3JZ0A

Linb complexed with clindamycin and ampcpp
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
266
structure length
266
Chain Sequence
LKQKELIANVKNLTESDERITACMMYGSFTKGEGDQYSDIEFYIFLKHSITSNFDSSNWLFDVAPYLMLYKNEYGTEVVIFDNLIRGEFHFLSEKDMNIIPSFKDSGYIPDTKAMLIYDETGQLENYLSEISGARPNRLTEENANFLLCNFSNLWLMGINVLKRGEYARSLELLSQLQKNTLQLIRMAEKNADNWLNMSKNLEKEISLENYKKFAKTTARLDKVELFEAYKNSLLLVMDLQSHLIEQYNLKVTHDILERLLNYISE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lincosamide nucleotidyltransferase
publication title Structure and mechanism of the lincosamide antibiotic adenylyltransferase LinB.
pubmed doi rcsb
source organism Enterococcus faecium
molecule tags Transferase/antibiotic
total genus 106
structure length 266
sequence length 266
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 3jz0A02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 3jz0A01
3AU6A 1ZQNA 2JX0A 9ICBA 3OVAA 4E80A 1ZQTA 3WFPA 4UB3A 5J0WA 7ICPA 4I2JA 1UEUA 1ZQAA 3C2LA 4X4NA 3C8GA 3AQNA 1PX5A 3O10A 3H38A 3OUYA 3RQEA 2W9MA 3MFNA 7ICRA 1FA0A 4RWQA 4R64A 4KLGA 3C8GB 7ICEA 3WFRE 4X4TA 1O3UA 4YD2A 3OUYB 4F5QA 3MBYA 3UXNA 2BCUA 3L9DA 5J0XA 2HSBA 4FHWA 4KLDA 3GDXA 2ZH2A 2BCVA 4P2HA 1ZQPA 4K4GA 4NLKA 5HRIA 4NY8A 4X5VA 4RWPA 4RQ6A 4QZDA 4M9GA 4WC7A 3U0CA 1ZJNA 4RQ2A 2GWSA 9ICNA 4PHAA 1BPYA 3C2KA 5DEDA 8ICLA 1K05A 3RH4A 4YMMA 4Z6CA 4DOCA 7ICLA 3TFRA 3C8GD 4RQ5A 7ICFA 1ZQMA 4P4MA 2YWAA 4UBBA 4KLJA 5DKWA 3TULA 1V4AA 4F5OA 4QZFA 4NM2A 5J2KA 4NKTA 8ICOA 3K75D 4MFAA 3ISBA 3HW8A 3H39A 5DECA 4E8FA 1ZQYA 2BPCA 2ZH1A 2DR8A 5J0RA 1ZQVA 1YLQA 1ZQBA 5DDMA 2M2UA 3V72A 1Q79A 2ZH5A 3K7DA 9ICQA 5HRLA 8ICBA 3AQMA 1TV9A 4FHYA 2FMQA 4GXKA 1MIVA 4IQWA 5J0SA 5J29A 5IILA 3JPQA 4GXIA 5J2FA 5HRKA 4QZ9A 5CP2A 3RJHA 5DB7A 9ICGA 3MDCA 1WTYA 5DDYA 4PHDA 8ICAA 5J0UA 8ICUA 1PV3A 4F5PA 4M9NA 3V7LA 4I2GA 4GXJA 4Z6DA 4RQ0A 4LVSA 4UBCA 5CR0A 3V7KA 2BCSA 1RPLA 2IHMA 3L8JA 1UETA 5J2AA 9ICVA 1R8CA 4FH3A 2BPFA 5HR9A 8ICFA 4M04A 4I2HA 3UQ2A 4JWNA 2ZH6A 2Q66A 4I2DA 1ZQLA 3GM2A 4EBJA 9ICMA 4FHPA 8ICHA 3C5FA 1ZQEA 4RQ4A 8ICSA 2BCQA 1ZQOA 8ICYA 8ICNA 1KTMA 3C66A 2ZH3A 1MQ2A 3OGUA 1OW6A 4XQ8A 3B71A 4XRHA 9ICFA 4WC0A 9ICOA 1Q78A 3MDAA 5IINA 1R8BA 5HRGA 4I2EA 3OVBA 3AQLA 2RFFA 1ZZPA 4O5EA 7ICJA 4I2IA 4XUSA 9ICWA 4M5DA 1K04A 5J2DA 7ICKA 1KEJA 9ICPA 4TUPA 4XQ7A 4QZGA 2I9GA 3HIYA 3JPNA 4RPXA 3C2MA 2NRKA 5D4BA 4UB1A 5J2EA 2ZH8A 5HC9A 4YCXA 4X4OA 1ZQKA 4YD1A 3GM3A 4AT8A 5J2BA 4S3NA 3RQGA 4WBYA 5TZVA 5BOMA 3B0YA 5IIJA 4KLOA 5BOLA 4NKUA 7ICQA 3NYBA 2L6GA 4AT8B 4DO9A 5BPCA 4UAYA 4M9LA 3RH6A 1XSPA 4I2FA 4O5KA 5DB6A 9ICXA 3U3FA 4X4SA 8ICJA 4IQTA 4KLQA 1ZQFA 4X4PA 1ZQXA 1ZQGA 1MQ3A 4WC2A 