;  4DJ9 A;  7ICO A;  5L0J A;  4KLQ A;  3G50 A;  3DZA A;  4ONS A;  1M57 C;  5DLJ A;  4N6H A;  1I4Z A;  4MF8 A;  4PR9 A;  1FTS A;  5JSL A;  5J2D A;  2Q00 A;  3UQ0 A;  2R7V A;  3DAF A;  3M4B A;  3WFS C;  4I0U A;  4EIY A;  2R7X A;  3OEO A;  3DKA A;  2LFF A;  3BRJ A;  4XLP F;  3EHM A;  4RQ0 A;  4JWN A;  4U9E A;  5HHI A;  1K40 A;  2W9Y A;  9ICT A;  1IW7 F;  2PX0 A;  3K1H A;  2WL8 A;  3LAY A;  4EV6 A;  2ZHA A;  2P61 A;  1TKN A;  3WOD F;  3RJG A;  1JAF A;  5HRH A;  3V7J A;  4XEV A;  3U2M A;  1OW8 A;  7ICN A;  5CA7 A;  2ZPA A;  9ICJ A;  4U5E E;  5D49 A;  4YT8 A;  1QZX A;  1UET A;  3RH5 A;  2Y3D A;  3RIP A;  3IQC A;  3ZG1 A;  2R7Q A;  2O5A A;  4FH3 A;  4P9T A;  4BJ5 C;  3C2K A;  2PNO A;  3UXP A;  4MVO A;  1BPY A;  2PFO A;  5D63 A;  2R7W A;  3T9O A;  2J8W A;  3F47 A;  4K1O A;  4CS9 C;  1O5H A;  4JLX A;  5DB6 A;  2YRF A;  2R7T A;  1ZQL A;  4I2D A;  5L3V A;  1D0Z A;  4KLG A;  4TUP A;  1JPJ A;  4FES A;  5FZT A;  2YWA A;  3ER9 B;  1FMW A;  4JJF A;  3C62 A;  1GQA A;  5HV9 A;  5CI9 A;  3VM6 A;  3JSZ A;  5J2C A;  2A1D D;  2YLD A;  4BEM J;  5J0R A;  4F5R A;  2X51 A;  4NY8 A;  8ICU A;  3AJM A;  8ICV A;  4LDK A;  1HW2 A;  1CGO A;  9ICK A;  1FA0 A;  3RQG A;  5J0W A;  1ZQI A;  5J0Q A;  5CB1 A;  1MMD A;  4X4S A;  2BE5 F;  2OU6 A;  1BDJ B;  3NMJ A;  5HR9 A;  4I2B A;  1FMV A;  1G4W R;  4AT9 A;  1RCP A;  3RH6 A;  3C18 A;  2DR5 A;  3SP1 A;  3O10 A;  5DED A;  5B1A C;  2NUT B;  1GGQ A;  3I4U A;  1ZQE A;  4EBB A;  2KW3 C;  4UB3 A;  4P4O A;  5J2J A;  1ZQJ A;  4IB4 A;  2H7B A;  4G7H F;  5L0I A;  3X2Q C;  4DBR A;  3HNJ A;  2Q66 A;  3RF3 A;  3EGD B;  2PFP A;  3HW8 A;  1ZQO A;  3LNM B;  3B0X A;  1CPQ A;  4MVU A;  4DOZ A;  3JYY A;  3MGH A;  1OXB A;  4JTA B;  3NKE A;  2XLW A;  1E86 A;  2BPG A;  4OAG A;  3H3A A;  3RFY A;  4X5V A;  3F46 A;  2Q4F A;  4AT8 B;  4LT6 A;  3L9D A;  4FO1 A;  1JMS A;  2KC3 A;  4I3M A;  2PFN A;  3B29 A;  5CHG A;  2P1A A;  3M1C B;  2AU5 A;  4U5F E;  2YHS A;  1RKC A;  3B0U X;  1SR2 A;  5TZV A;  2AWC A;  2L6F A;  2CNW A;  2B0J A;  4E7Z A;  4AT7 A;  3OVB A;  3JZ0 A;  2H7O A;  2OEX A;  4RQ1 A;  1ZU4 A;  2VAS A;  4YMN A;  5F5H A;  3SXK A;  4EP7 A;  3N0T A;  5KYW A;  4LEY A;  5B3I A;  3WG7 C;  3SXY A;  3W2W A;  2VCC A;  4C3D A;  4M5D A;  4R65 A;  4PJM A;  3ZTM A;  1T01 A;  5CWR A;  3RQE A;  9ICR A;  3LUT B;  8ICN A;  2XL8 A;  3MYI A;  2ZXO A;  4RQ4 A;  2LQG A;  3A9C A;  4CS8 A;  5E33 A;  1ORJ A;  2IM8 A;  4NXV A;  2Q9B A;  2HHP A;  3G4Z A;  9ICC A;  4YMO A;  4CIP A;  2MWQ A;  4OIO F;  3V72 A;  3MDC A;  3KYI A;  1ZQW A;  4CIH A;  2GFH A;  1LM3 B;  3PMR A;  4KLT A;  4M47 A;  3ERC C;  2DVI A;  2IYL D;  4WBZ A;  2ZH9 A;  4A2N B;  8ICE A;  4G78 A;  1TV9 A;  1ZQP A;  5DB7 A;  2XLM A;  2HMQ A;  4JEB A;  4OIP F;  4CSA A;  2DRB A;  3H39 A;  1BPE A;  1JRA A;  4X4U A;  4X0A A;  3B0P A;  5CR0 A;  2YL3 A;  3GOR A;  4K96 A;  1MQ2 A;  4NTB A;  4K98 A;  5DB9 A;  1OKK A;  4G7O F;  1ZVZ A;  3EG9 A;  3HKK A;  1XSP A;  3WAQ A;  4R32 A;  1U0B B;  3QZC A;  1JMW A;  4K97 A;  1NZE A;  4YK5 A;  2DB4 A;  1YLM A;  3U9J A;  2IXM A;  4D4X A;  3B0V C;  4Z9J A;  9ICW A;  4DRI B;  4DRH B;  4O7G A;  4PGQ A;  2ISP A;  4HEA J;  4KBL A;  4YD2 A;  4P4P A;  2X0C A;  2HV7 A;  1VJ7 A;  2M2W A;  1JQR A;  2O1P A;  5EHH A;  4B6I A;  3CZ6 A;  3OUY A;  2A69 F;  5DKW A;  1ZQN A;  4K9A A;  4JZA A;  2ZHB A;  3DMD A;  2UUI A;  5EK0 A;  9ICL A;  4YT2 A;  4HE8 D;  4P4M A;  2W4B A;  1QQ3 A;  4F4B A;  3HNL A;  2WZG A;  3RW0 A;  4CJO A;  2A6H F;  2ZD9 A;  3EJN A;  2JPU A;  2PFQ A;  2M4E A;  4XLN F;  5KYN A;  2ICW G;  7ICF A;  5BOM A;  2C04 A;  4I44 A;  4U5B E;  5D4B A;  1LE2 A;  2M2T A;  1I4Y A;  4ATB B;  4M04 A;  5HRF A;  5J2A A;  3S28 A;  5KYX A;  3EGX A;  4NLK A;  4LAC B;  3WHN A;  4D4N A;  4F5N A;  3NKD A;  5A69 A;  4I2J A;  1TWA A;  3JTL O;  2ISO A;  7ICJ A;  3QW1 A;  4QZ8 A;  4MFF A;  3VF0 A;  8ICA A;  1JR8 A;  1LVK A;  2MYS A;  3DM5 A;  1RJ9 A;  1U89 A;  4PJJ A;  4PGX A;  1TWH A;  2L6G A;  1Q0K A;  4K7B A;  7ICE A;  2A68 F;  4C7O A;  3LQC B;  1ZJN A;  3NKU A;  2PF4 E;  4R63 A;  1OW7 A;  2H7V C;  4UAW A;  4MS2 A;  4FHV A;  3JSE O;  4K4I A;  4DRJ B;  4UDV A;  3ZDL A;  4LZG A;  3EFO A;  3G4X A;  5KYY B;  4LEW A;  2KK1 A;  1Q0G A;  1VYI A;  2FMP A;  2GAF D;  4JIO A;  5J0S A;  3I5P A;  4KLH A;  3K75 D;  4IQT A;  3U0C A;  4MTG A;  1HE9 A;  1A41 A;  5B3P A;  3NYM A;  3C8Z A;  2VCB A;  4MFC A;  3AG3 C;  3OWG A;  4QDL A;  4NXT A;  7ICH A;  5COG A;  3U9M A;  1F1M A;  2AVK A;  4JKV A;  3TD7 A;  5EOZ A;  4E7X A;  1XZQ A;  4AE4 B;  3JPT A;  1GS9 A;  4X4Q A;  2BCR A;  1ZQQ A;  1OCC C;  2CNW D;  1R8B A;  8ICI A;  3CQZ A;  2YL1 A;  5AC4 A;  3DXJ F;  1TWG A;  2XRH A;  2ZH7 A;  2F22 A;  4NCQ A;  1VTM P;  3ISD A;  4UB2 A;  1JPN A;  3AQN A;  5FCL A;  1Y4C A;  2ZH3 A;  1ZQD A;  5A6B A;  4IAQ A;  2IUB A;  5DS6 A;  9ICI A;  4YL0 A;  2YLG A;  4PAC A;  2J0W A;  2GWW A;  1BR4 A;  2P66 A;  1WGW A;  4WAB A;  3FOO A;  4ER9 A;  3UR3 C;  3Q6M A;  3RQF A;  7ICL A;  2AWY A;  4P6I C;  5CP2 A;  1NFN A;  5D46 A;  1QKR A;  4DO9 A;  2IXN A;  2EWR A;  1VOM A;  3K1I A;  4U5D E;  4IQU A;  2Q9A A;  3T6G B;  1CPR A;  2BPF A;  