4XA5A 1XSLA 4KLUA 3OV7A 4TUQA 3OVSA 1NOMA 4DOAA 4X4VA 4WBZA 1ZQUA 3PMNA 3UPQA 1R8AA 4O5CA 1BPDA 4QZEA 2L6FA 1OW7A 1ZQDA 3LQCB 2PFOA 1RZTA 5HRDA 3UQ0A 4PHPA 5CB1A 7ICIA 8ICKA 7ICUA 5IIOA 4M47A 3TFSA 4YN4A 8ICGA 1WWPA 5DB9A 3RQFA 4KLTA 4WC4A 5J0YA 5HHIA 5F2VO 8ICXA 2ZHBA 4QZHA 4PGYA 1JN3A 2ZH4A 4F5NA 4NXZA 4WCWA 9ICRA 4XEFA 2VANA 1ZQCA 5J0QA 2M2VA 2O1PA 5CA7A 3WFQE 4O9MA 2M2WA 1XSNA 3GM1A 3BRJA 4X0BA 1MIYA 4F5RA 5J0PA 4UAWA 1KDHA 2PFPA 2FMPA 2P66A 2ZH9A 4KLFA 4MF2A 4XEKA 9ICTA 3RJFA 1HUZA 3RJKA 4EP7A 2DR5A 2ISOA 4RWOA 5F28E 1ZQWA 7ICVA 3AJMA 4UB2A 4I2BA 1QVXA 3JPSA 4YMNA 1ZQQA 5EOZA 3RJIA 3L8IA 1ZQSA 4KLHA 4UD4A 8ICCA 4RPZA 7ICHA 5J2HA 1ZQRA 4KLLA 4M0AA 2Q00A 4UB4A 3UXPA 7ICSA 5J2IA 4KLMA 5DBBA 4AT9A 5J2GA 2DR9A 1K40A 3JPTA 4WC6A 8ICRA 5CHGA 2JPUA 3JPRA 1TFYA 5J0OA 4X4QA 3WFSC 5HRHA 2PXIA 3JYYA 4LZDA 4TURA 1BPBA 3ISCA 5D46A 1R89A 4UB5A 5CJ7A 4R63A 1VJ7A 4X4UA 4QZIA 4XEVA 5HRBA 2ZH7A 4M9HA 3V7JA 2KK1A 4K4HA 4UAZA 4E7XA 2DRAA 4FHVA 4JWMA 2PFQA 3JPPA 4PH5A 4Z6EA 1JQRA 4ATBA 3JZ0A 5HRFA 9ICKA 8ICZA 1JMSA 3B0XA 3HJ1A 1ZQJA 4QZCA 8ICPA 4R32A 4I2CA 4PPXA 4P4OA 5DBAA 3RJEA 3AU2A 4ATBB 2ZHAA 3S9OA 8ICTA 4MFCA 5J2JA 2BE3A 1WOLA 7ICMA 2M2TA 2DR7A 4I2AA 3C5GA 1UFBA 5DB8A 4PHEA 4MFFA 8ICVA 4RT3A 4TUSA 3AQKA 5J2CA 1JAJA 5DBCA 1ZQHA 4QZBA 4P4PA 9ICJA 5IIIA 2BPGA 8ICIA 3HWTA 4R66A 2BCRA 4I28A 5IIKA 9ICUA 5HHHA 4RT2A 4Z6FA 4NQFA 1BPZA 4KLIA 3PNCA 4M9JA 5J0TA 8ICWA 3C18A 1ZQIA 3HJ4A 4FH5A 3UPSA 2L6HA 4NM1A 1NO5A 7ICNA 1UEVA 4I27A 2DVIA 1TVAA 4NLNA 4M2YA 3ISDA 1TFWA 4X4RA 2PFNA 1MIWA 4K4IA 4RQ1A 9ICSA 5IIMA 3LK9A 4AT7A 1VFGA 1BPXA 9ICEA 9ICCA 3UXOA 1OW8A 9ICLA 4UD5A 4KLEA 5HREA 1F5AA 4QZAA 4AT7B 4FHXA 5D49A 3MGHA 4LZGA 7ICGA 1OU5A 2FMSA 4RQ7A 3JPOA 2PBEA 3MGIA 3HX0A 9ICAA 3RJGA 8ICQA 4RWNA 3AUOA 2HHPA 1ZJMA 8ICMA 4PGXA 4IG8A 1BPEA 9ICHA 4EBKA 9ICIA 4I29A 1HUOA 8ICEA 1ZQZA 4NLZA 3H37A 1WOTA 4YMOA 4QZ8A 2LK4A 3WFOA 3RJJA 2ID1A 4MF8A 4RQ3A 4RPYA 1JOGA 2O5AA 7ICOA 4LT6A 4PGQA 4IQVA 4R65A 4WC1A 3PMLA 2DRBA 5CWRA 4WC5A 1KNYA 4AT9B 4KLSA 2ISPA 4DOBA 7ICTA 3RH5A 4RQ8A 4FO6A 4WC3A 4X0AA 4IQUA 3H3AA
chains in the Genus database with same CATH superfamily
3WAQA 3DWWA 1DOVA 3GORA 9ICBA 5J0WA 2WVNA 3C2LA 4X4NA 3NMKA 3L34A 1PX5A 3O10A 2H8AA 2B56A 1FA0A 4NY3A 3UXNA 5A6KA 4JW1A 2OEVA 1HE1A 1M56C 2BCVA 1ZQPA 4LDQA 3FVYA 4CJGA 3AOUA 5COGA 4NY8A 4X5VA 3IQ6A 5L0JA 2A6HF 5A6BD 4QZDA 1ZU5A 9ICNA 1BPYA 3NG1A 3MLGA 4C3EA 1EI7A 3Q7GA 8ICLA 2EIMC 1E83A 2HUJA 1K05A 4X0RA 3RH4A 1MQVA 4CS9C 2XM0A 3NYJA 1ZQMA 2G62A 2HJ3A 2YWAA 3C63A 2NUTA 3ER9B 1ZHZA 3NKEA 3TULA 1FFTC 2R7TA 5J2KA 8ICOA 3K75D 2NUTB 3HW8A 4G7HF 5D92A 4F4BA 1T5OA 2P7VA 3GWLA 3N2ZB 2CYDA 3V72A 1Q79A 2PNOA 1TV9A 2CCYA 3ZG1A 4JVSA 3POVA 4IQWA 4GXIA 2WL8A 1I5NA 5CP2A 5DB7A 4W8PA 2XLOA 3ABMC 2MWQA 1A7EA 5J0UA 3V7LA 2IXMA 4DVZA 4E17A 1S7ZA 4RQ0A 4UBCA 1LS1A 4O6AA 1Z5ZA 3F46A 1UETA 9ICVA 1T01A 2HSQA 2QLAA 4LLCA 3UQ2A 4JWNA 5E2QA 1ZQLA 1C02A 1YARO 4PJJA 4EBJA 4WGZA 4FHPA 1D0XA 4C3BA 2BCQA 1WASA 1WN0A 1MQ2A 4XWJA 1OW6A 1NU7D 2IHOA 3K1HA 1JPJA 9ICOA 4ONSA 1R8BA 1TFKB 2E87A 3AQLA 2GFHA 4DOZA 4I2IA 1M6TA 2IBFA 2WZFA 2XM4A 3JRMO 7ICKA 3M15A 2ZXWC 5A6AA 1KEJA 1LI7A 3HNIA 1Y6DA 3JPNA 4KNWA 3EQLF 2ZH8A 4O69A 4Q5SF 2Y3BA 5L0GA 4JKVA 2XRHA 4K8VA 3LEVA 3SXYA 4AT8A 3RQGA 4WBYA 4AT8B 2Y3DA 5BPCA 4UAYA 3E9VA 4M9LA 1XSPA 3VF0A 3U3FA 1IZMA 1ZQXA 3OEOA 3T6GB 3U9JA 3RH3A 1MQ3A 1ZQGA 3L1MA 2Q4FA 4E7SA 1ORSC 1ZQUA 4WBZA 3PMNA 3UPQA 4O5CA 2L6FA 3UR3C 2OQMA 3LQCB 1V54C 4YT8A 4O6YA 3HLZA 4PHPA 3H65A 2GA9D 3FAPB 5T1DB 3KL4A 4Q7CA 8ICXA 1YYJA 4QZHA 2ZH4A 3ZQYA 4WCWA 3IHUA 9ICRA 4XEFA 5J0QA 2M2VA 2O1PA 5CA7A 2XL6A 1OR3A 2HMQA 3EZIA 5J0PA 1S05A 3EGXA 2OJED 2PF4E 2P66A 4KLFA 2FFHA 4E0IA 4XEKA 3SNHA 3RJFA 1HUZA 3GEEA 2ISOA 5KYWA 5F28E 1ZQWA 3ASOC 1QVXA 3FHDA 3RJIA 1ZQSA 5KYWB 3TD7A 7ICHA 3LS0A 3UXPA 4AT9A 1ORYA 2J7PD 3B9QA 1B68A 3IQTA 4HFKB 1CGOA 3T9OA 5CHGA 4FX5A 3AG3C 3R7CA 3Q6NA 2J0WA 1MMGA 1OXKA 2MYSA 3UGPA 2IUBA 2F22A 1VYIA 4A2NB 5HRBA 4CS7A 3A9CA 4Z9JA 2ZH7A 4JCHA 3EJNA 5DS5A 2GAQA 4AK9A 4E7XA 4FHVA 3TOMA 4JWMA 1OQCA 2BE5F 3V5YA 5IY5C 1YDIA 5KYNA 3V7OA 1JMSA 1ZQJA 1UG7A 4CX9A 3U8VA 3AG4C 2B0HA 3QW1A 4U9DA 1ZHXA 3RW0A 3S9OA 2IM8A 5BQIA 1RKEA 4MFCA 4OIRF 5J2JA 1WOLA 2A68F 1OKKA 2M2TA 1RKEB 256BA 1D0ZA 2DGJA 5DB8A 8ICVA 4TUSA 1JAJA 3U9MA 5DBCA 9ICJA 2BPGA 3FAJA 2CGEA 3VRCA 2BCRA 2O9XA 2EILC 4I28A 4RT2A 4NQFA 1TKNA 3DM5A 4JEAA 3DE8A 1FFHA 2YHSA 2W4MA 2L6HA 7ICNA 3KYIA 1G5ZA 4O79A 1UEVA 2A6EF 1H9GA 2QNLA 1JAFA 4K97A 2GA0A 4O68A 2UUIA 1TQGA 1MIWA 1JMWA 1AUEA 5GPGB 5IIMA 1Q0GA 1SF8A 9ICCA 3EF2A 3LNRA 1FR0A 5HREA 1F5AA 3KMIA 1FMVA 4O7GA 3B0VC 4FHXA 5D49A 3TOLA 3EGDB 4LZGA 7ICGA 1OU5A 1U89A 2PBEA 8ICQA 3OWTA 5T3TA 1J8MF 3DI5A 1ZJMA 1VLTA 8ICMA 4EBKA 4I29A 3IPMO 5DVWA 2YQYA 1EQ1A 1BR1A 4U5BE 4NLZA 4K98A 4YMOA 4PR9A 3K66A 3JRTA 4MF8A 1LPEA 1ZHYA 1ZW3A 4RPYA 4HEAJ 1F1MA 5JUAA 4PGQA 1RKCA 1JR8A 3U3BA 4MQ9F 2BL2A 3HNJA 5CWRA 2DRBA 2GAFD 2Q3TA 4MVMA 4KLSA 3S84A 4FO6A 3UMIA 3H3AA 3LJBA 4FO1A 1ZU4A 1JPNA 1O87A 4KB6A 2JX0A 3OVAA 3CK6A 2LSEA 1D1BA 1SMYF 5F5HA 1HW1A 4MS2A 5CI9A 4I2JA 1ZQAA 4EEDA 2NG1A 1QLEC 3ZC4A 3AQNA 3F47A 2B0JA 4NXVA 2QY9A 4G78A 3MFNA 2IXNA 4F5QA 3MBYA 2LQGA 4MKPA 3K1IC 3L9DA 4FHWA 1XZQA 2ZH2A 1NLXA 4P2HA 4NLKA 4I44A 2Q7RA 1A7VA 3DZAA 4RQ6A 4FWVA 4O6MA 1ZJNA 4YWQA 1LKXA 5L0FA 2NUPB 4WH5A 2J9VA 