2UUH A;  1D0X A;  2QE9 A;  2Y39 A;  3K6B A;  2QUP A;  2XLO A;  1A0B A;  4O79 A;  3C7J A;  3H38 A;  4Z6F A;  4QZD A;  8ICF A;  3W8I A;  4KLS A;  2OJE D;  4JJG A;  4QZB A;  1FFT C;  4I2I A;  2R03 A;  3IQ6 A;  2D4U A;  1NLX A;  1MQV A;  1OKK D;  1RPL A;  1M56 C;  3V5X A;  1HMD A;  2V26 A;  4LEV A;  4K4H A;  3QMK A;  1QPU A;  5CJ7 A;  5J2K A;  9ICQ A;  3M15 A;  1JOG A;  4NTA A;  1TFO B;  2Y69 C;  1APC A;  9ICU A;  3AQL A;  1Z7Q c;  2NUT A;  5J0U A;  4XQ7 A;  4JCH A;  4GXK A;  3C66 A;  2LFD A;  4JRZ A;  1ZU5 A;  1T6U A;  8ICM A;  5IIO A;  9ICS A;  1BBH A;  3EGD A;  4IAO A;  1M2V A;  3MLG A;  7ICG A;  2Z15 A;  5J29 A;  1R5I D;  1WAT A;  4NXX A;  2M64 A;  4TUS A;  4LLE A;  2Y3B A;  3FVY A;  4CX9 A;  2W4M A;  1D1A A;  2NUP B;  4MKP A;  1XSL A;  4MND A;  4AT8 A;  4OIQ F;  4RWN A;  4CS8 C;  1HMO A;  3DWW A;  4MVR A;  1XZP A;  3AUO A;  3S9O A;  1MIV A;  3PHZ A;  3EPV A;  5DBC A;  3EQL F;  2XM0 A;  4LDQ A;  2O9X A;  2QLA A;  1HW1 A;  3LEO A;  3UXO A;  4G0H A;  4PHA A;  4FX5 A;  1VLS A;  3GM3 A;  3FDQ A;  4FHP A;  2LCH A;  1LIH A;  3NVO A;  4O69 A;  2HN2 A;  2PP4 A;  2BCS A;  4OAF A;  3OWT A;  4E8F A;  9ICH A;  5DDY A;  1PD1 A;  3ATP A;  4O68 A;  1MND A;  3OGU A;  1EQ1 A;  4CSA C;  5E3A A;  3EF2 A;  4WQK A;  4I1O B;  4FHY A;  2A0U A;  5BQG A;  1PD0 A;  3UMH A;  1UG7 A;  3AU6 A;  3UNG C;  4CJG A;  3QVY A;  4AL1 A;  2J9B A;  8ICG A;  2XXA B;  4JEA A;  2GWS A;  3ZVR A;  4WC6 A;  1JN3 A;  3PMN A;  2FGY A;  2D5R B;  4KLD A;  4PGY A;  8ICQ A;  1O87 A;  1EKY A;  2PFD A;  2IXP A;  4RDA A;  1ORY A;  4GXI A;  4JVS A;  3L8J A;  5GPG B;  3TFS A;  3E70 C;  1SYQ A;  4HX0 A;  2J0X A;  4I2H A;  4Z9I A;  5HRE A;  4NY3 A;  4L6R A;  5IIM A;  3RH4 A;  2R05 A;  5A6K A;  2LSE A;  3R2P A;  4JUR I;  3W8H A;  3MFN A;  4IQV A;  5HC9 A;  1UEV A;  1YA9 A;  3OVA A;  3V7L A;  1TR2 A;  3RJH A;  4IRU A;  3ZC4 A;  4PHD A;  4NXW A;  3AOU A;  1DOW A;  1Q78 A;  4DVY P;  1G8X A;  4XWJ A;  2EPM X;  4KM5 A;  2BBJ A;  1OQC A;  3DI5 A;  4XA5 A;  3SYN A;  3UPQ A;  3MBG A;  4EGW A;  4IG8 A;  3SZR A;  2VC9 A;  1MIW A;  4X4R A;  4MVM A;  1ZW2 A;  1A7D A;  3T6B A;  4UAZ A;  3NYB A;  4LLC A;  4GYT A;  3ITF A;  5BOL A;  2ZXW C;  1EA8 A;  2EIJ C;  1NBB A;  3NYJ A;  3UGP A;  9ICX A;  1E2X A;  1CGM E;  2CW0 F;  2EPL X;  4Z6E A;  3GM1 A;  1XWJ A;  2I15 A;  3ZTZ A;  2YKZ A;  5A6B D;  4K99 A;  3KMI A;  5T1D B;  5KYU B;  1HUZ A;  4WC5 A;  2XS8 A;  4K0D A;  2ZH5 A;  3TQO A;  4RPZ A;  4LZD A;  4I27 A;  4Z6C A;  3C2L A;  1FAP B;  5DDM A;  4PFP A;  4QZH A;  3GDX A;  4I2E A;  4ATB A;  3C8G D;  2V3C C;  3UMI A;  3AQB A;  4U5G A;  7ICR A;  2E87 A;  1E83 A;  3H2U A;  1T6Q A;  4Q7C A;  4EKW A;  5D61 A;  3RJK A;  4EBJ A;  4MTO A;  2EIL C;  3AGT A;  3JCU Q;  3MDA A;  3TUL A;  3IEE A;  4XUS A;  1VMA A;  3JYH A;  2DYS C;  4KNV A;  3SXZ A;  5JUA A;  3MGI A;  2R7O A;  4WGZ A;  2GDC A;  4MW3 A;  3U8P A;  4EWC A;  4NXU A;  4WC3 A;  9ICO A;  3W4Y A;  3UXN A;  4BJT A;  4M9L A;  5J2B A;  2ID1 A;  3JT1 A;  3M4C A;  3X1O A;  1SF8 A;  8ICC A;  3FAJ A;  3DJN B;  1ZQG A;  2I9G A;  4HFK B;  4RPX A;  1W2W A;  1YJG A;  5D91 A;  4RQ6 A;  4H54 A;  1WTY A;  4LDR A;  3IQ5 A;  2R25 A;  3KPH A;  5CFT A;  3BEH A;  3JPP A;  1O3U A;  5KYY A;  1ZQF A;  4YL3 A;  3QVZ A;  1ZQT A;  3PHF 2;  3ASO C;  4H4K C;  4E0H A;  2HN1 A;  1ZHX A;  4JCZ A;  2C03 A;  3DJU B;  3L0I A;  4J7T A;  5DS5 A;  3RJE A;  4NQF A;  4RPY A;  4I2G A;  3CK6 A;  4IJJ A;  3UMK A;  1V4A A;  5CFS A;  5JT4 A;  4MVZ A;  4C3B A;  5L0F A;  4ULW A;  2IHM A;  4X4O A;  1Q0M A;  4WGY A;  4KLL A;  2M2U A;  4PFO A;  1Z23 A;  1V54 C;  4F5P A;  1H9G A;  1G4U S;  2QY9 A;  3LES A;  4DBQ A;  4Z6D A;  4E7S A;  4JC7 A;  4AE4 A;  3K1I C;  1U6H A;  4PHP A;  3HWT A;  1LPE A;  4QZ9 A;  4RWO A;  4DVZ A;  2R02 A;  3KYJ A;  1F5A A;  1GPJ A;  8ICP A;  3VRC A;  3U8V A;  3OVS A;  1I5N A;  2J9U A;  1ZQM A;  5III A;  4QZC A;  4X4P A;  2ZH8 A;  4JW1 A;  5J0X A;  1T6I A;  4EED A;  1TQG A;  4G7Z F;  3FXH A;  1KU2 A;  3NRH A;  5J2G A;  5L0H A;  2J45 A;  5L0G A;  4JLZ A;  4KI2 A;  2BPC A;  4QZI A;  2GA9 D;  5E2Q A;  4W8P A;  4E0I A;  1LI5 A;  4AK9 A;  5BQH A;  2HKV A;  4WBY A;  5AC5 A;  4KNW A;  3ISB A;  1NU7 D;  3CSK A;  3IHU A;  2FMQ A;  2BCV A;  4CDA A;  4RWQ A;  2XLD A;  2ZXR A;  2DR9 A;  5HRD A;  2HFI A;  4NKT A;  4XEF A;  4OAI Z;  1UFB A;  2OCC C;  1ZHT A;  1V55 C;  2ZH2 A;  4WQL A;  5F2V O;  4EUK B;  4IWB A;  4YT5 A;  4ULV A;  1HY5 A;  3L1M A;  5B3S C;  4JWM A;  1K05 A;  4KLJ A;  3C5G A;  2ETS A;  1Q0D A;  2KGO A;  5COF A;  4RBN A;  2RD9 A;  4FWV A;  3WFR E;  4UBB A;  3PNC A;  7ICK A;  8ICK A;  2VCA A;  4WC1 A;  3FMS A;  2NSF A;  4DXW A;  4ZLC A;  1MIY A;  3A11 A;  2RFF A;  4XJE A;  4A4A A;  1J8Y F;  3NG1 A;  1DOV A;  4BJ1 A;  4JTD B;  1YDI A;  4LEZ A;  4CBE A;  4OD4 A;  3E9V A;  1L3P A;  1L7C A;  5L0D A;  2IOQ A;  1RKE B;  2EPK X;  3UGO A;  4MW8 A;  3AG4 C;  4GQH A;  1LS1 A;  8ICR A;  1QVX A;  1V74 B;  4MF2 A;  2CYD A;  1RXQ A;  1Z63 A;  1BZ4 A;  4O6M A;  4WOY A;  2P0N A;  3NDB B;  3MX3 A;  4FHW A;  4OAH A;  4QI2 A;  1BPZ A;  4TUQ A;  3SEO A;  4K9B A;  2CCY A;  4GEH A;  4JE9 A;  