4PHAA 2OOCA 2VH3A 5DEDA 4H54A 7ICLA 1HE9A 3RF3A 4RQ5A 5EK0A 3FOPA 2ZXOA 5B3PA 2YL1A 2W4BA 4UBBA 4KLJA 2V26A 1LE2A 4QZFA 2KNHA 4C7OB 4NM2A 1LE4A 3M4CA 4CBEA 3SYNA 1ZQYA 4JJGA 1YLQA 2M2UA 5HRLA 3AQMA 2MHRA 4D4XA 2TMVP 1MIVA 5J0SA 2PP4A 3T6JA 1TR2A 1MNDA 4QZ9A 3RJHA 9ICGA 2Y39A 5D62A 3W2WA 2HS5A 3Q7LA 4PFOA 1PV3A 4F5PA 1YJGA 4EHPA 4GXJA 3NMIA 4Z6DA 4ER9A 3V5ZA 4N6CA 2BCSA 3B0UX 1RPLA 2OJQA 2LP4A 3LEOA 3MYFA 1Z3IX 4FH3A 4I2HA 2ZXPA 1LM3B 4JLZA 4I2DA 4KC9A 3GM2A 2OKUA 9ICMA 8ICHA 1E85A 3L0IA 3C5FA 1A0BA 4RQ4A 1E86A 1M57C 3ZSUA 2RD9A 1ZHWA 8ICNA 4I1OB 1KTMA 1PD0A 2R7XA 2HZ8A 4JJFA 1Q0MA 5AC4A 9ICFA 2OU6A 1Q78A 2HN1A 5HRGA 3OWGA 4XPWA 4U9EA 4XUSA 9ICWA 5EHHA 4NXWA 1VB5A 3NKDA 4C3DA 1K04A 2LFDA 3LUTB 5A69A 9ICPA 4TUPA 5B3SC 4WABA 2J0XA 2B4VA 4QZGA 2I9GA 3HIYA 4RPXA 2NRKA 5D4BA 2V3CC 4UB1A 4MVQA 5J2EA 1I4ZA 4YCXA 1ZQKA 2R9RB 4GEHA 3QZCA 5TZVA 4KLOA 4NKUA 1RXQA 2L6GA 2XSEA 4WQLA 4RD9A 3RKOF 4CS8C 4O5KA 3RFYA 4X4SA 4EKWA 8ICJA 1ZQFA 2XL8A 3S90A 1RJ9A 4WC2A 2QE9A 1NOMA 1V55C 1VK5A 4JTAB 3U8PA 1Z6AA 4QZEA 2YL0A 1ZQDA 3O55A 4YN0B 2PFOA 1RZTA 4IAOA 3SXMA 2R25A 8ICKA 5BUOA 3KPHA 4OIPF 1R5ID 1VLSA 3DXJF 3TFSA 8ICGA 3RQFA 4KLTA 1WGWA 2ZHBA 2EWRA 4PGYA 4NXZA 3DAGA 2VANA 3JCFA 4O9MA 4BG0A 1TFOB 1LS4A 1XSNA 3GM1A 4F5RA 4X0BA 1MIYA 2EPLX 1W2WA 1KU2A 2PFPA 3PMRA 2KW3C 2ZH9A 2EPKX 4CSAC 1Q0KA 9ICTA 4JCZA 4EP7A 4DRIB 3AJMA 2PX3A 4DBRA 1ZQQA 4P9TA 5J2HA 1ZQRA 4UB4A 3GWNA 2KSFA 5J2IA 4KLMA 3JPTA 1JRAA 3PDMP 1J8YF 1E84A 1TFYA 5J0OA 3WFSC 4Z9IA 2R02A 3JYYA 2AVKA 5JP7A 5A6BA 1A41A 4NTAA 4FAPB 4UB5A 2YKZA 3WHNA 3DE9A 4O6NA 1Z63A 2R7WA 2UUHA 1EKYA 2Q9CA 4M9HA 5COFA 1XZPA 2KK1A 5D63A 3M79A 3UGOA 4UAZA 4JTDB 1C17M 3QVZA 2A0UA 2CW0F 3ER8C 1JQRA 3ASNC 3O6XA 1IW7F 4YT2A 8ICPA 4PPXA 3GEHA 4Q4ZF 5DBAA 3RJEA 5JSLA 2BE3A 2A69F 7ICMA 4I2AA 4CS9A 4IB4A 4QI0A 3C5GA 1UFBA 4ZLDA 4HX0A 3SXZA 4OAHA 3DJNB 2B51A 4RT3A 4BJ6A 4B6IA 1ZQHA 4QZBA 4P4PA 1OCCC 1OCZC 1QPUA 1NU9C 5IIKA 3DJUB 4Z6FA 1VMAA 4M9JA 1NSGB 2LIGA 8ICWA 4LEZA 1ZQIA 4PJLA 1BBHA 4NM1A 1NO5A 2DVIA 4ULWA 2EPMX 4M2YA 4N06A 1OKKD 2PFNA 1QKRA 4G7ZF 3CSKA 9ICSA 4YL1A 2XLVA 5L0DA 1YAUO 1BPXA 9ICEA 9ICLA 3QTHA 3U2LA 3V5XA 3EH2A 3HKKA 4K7BA 5K0IA 2FMSA 4EEBA 4RQ7A 9ICAA 3HX0A 3UNGC 3A11A 4RWNA 3EGXB 4PGXA 4AE4A 4IG8A 1BPEA 9ICIA 3EH1A 3ATPA 2R7VA 4OIQF 2PFDA 4AE4B 1WOTA 1BZ4A 3WFOA 3ABLC 4LDRA 1Z7Qc 2ZXRA 4LT6A 4IQVA 2YVKA 1SZIA 3PMLA 2XS1A 3EPVA 4AT9B 1TWCA 2YLGA 3RH5A 2A1DD 4IQUA 4W8KA 3C7JA 2I15A 4IJJA 1OXBA 1ZQNA 4MTGA 4E80A 2HMZA 2HJMA 2VC9A 5E3CA 4LEYA 2J9WA 4UB3A 2R03A 1UEUA 3C8GA 1NG1A 2CNWA 3H38A 1M2VA 3RQEA 2VB6A 5JTGA 2W9MA 3ZDLA 7ICRA 1MNEA 1GPJA 4R64A 3C8GB 4KLGA 4X4TA 4YD2A 