4O67 A;  1N1C A;  5IIK A;  4XRH A;  3MBY A;  7ICM A;  2DI3 A;  5HRI A;  1M2O A;  4KLE A;  2NUP A;  8ICT A;  2B51 A;  3TJ6 A;  4N7R A;  2A0B A;  4JTC B;  3KKB A;  4ZLD A;  1YYX A;  7ICV A;  3V5Y A;  5CI8 A;  4MVQ A;  9ICA A;  3ZQY A;  4M0A A;  4X0B A;  3RJF A;  3T6J A;  3JPQ A;  3NMI A;  1FR0 A;  4FH5 A;  2XM4 A;  3FHD A;  4CDY A;  2YQY A;  3DAG A;  2FFH A;  2NSG A;  4QZG A;  5BUO A;  3CEX A;  5CIV A;  3EHN A;  4P9F A;  5J2I A;  3U5S A;  3EZI A;  2CDQ A;  3ZWI A;  3JPS A;  1FFH A;  4NC3 A;  9ICE A;  3RYL A;  2XLH A;  2BCQ A;  9ICB A;  2L9J A;  2JX0 A;  2XXA A;  4NTF A;  1XSN A;  4C3E A;  4MVS A;  1ZQU A;  4UBC A;  1ZQB A;  2KQ9 A;  256B A;  1D1C A;  1CGN A;  4WCW A;  3C2M A;  1MMA A;  5BQI A;  4J32 B;  2IBF A;  2HUJ A;  3RVY A;  2L81 A;  3FOP A;  4M63 A;  4RD9 A;  2R7R A;  3SNH A;  4NLN A;  1IZM A;  3HNK A;  1MNE A;  1D1B A;  3LEV A;  1OCR C;  3PCV A;  3C63 A;  1Z6A A;  5CFU A;  4O5K A;  1OR3 A;  2GA0 A;  2XL6 A;  2OG2 A;  3L8I A;  2HMZ A;  2J9W A;  1PCX A;  1T9K A;  1BPD A;  3HNI A;  4EBK A;  1VYK A;  8ICS A;  4OD5 A;  1OU5 A;  2EPO A;  2NRK A;  5J2H A;  2KNH A;  5EGY A;  4XPW A;  2RSE B;  2ZXP A;  4YD1 A;  3ABL C;  3GEH A;  7ICQ A;  3WFQ E;  2JD3 A;  2H8A A;  2HSQ A;  4YN4 A;  3TJ5 A;  1QLE C;  4QZE A;  4PK4 A;  1ZYR F;  2YEV A;  1WWP A;  3ABM C;  2VAN A;  3DM9 B;  2L7A A;  1R89 A;  2WZL A;  4XEK A;  1SZI A;  1YZA A;  4LVS A;  4RQ3 A;  4MQ9 F;  4UB5 A;  9ICP A;  2EIM C;  1ZJM A;  4E17 A;  1H7I A;  2BCU A;  1R4T A;  5KYU A;  5TJ5 E;  4BG0 A;  5DS4 A;  1LE4 A;  1C17 M;  3IPM O;  1A7E A;  3O55 A;  5A6A A;  4RQ8 A;  4M2Y A;  1QSP A;  2LIG A;  3R7C A;  3L34 A;  3M79 A;  3J06 A;  5HRL A;  3S90 A;  2HJM A;  3HJC A;  1KEJ A;  4F5O A;  3V5Z A;  4NM1 A;  2HS5 A;  3V7O A;  4WJ0 A;  3LJB A;  4AX2 A;  2VB6 A;  2PBE A;  3C8G B;  1NO5 A;  4KB6 A;  4OIN F;  2Q3T A;  1YYJ A;  5DBB A;  2A6E F;  5HRK A;  1LI7 A;  1WOT A;  1HUO A;  1OCZ C;  3RJI A;  3LK9 A;  3H65 A;  1M6T A;  2TMV P;  1VK5 A;  4YL1 A;  3NMK A;  4O9M A;  3LLK A;  2KJG A;  2QNL A;  2J7P A;  7ICU A;  5HRB A;  3HIY A;  4N4W A;  5B3Q A;  2FAP B;  1NSG B;  3VAY A;  1A7V A;  4YT4 A;  2W45 A;  4K4G A;  2B0H A;  3KH2 A;  3NYL A;  3ASN C;  3EZH A;  3C5F A;  4NKU A;  1LKX A;  1ZHY A;  4UB4 A;  5IIL A;  2I8B A;  5B1B C;  2ZH4 A;  3H2V A;  2W9M A;  4YWQ A;  4BJ6 A;  1KDH A;  2EPN A;  2HJ3 A;  9ICG A;  8ICY A;  2WVN A;  9ICN A;  4W8K A;  4XPY A;  2Y3H A;  2PXI A;  1M2V B;  3GEI A;  3ZQV A;  4YJW A;  3AQC A;  5T3W A;  2LD6 A;  2DRA A;  4WC7 A;  5HHH A;  2WB7 A;  5DB8 A;  5DQT A;  1BR2 A;  2XS1 A;  8ICZ A;  4KLI A;  4UAY A;  3K33 A;  5J0P A;  3JPN A;  5J0O A;  4PHE A;  4RT3 A;  4AL0 A;  2NG1 A;  2ASR A;  2OOC A;  2Q9C A;  8ICJ A;  5JS5 A;  8ICL A;  3Q7L A;  3S29 A;  2R7U A;  4U9D A;  4O5C A;  3U3F A;  1ZQK A;  5J0Y A;  4M9N A;  3GEE A;  2L6H A;  2BE3 A;  3EH2 A;  3POV A;  1BPB A;  5IY5 C;  2IHO A;  2ZH6 A;  1PV3 A;  3WFO A;  4O5E A;  3HLZ A;  3AU2 A;  1OCO C;  4I2F A;  4E18 A;  2XLV A;  1G5Z A;  3MYF A;  1TVA A;  4DOC A;  4Z9H A;  3B71 A;  1YAR O;  2XLE A;  4UB1 A;  2QTV A;  1ZQZ A;  5K0I A;  5IIN A;  1H9T A;  2BC5 A;  3AQM A;  4PJN A;  3RH3 A;  2BL2 A;  1NOM A;  4WC4 A;  3DD7 A;  4MTF A;  1TFY A;  3AGU A;  4Q4Z F;  3B9Q A;  2P7V A;  2YVK A;  1Q79 A;  3JCF A;  1YA7 O;  5HRG A;  4EEB A;  1ZQA A;  4UD4 A;  4BJ5 A;  4RT2 A;  1VFG A;  4O6Y A;  5DBA A;  1TWC A;  2Q7R A;  1RZT A;  3N2Z B;  3JRM O;  4AT9 B;  4X4V A;  1ZQH A;  8ICO A;  4CS9 A;  2B56 A;  4RQ2 A;  1WOL A;  2CGE A;  9ICF A;  5DVW A;  1ST6 A;  4NM2 A;  2WVO A;  4YCX A;  4O6A A;  5J0T A;  4I1M A;  1S05 A;  3UQ2 A;  3JRT A;  1AUE A;  4YMM A;  4RQ7 A;  1C02 A;  1NG1 A;  1MMN A;  1YZC A;  1R8C A;  5BPC A;  2G3V A;  2R7S A;  8ICX A;  3S0X A;  2YL0 A;  1GM5 A;  1ZQY A;  2KYH A;  4KLF A;  2DYR C;  5DQZ A;  4FO6 A;  4I29 A;  4M9H A;  2XL4 A;  4CS7 A;  3WFP A;  3GWN A;  3U2L A;  4X4T A;  1RKE A;  1MQ3 A;  1RMV A;  2YL7 A;  1TFK B;  3RJJ A;  4U5H A;  3GWL A;  5CHE A;  2M2V A;  5JLI A;  9ICM A;  5JTG A;  2NPU A;  2VH3 A;  4BPM A;  2LP4 A;  1MMG A;  4PPX A;  1LS4 A;  3TOL A;  4Q5S F;  1K04 A;  4IGG A;  4KLU A;  3HJ4 A;  1SMY F;  2HSB A;  1ZHZ A;  2FMS A;  1ZQV A;  9ICV A;  2MHR A;  4DOA A;  1Z3I X;  4HFF B;  4QZF A;  4M9G A;  2HV6 A;  4F5Q A;  3K66 A;  4AT7 B;  2DGJ A;  4ANJ A;  2IXO A;  1UEU A;  1ZQC A;  4KLM A;  4E80 A;  4XTK A;  1C03 A; 
#chains in the Genus database with same CATH homology
 4RQ1 A;  3GM3 A;  4YMN A;  4FHP A;  7ICV A;  4IQW A;  4EP7 A;  4QZA A;  2BCS A;  4E8F A;  9ICA A;  9ICH A;  5DDY A;  4M0A A;  4X0B A;  3RJF A;  4I2C A;  3JPQ A;  4FH5 A;  4M5D A;  4R65 A;  3OGU A;  1ZZP A;  3AQK A;  5CWR A;  3RQE A;  9ICR A;  4FHX A;  4FHY A;  8ICN A;  4QZG A;  4RQ4 A;  5J2I A;  3AU6 A;  1KTM A;  3JPS A;  8ICW A;  2HHP A;  8ICG A;  9ICC A;  4YMO A;  1YLQ A;  9ICE A;  2BCQ A;  2GWS A;  3V72 A;  9ICB A;  4RWP A;  3MDC A;  4WC6 A;  1ZQW A;  2JX0 A;  1JN3 A;  3PMN A;  1XSN A;  4KLD A;  4PGY A;  8ICQ A;  3PML A;  1ZQU A;  3HX0 A;  4PH5 A;  4UBC A;  1ZQB A;  4KLT A;  4M47 A;  4GXI A;  4WCW A;  2DVI A;  3C2M A;  4WBZ A;  3L8J A;  3B0Y A;  2ZH9 