1L7CA 5JS5A 5J0XA 2HSBA 3GDXA 4K4GA 5HRIA 4K99A 1GM5A 1ST6A 3NKUA 3ZTZA 4WC7A 2GWWA 3LAYA 4WOYA 4RQ2A 2GWSA 3FDQA 5L3VA 4MTOA 2DYRC 3ZTMA 1OR2A 4BJ5C 2KJGA 2KQ9A 4HE8D 4YMMA 4Z6CA 4DOCA 3TFRA 3JSEO 1Q0DA 7ICFA 5CFSA 1SR2A 4QI2A 4P4MA 1L3PA 4EGWA 5DKWA 4JRZA 1CPRA 1V4AA 3AGTA 4NKTA 5DLJA 4PACA 2Y3HA 2BBJA 3H39A 1HW2A 4YT5A 1A7DA 2WB7A 2YLIA 5J0RA 5DDMA 1MMAA 1QZXA 3JT1A 3K7DA 5JRAA 4BPMA 2ZH5A 8ICBA 3FOOA 1YZCA 2Q9AA 2FMQA 4Z9HA 4GXKA 1LVKA 1V74B 1GGQA 4CDVA 2EINC 5J29A 5IILA 3JPQA 2L7AA 2YL3A 4E18A 5KYUA 5J2FA 4JZAA 1WTYA 4ZLCA 5DDYA 2W9YA 3T6BA 8ICAA 5DQTA 5KYUB 4NTFA 8ICUA 3RYLA 4M9NA 3JTLO 3GODA 4DVYP 4LVSA 4LEVA 3L8JA 4EV6A 2M4EA 1M2OA 1GS9A 1I4YA 3S28A 4XQ1A 2ZH6A 2Q66A 3TJ5A 1CGNA 2J46A 3QW0A 4G0HA 4JIOA 3EG9A 5JT4A 8ICSA 1ZQOA 4LERA 8ICYA 4LEWA 2HKVA 3EG9B 3NYMA 2XLDA 3C66A 3FMSA 3OGUA 4IGGA 3B71A 4WC0A 1G4WR 4H4KC 3MDAA 5IINA 4JLXA 4I2EA 3OVBA 2RFFA 3CAXA 1HY5A 1VYKA 4M5DA 1H6GA 2EPNA 3AQCA 2PX0A 1YZAA 4OINF 4XQ7A 2J9UA 3C2MA 5A6JA 4XLPF 5HC9A 5HV9A 1N1CA 1YA9A 4CJOA 4JC7A 2OEXA 2P61A 4S3NA 5BOMA 4RBNA 3B0YA 5IIJA 4J7TA 4L6RA 5BOLA 3BEHA 4U5DE 1LI5A 3WG7C 7ICQA 5COMA 4DO9A 1QQ3A 5DB6A 2XL4A 3NMJA 4A4AA 3J06A 4WGYA 4MW3A 4IQTA 3EHMA 4X4PA 2VCAA 4XA5A 1FMWA 4TUQA 3OVSA 4X4VA 3PHZA 4K9AA 3MCRA 3DMDA 2H7BA 3UMKA 1ZYRF 4FESA 2DI3A 1FAPB 2C04A 7ICUA 4NXTA 5DS4A 4J32B 4M47A 2XLMA 1VTMP 3WODF 1WWPA 3HJCA 5DB9A 2YLDA 1T6UA 4DBQA 1JN3A 3CQZA 4NCQA 5L3QA 3W4YA 3M1CB 1ZQCA 3BRJA 1G4US 4JURI 3TJ6A 1KDHA 2AP3A 1AVOB 5BQHA 3I5PA 5KYYA 2YL7A 2D5RB 5L0CA 3RJKA 2DR5A 2G3VA 4I2BA 5KYYB 4YMNA 3L8IA 4KLHA 4E0HA 3TK0A 3B29A 1D1CA 1NFOA 4PFPA 4M0AA 2Q00A 1DOWA 5EGYA 2QTVA 5DBBA 3LLIA 4MVUA 4NXUA 5J2GA 3HNKA 3RIPA 1K40A 3JCUQ 4WC6A 4EUKB 3NDBB 8ICRA 4MVSA 4U5EE 1D0YA 3LS1A 3JPRA 5FZTA 2ZPAA 5HRHA 1U0BB 4TURA 5D46A 1R89A 5CJ7A 1NFNA 3DKAA 4R63A 4XTKA 2VCCA 4DJ9A 2CDQA 3W8IA 1LIHA 4QZIA 3G4XA 3V7JA 3K1IA 4K4HA 2DRAA 4IARA 4U5CE 3PHF2 2PFQA 3JPPA 5CFUA 5HRFA 9ICKA 8ICZA 3B0XA 4R32A 4P4OA 2ZHAA 5CHEA 3K6BA 4EIYA 1R4TA 1Z23A 2XLHA 2J45A 3KKBA 4CDAA 3CEXA 4P6IC 4PHEA 4MFFA 4YL3A 1APCA 1ZHTA 1Q0FA 5J2CA 5BQGA 5IIIA 8ICIA 1RJ9B 4D4NA 4J30B 1PD1A 3IQ5A 4K0DA 1BPZA 2R7RA 4U5FE 4KLIA 4MTFA 5B1AC 5J0TA 1XWJA 2H7OA 4BJ6C 3HJ4A 3SZRA 3UPSA 3T4RA 4I27A 2VCBA 3M4BA 1TVAA 4I3MA 3ISDA 4X4RA 2WVQA 4K4IA 4RQ1A 4I1MA 3ZIBA 4AT7A 4KLEA 4YL0A 1G8XA 4QZAA 2Z15A 4AT7B 3MGHA 2LCHA 2WVOA 3JPOA 5B3QA 4JEBA 2RSEB 5JVEA 3JSZA 3VYWA 9ICHA 4BEJA 8ICEA 5KYXA 4K9BA 2WZLA 3H37A 2LK4A 2IYLD 5KYXB 4AL1A 5CFTA 3SXKA 2QUPA 4RQ3A 4WQKA 4N6HA 4XJEA 2O5AA 4EBBA 4GQHA 4LDKA 1OCRC 4CIHA 4XLNF 1TWAA 1T6QA 3HNLA 3LLKA 2X0CA 1NZEA 4AL0A 4DOBA 4WJ0A 5DQZA 4RQ8A 4X0AA 3CZ6A 3PCVA 2P0NA 1YLMA 3R2PA 2XXAA 3EHNA 3AU6A 3US6A 4OIOF 3ZQVA 1ZQTA 1HMOA 2XXAB 4MVZA 3WFPA 7ICPA 2ICWG 3NRHA 3JYHA 3W8HA 3OUYA 3MX3A 1Y4CA 3C62A 4RWQA 7ICEA 3IEEA 3WFRE 1O3UA 3OUYB 2BCUA 2KYHA 4KLDA 2OCCC 4MVOA 4XPYA 2BBHA 4ULVA 4CDYA 1RCPA 2VASA 3QMKA 4RWPA 4NTBA 4CS8A 4M9GA 1AEPA 3U0CA 4RDAA 3AGUA 1E2XA 4G7OF 2EIJC 2GDCA 4MW8A 4QDLA 3C2KA 3S29A 2R7QA 3U5SA 2HN2A 1HMDA 1D1AA 1VOMA 4UDVA 4JE9A 1YYXA 2EPOA 3C8GD 1BR2A 3KYJA 1H9TA 2CNWD 3HTKC 4N7RA 4NXXA 1T9KA 2EIKC 4DRHB 4F5OA 4MNDA 4MFAA 1NBBA 3ISBA 5DECA 4U5GA 3W2VA 4E8FA 2BPCA 1RMVA 2ZH1A 2DR8A 5HSWA 1ZQVA 1ZQBA 5F5FA 9ICQA 3G50A 2YEVA 5AGFA 4IRUA 4FHYA 1YA7O 2DB4A 4KM5A 5D61A 5HRKA 4LLEA 4KI2A 3N0TA 4CSAA 3MDCA 2P1AA 4PHDA 5B1BC 4I2GA 2D4UA 3ITFA 4M63A 4OAGA 5CR0A 3V7KA 2IHMA 5J2AA 1R8CA 4LACB 3E70C 1CGME 2BPFA 2W45A 5HR9A 8ICFA 3AG2C 4M04A 3N24A 4YJWA 3SEOA 5T3WA 3GANA 4PJNA 4K1OA 2BC5A 1ZQEA 4OAFA 2X51A 4DXWA 3I5QA 1MMDA 3AQBA 2ZH3A 3VM6A 1OCOC 1QSPA 4KNVA 4XQ8A 4XRHA 2L9JA 4O67A 3ECSA 4O5EA 1ZZPA 2I8BA 7ICJA 4XPXA 1C03A 5L0HA 5J2DA 1M2VB 3G4ZA 2FAPB 4X4OA 4KBLA 3X2QC 4YD1A 1H7IA 5CIVA 3GM3A 5J2BA 3AG1C 3DD7A 2IOQA 3NYBA 3B0PA 3H2UA 3O39A 3RH6A 4I2FA 2IXPA 9ICXA 4AX2A 4KLQA 1XSLA 4KLUA 3OV7A 3LNMB 4DOAA 1FTSA 1R8AA 1BPDA 3MYIA 1OW7A 5B3IA 3ABKC 5E3AA 3NVOA 4U5HA 5L0IA 5HRDA 3UQ0A 5CB1A 7ICIA 2YZSA 3U2MA 2LFFA 2L81A 5IIOA 4YN4A 4GYTA 4WC4A 5J0YA 3H2VA 1YVIA 5F2VO 5HHIA 2J7PA 1TWGA 2ETSA 4BJ1A 4F5NA 1O5HA 1EA8A 3I4UA 1T6IA 2HV7A 3WFQE 3EGDA 2M2WA 4J7YA 5AC5A 4UAWA 3ZVRA 1ZW2A 4YT4A 2FMPA 2C03A 4PK4A 4MF2A 1TWHA 2FGYA 2H7VC 2Y69C 4RWOA 3QVYA 7ICVA 4UB2A 3JPSA 4ANJA 3VAYA 5EOZA 4UD4A 2NSGA 2ZD9A 3GEIA 8ICCA 4RPZA 4N4WA 4NC3A 4KLLA 1FNTc 4DRJB 7ICSA 2XS8A 3ERCC 2KC3A 2DR9A 1PCXA 3NWIA 4BEMJ 2JPUA 2M64A 2FCLA 4PJMA 4X4QA 1SYQA 3DAFA 2PXIA 2NSFA 4LZDA 1BPBA 3ISCA 4EWCA 3S0XA 3RVYA 2DYSC 2R7UA 1VJ7A 4X4UA 2YRFA 4XEVA 1CPQA 2HV6A 4K96A 4OD5A 3EFOA 5FCLA 1U6HA 4HFFB 3EFOB 4OD4A 4PH5A 3LESA 2P6VA 4Z6EA 2JD3A 4ATBA 2KGOA 3JZ0A 3K33A 3HJ1A 3RVZA 4QZCA 3MBGA 4P9FA 4I2CA 4BJ5A 3AU2A 4ATBB 8ICTA 5CI8A 2NUPA 2AWYA 2DR7A 2OG2A 5D91A 4BJTA 3FXHA 5DS6A 3DM9B 2R7SA 1WATA 3SP1A 5JLIA 4IAQA 3AQKA 4JTCB 3C8ZA 3HWTA 1GQAA 4R66A 2WZGA 9ICUA 2XLEA 5HHHA 3PNCA 4E7ZA 4C7OA 3C18A 3UMHA 3NYLA 1ZVZA 4FH5A 2ASRA 1BR4A 4OAIZ 4NLNA 3ZWIA 1TFWA 2AU5A 3OA1A 4IWBA 3LK9A 1VFGA 3IQCA 3UXOA 1OW8A 4CIPA 4UD5A 4MVRA 1BDJB 3X1OA 5E33A 3EZHA 3S27A 4I0UA 2A0BA 2G3KA 3MGIA 3RJGA 3KH2A 3AUOA 2HHPA 5TJ5E 1HUOA 2Y3GA 2NPUA 1ZQZA 2LD6A 3Q6MA 4QZ8A 1MMNA 3RJJA 2J8WA 2ID1A 2IXOA 2AWCA 1JOGA 2XLWA 7ICOA 2R7OA 4R65A 2HFIA 4WC1A 1ORJA 2R05A 4WC5A 2Q9BA 1KNYA 4YK5A 2ISPA 7ICTA 2J9BA 3TQOA 4WC3A