A;  1R8A A;  3TFS A;  8ICE A;  4NLZ A;  1TV9 A;  1ZQP A;  5DB7 A;  1OW6 A;  4I2H A;  2DRB A;  5HRE A;  3H39 A;  4XQ8 A;  5IIM A;  3RH4 A;  1BPE A;  4X4U A;  4X0A A;  4NLN A;  5CR0 A;  4MFA A;  1MQ2 A;  5DB9 A;  3MFN A;  4IQV A;  4R64 A;  3H37 A;  5HC9 A;  1UEV A;  1XSP A;  4R32 A;  5IIJ A;  3OVA A;  4O5K A;  3ISC A;  3V7L A;  3RJH A;  1ZQS A;  4I2A A;  4PHD A;  3L8I A;  1Q78 A;  3JPO A;  1BPD A;  4UD5 A;  9ICW A;  4EBK A;  4TUR A;  8ICS A;  4WC2 A;  4PGQ A;  4XA5 A;  2ISP A;  3UPQ A;  3JPR A;  1OU5 A;  2NRK A;  3OV7 A;  5J2H A;  4IG8 A;  4P4P A;  4YD2 A;  1VJ7 A;  1MIW A;  4X4R A;  4P2H A;  4YD1 A;  2M2W A;  1JQR A;  2O1P A;  3OUY B;  5F28 E;  4UAZ A;  7ICQ A;  3WFQ E;  1TFW A;  3NYB A;  7ICP A;  4YN4 A;  8ICB A;  8ICH A;  2DR7 A;  7ICS A;  4QZE A;  3OUY A;  5DKW A;  5BOL A;  1ZQN A;  7ICT A;  1KNY A;  1WWP A;  2ZHB A;  2VAN A;  9ICX A;  1R89 A;  4GXJ A;  4XEK A;  9ICL A;  4Z6E A;  4NXZ A;  4R66 A;  4I28 A;  3GM1 A;  4P4M A;  4LVS A;  4RQ3 A;  3V7K A;  4UB5 A;  1BPX A;  9ICP A;  1HUZ A;  2JPU A;  2PFQ A;  1ZJM A;  4WC5 A;  2ZH5 A;  7ICF A;  2BCU A;  5BOM A;  3K7D A;  4RPZ A;  4X4N A;  4LZD A;  2DR8 A;  5D4B A;  2M2T A;  4ATB B;  4I27 A;  4M04 A;  4Z6C A;  3C2L A;  4RQ8 A;  4M2Y A;  5HRF A;  5DDM A;  5J2A A;  4QZH A;  4S3N A;  3GDX A;  4I2E A;  4ATB A;  3C8G D;  4NLK A;  5J2E A;  4RQ5 A;  5HRL A;  4WC0 A;  4F5N A;  5J2F A;  1KEJ A;  4I2J A;  3GM2 A;  4F5O A;  7ICR A;  2ISO A;  4NM1 A;  2LK4 A;  7ICJ A;  3RJK A;  4EBJ A;  1JAJ A;  4QZ8 A;  3MDA A;  2PBE A;  3TUL A;  4MFF A;  3C8G B;  1NO5 A;  8ICA A;  4XUS A;  5DEC A;  1ZQX A;  1PX5 A;  3C8G A;  5DBB A;  5HRK A;  3MGI A;  1WOT A;  3HJ1 A;  1HUO A;  4PGX A;  3RJI A;  3LK9 A;  2L6G A;  7ICE A;  3LQC B;  1ZJN A;  4WC3 A;  9ICO A;  4R63 A;  1OW7 A;  4UAW A;  4DOB A;  4M9J A;  4O9M A;  7ICI A;  3TFR A;  3UXN A;  4KLO A;  4M9L A;  4FHV A;  3UPS A;  5J2B A;  4K4I A;  7ICU A;  2ID1 A;  2ZH1 A;  5HRB A;  3HIY A;  8ICC A;  1ZQG A;  2I9G A;  1ZQR A;  4LZG A;  7ICO A;  4RPX A;  4KLQ A;  4RQ6 A;  1WTY A;  4MF8 A;  4K4G A;  5J2D A;  3JPP A;  2KK1 A;  1O3U A;  1ZQF A;  2Q00 A;  3UQ0 A;  3C5F A;  2FMP A;  4NKU A;  1ZQT A;  4UB4 A;  5J0S A;  4KLH A;  3K75 D;  5IIL A;  4IQT A;  3U0C A;  2ZH4 A;  3WFS C;  2W9M A;  1KDH A;  4MFC A;  9ICG A;  3BRJ A;  3RJE A;  8ICY A;  4RQ0 A;  7ICH A;  4NQF A;  4RPY A;  4I2G A;  4JWN A;  5HHI A;  9ICN A;  1V4A A;  1K40 A;  2PXI A;  2IHM A;  9ICT A;  4X4O A;  4KLL A;  2ZHA A;  2M2U A;  5EOZ A;  4E7X A;  3RJG A;  5HRH A;  4F5P A;  2DRA A;  3V7J A;  