chains in the Genus database with same CATH topology
3AU6A 1ZQNA 2JX0A 9ICBA 3OVAA 4E80A 1ZQTA 3WFPA 4UB3A 5J0WA 7ICPA 4I2JA 1UEUA 1ZQAA 3C2LA 4X4NA 3C8GA 3AQNA 1PX5A 3O10A 3H38A 3OUYA 3RQEA 2W9MA 3MFNA 7ICRA 1FA0A 4RWQA 4R64A 4KLGA 3C8GB 7ICEA 3WFRE 4X4TA 1O3UA 4YD2A 3OUYB 4F5QA 3MBYA 3UXNA 2BCUA 3L9DA 5J0XA 2HSBA 4FHWA 4KLDA 3GDXA 2ZH2A 2BCVA 4P2HA 1ZQPA 4K4GA 4NLKA 5HRIA 4NY8A 4X5VA 4RWPA 4RQ6A 4QZDA 4M9GA 4WC7A 3U0CA 1ZJNA 4RQ2A 2GWSA 9ICNA 4PHAA 1BPYA 3C2KA 5DEDA 8ICLA 1K05A 3RH4A 4YMMA 4Z6CA 4DOCA 7ICLA 3TFRA 3C8GD 4RQ5A 7ICFA 1ZQMA 4P4MA 2YWAA 4UBBA 4KLJA 5DKWA 3TULA 1V4AA 4F5OA 4QZFA 4NM2A 5J2KA 4NKTA 8ICOA 3K75D 4MFAA 3ISBA 3HW8A 3H39A 5DECA 4E8FA 1ZQYA 2BPCA 2ZH1A 2DR8A 5J0RA 1ZQVA 1YLQA 1ZQBA 5DDMA 2M2UA 3V72A 1Q79A 2ZH5A 3K7DA 9ICQA 5HRLA 8ICBA 3AQMA 1TV9A 4FHYA 2FMQA 4GXKA 1MIVA 4IQWA 5J0SA 5J29A 5IILA 3JPQA 4GXIA 5J2FA 5HRKA 4QZ9A 5CP2A 3RJHA 5DB7A 9ICGA 3MDCA 1WTYA 5DDYA 4PHDA 8ICAA 5J0UA 8ICUA 1PV3A 4F5PA 4M9NA 3V7LA 4I2GA 4GXJA 4Z6DA 4RQ0A 4LVSA 4UBCA 5CR0A 3V7KA 2BCSA 1RPLA 2IHMA 3L8JA 1UETA 5J2AA 9ICVA 1R8CA 4FH3A 2BPFA 5HR9A 8ICFA 4M04A 4I2HA 3UQ2A 4JWNA 2ZH6A 2Q66A 4I2DA 1ZQLA 3GM2A 4EBJA 9ICMA 4FHPA 8ICHA 3C5FA 1ZQEA 4RQ4A 8ICSA 2BCQA 1ZQOA 8ICYA 8ICNA 1KTMA 3C66A 2ZH3A 1MQ2A 3OGUA 1OW6A 4XQ8A 3B71A 4XRHA 9ICFA 4WC0A 9ICOA 1Q78A 3MDAA 5IINA 1R8BA 5HRGA 4I2EA 3OVBA 3AQLA 2RFFA 1ZZPA 4O5EA 7ICJA 4I2IA 4XUSA 9ICWA 4M5DA 1K04A 5J2DA 7ICKA 1KEJA 9ICPA 4TUPA 4XQ7A 4QZGA 2I9GA 3HIYA 3JPNA 4RPXA 3C2MA 2NRKA 5D4BA 4UB1A 5J2EA 2ZH8A 5HC9A 4YCXA 4X4OA 1ZQKA 4YD1A 3GM3A 4AT8A 5J2BA 4S3NA 3RQGA 4WBYA 5TZVA 5BOMA 3B0YA 5IIJA 4KLOA 5BOLA 4NKUA 7ICQA 3NYBA 2L6GA 4AT8B 4DO9A 5BPCA 4UAYA 4M9LA 3RH6A 1XSPA 4I2FA 4O5KA 5DB6A 9ICXA 3U3FA 4X4SA 8ICJA 4IQTA 4KLQA 1ZQFA 4X4PA 1ZQXA 1ZQGA 1MQ3A 4WC2A 4XA5A 1XSLA 4KLUA 3OV7A 4TUQA 3OVSA 1NOMA 4DOAA 4X4VA 4WBZA 1ZQUA 3PMNA 3UPQA 1R8AA 4O5CA 1BPDA 4QZEA 2L6FA 1OW7A 1ZQDA 3LQCB 2PFOA 1RZTA 5HRDA 3UQ0A 4PHPA 5CB1A 7ICIA 8ICKA 7ICUA 5IIOA 4M47A 3TFSA 4YN4A 8ICGA 1WWPA 5DB9A 3RQFA 4KLTA 4WC4A 5J0YA 5HHIA 5F2VO 8ICXA 2ZHBA 4QZHA 4PGYA 1JN3A 2ZH4A 4F5NA 4NXZA 4WCWA 9ICRA 4XEFA 2VANA 1ZQCA 5J0QA 2M2VA 2O1PA 5CA7A 3WFQE 4O9MA 2M2WA 1XSNA 3GM1A 3BRJA 4X0BA 1MIYA 4F5RA 5J0PA 4UAWA 1KDHA 2PFPA 2FMPA 2P66A 2ZH9A 4KLFA 4MF2A 4XEKA 9ICTA 3RJFA 1HUZA 3RJKA 4EP7A 2DR5A 2ISOA 4RWOA 5F28E 1ZQWA 7ICVA 3AJMA 4UB2A 4I2BA 1QVXA 3JPSA 4YMNA 1ZQQA 5EOZA 3RJIA 3L8IA 1ZQSA 4KLHA 4UD4A 8ICCA 4RPZA 7ICHA 5J2HA 1ZQRA 4KLLA 4M0AA 2Q00A 4UB4A 3UXPA 7ICSA 5J2IA 4KLMA 5DBBA 4AT9A 5J2GA 2DR9A 1K40A 3JPTA 4WC6A 8ICRA 5CHGA 2JPUA 3JPRA 1TFYA 5J0OA 4X4QA 3WFSC 5HRHA 