4WC7 A;  3JPT A;  5HHH A;  4XEV A;  4X4Q A;  4Z6D A;  5DB8 A;  2BCR A;  1ZQQ A;  8ICZ A;  4KLI A;  4UAY A;  1R8B A;  8ICI A;  5J0P A;  3JPN A;  5J0O A;  4PHE A;  4PHP A;  3HWT A;  4QZ9 A;  4RT3 A;  4RWO A;  1OW8 A;  7ICN A;  5CA7 A;  9ICJ A;  1F5A A;  8ICJ A;  5D49 A;  8ICP A;  2ZH7 A;  8ICL A;  3OVS A;  1UET A;  3RH5 A;  3ISD A;  4O5C A;  3U3F A;  4UB2 A;  3AQN A;  1ZQM A;  5J0Y A;  1ZQK A;  5III A;  4QZC A;  4M9N A;  4X4P A;  2ZH8 A;  2ZH3 A;  5J0X A;  2BE3 A;  2L6H A;  2O5A A;  4FH3 A;  1ZQD A;  5J2G A;  1BPB A;  2ZH6 A;  1PV3 A;  3C2K A;  3UXP A;  3WFO A;  1BPY A;  2PFO A;  4O5E A;  9ICI A;  2P66 A;  3AU2 A;  4I2F A;  5DB6 A;  3RQF A;  2BPC A;  7ICL A;  5CP2 A;  4QZI A;  4DOC A;  1TVA A;  1ZQL A;  4I2D A;  5D46 A;  4KLG A;  4TUP A;  3B71 A;  4DO9 A;  4IQU A;  2YWA A;  4UB1 A;  1ZQZ A;  2BPF A;  4WBY A;  5IIN A;  3ISB A;  5J2C A;  2FMQ A;  2BCV A;  3AQM A;  4RWQ A;  2DR9 A;  5J0R A;  5HRD A;  4F5R A;  1NOM A;  4NY8 A;  4WC4 A;  4NKT A;  4XEF A;  4Z6F A;  3H38 A;  1TFY A;  1UFB A;  8ICU A;  3AJM A;  8ICV A;  4QZD A;  8ICF A;  1Q79 A;  5HRG A;  2ZH2 A;  4KLS A;  5F2V O;  1ZQA A;  9ICK A;  1FA0 A;  4UD4 A;  4QZB A;  4RT2 A;  1VFG A;  4I2I A;  3RQG A;  5DBA A;  1K05 A;  4JWM A;  4KLJ A;  5J0W A;  1RZT A;  1ZQI A;  3C5G A;  5J0Q A;  5CB1 A;  4AT9 B;  4X4V A;  1RPL A;  1ZQH A;  8ICO A;  4X4S A;  4RQ2 A;  1WOL A;  3WFR E;  9ICF A;  5HR9 A;  4I2B A;  4UBB A;  4NM2 A;  3PNC A;  7ICK A;  8ICK A;  4AT9 A;  4YCX A;  4K4H A;  3RH6 A;  3C18 A;  4WC1 A;  5J0T A;  5CJ7 A;  3UQ2 A;  5J2K A;  2DR5 A;  1MIY A;  9ICQ A;  1JOG A;  4YMM A;  3O10 A;  4RQ7 A;  5DED A;  2RFF A;  1R8C A;  1ZQE A;  5BPC A;  9ICU A;  3AQL A;  8ICX A;  5J0U A;  4UB3 A;  4XQ7 A;  4P4O A;  1ZQY A;  4GXK A;  5J2J A;  1ZQJ A;  3C66 A;  4KLF A;  4M9H A;  4FO6 A;  4I29 A;  2Q66 A;  3WFP A;  8ICM A;  5IIO A;  2PFP A;  8ICR A;  1QVX A;  3HW8 A;  1ZQO A;  4MF2 A;  9ICS A;  4X4T A;  1MQ3 A;  3B0X A;  3RJJ A;  3JYY A;  2M2V A;  3MGH A;  7ICG A;  9ICM A;  5J29 A;  4FHW A;  1BPZ A;  4TUQ A;  2BPG A;  3H3A A;  4TUS A;  4PPX A;  4X5V A;  1K04 A;  4AT8 B;  4LT6 A;  3L9D A;  1JMS A;  5IIK A;  4XRH A;  3MBY A;  4KLU A;  7ICM A;  3HJ4 A;  5HRI A;  1XSL A;  2PFN A;  5CHG A;  2HSB A;  4AT8 A;  2FMS A;  4KLE A;  1ZQV A;  9ICV A;  4RWN A;  4DOA A;  8ICT A;  4QZF A;  4M9G A;  3AUO A;  4F5Q A;  3S9O A;  1MIV A;  4AT7 B;  5DBC A;  1UEU A;  1ZQC A;  5TZV A;  4KLM A;  2L6F A;  4AT7 A;  3OVB A;  3UXO A;  4E80 A;  3JZ0 A;  4PHA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...