2PXIA 3JYYA 4LZDA 4TURA 1BPBA 3ISCA 5D46A 1R89A 4UB5A 5CJ7A 4R63A 1VJ7A 4X4UA 4QZIA 4XEVA 5HRBA 2ZH7A 4M9HA 3V7JA 2KK1A 4K4HA 4UAZA 4E7XA 2DRAA 4FHVA 4JWMA 2PFQA 3JPPA 4PH5A 4Z6EA 1JQRA 4ATBA 3JZ0A 5HRFA 9ICKA 8ICZA 1JMSA 3B0XA 3HJ1A 1ZQJA 4QZCA 8ICPA 4R32A 4I2CA 4PPXA 4P4OA 5DBAA 3RJEA 3AU2A 4ATBB 2ZHAA 3S9OA 8ICTA 4MFCA 5J2JA 2BE3A 1WOLA 7ICMA 2M2TA 2DR7A 4I2AA 3C5GA 1UFBA 5DB8A 4PHEA 4MFFA 8ICVA 4RT3A 4TUSA 3AQKA 5J2CA 1JAJA 5DBCA 1ZQHA 4QZBA 4P4PA 9ICJA 5IIIA 2BPGA 8ICIA 3HWTA 4R66A 2BCRA 4I28A 5IIKA 9ICUA 5HHHA 4RT2A 4Z6FA 4NQFA 1BPZA 4KLIA 3PNCA 4M9JA 5J0TA 8ICWA 3C18A 1ZQIA 3HJ4A 4FH5A 3UPSA 2L6HA 4NM1A 1NO5A 7ICNA 1UEVA 4I27A 2DVIA 1TVAA 4NLNA 4M2YA 3ISDA 1TFWA 4X4RA 2PFNA 1MIWA 4K4IA 4RQ1A 9ICSA 5IIMA 3LK9A 4AT7A 1VFGA 1BPXA 9ICEA 9ICCA 3UXOA 1OW8A 9ICLA 4UD5A 4KLEA 5HREA 1F5AA 4QZAA 4AT7B 4FHXA 5D49A 3MGHA 4LZGA 7ICGA 1OU5A 2FMSA 4RQ7A 3JPOA 2PBEA 3MGIA 3HX0A 9ICAA 3RJGA 8ICQA 4RWNA 3AUOA 2HHPA 1ZJMA 8ICMA 4PGXA 4IG8A 1BPEA 9ICHA 4EBKA 9ICIA 4I29A 1HUOA 8ICEA 1ZQZA 4NLZA 3H37A 1WOTA 4YMOA 4QZ8A 2LK4A 3WFOA 3RJJA 2ID1A 4MF8A 4RQ3A 4RPYA 1JOGA 2O5AA 7ICOA 4LT6A 4PGQA 4IQVA 4R65A 4WC1A 3PMLA 2DRBA 5CWRA 4WC5A 1KNYA 4AT9B 4KLSA 2ISPA 4DOBA 7ICTA 3RH5A 4RQ8A 4FO6A 4WC3A 4X0AA 4IQUA 3H3AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AU6 A;  1ZQN A;  2JX0 A;  9ICB A;  3OVA A;  4E80 A;  1ZQT A;  3WFP A;  4UB3 A;  5J0W A;  7ICP A;  4I2J A;  1UEU A;  1ZQA A;  3C2L A;  4X4N A;  3C8G A;  3AQN A;  1PX5 A;  3O10 A;  3H38 A;  3OUY A;  3RQE A;  2W9M A;  3MFN A;  7ICR A;  1FA0 A;  4RWQ A;  4R64 A;  4KLG A;  3C8G B;  7ICE A;  3WFR E;  4X4T A;  1O3U A;  4YD2 A;  3OUY B;  4F5Q A;  3MBY A;  3UXN A;  2BCU A;  3L9D A;  5J0X A;  2HSB A;  4FHW A;  4KLD A;  3GDX A;  2ZH2 A;  2BCV A;  4P2H A;  1ZQP A;  4K4G A;  4NLK A;  5HRI A;  4NY8 A;  4X5V A;  4RWP A;  4RQ6 A;  4QZD A;  4M9G A;  4WC7 A;  3U0C A;  1ZJN A;  4RQ2 A;  2GWS A;  9ICN A;  4PHA A;  1BPY A;  3C2K A;  5DED A;  8ICL A;  1K05 A;  3RH4 A;  4YMM A;  4Z6C A;  4DOC A;  7ICL A;  3TFR A;  3C8G D;  4RQ5 A;  7ICF A;  1ZQM A;  4P4M A;  2YWA A;  4UBB A;  4KLJ A;  5DKW A;  3TUL A;  1V4A A;  4F5O A;  4QZF A;  4NM2 A;  5J2K A;  4NKT A;  8ICO A;  3K75 D;  4MFA A;  3ISB A;  3HW8 A;  3H39 A;  5DEC A;  4E8F A;  1ZQY A;  2BPC A;  2ZH1 A;  2DR8 A;  5J0R A;  1ZQV A;  1YLQ A;  1ZQB A;  5DDM A;  2M2U A;  3V72 A;  1Q79 A;  2ZH5 A;  3K7D A;  9ICQ A;  5HRL A;  8ICB A;  3AQM A;  1TV9 A;  4FHY A;  2FMQ A;  4GXK A;  1MIV A;  4IQW A;  5J0S A;  5J29 A;  5IIL A;  3JPQ A;  4GXI A;  5J2F A;  5HRK A;  4QZ9 A;  5CP2 A;  3RJH A;  5DB7 A;  9ICG A;  3MDC A;  1WTY A;  5DDY A;  4PHD A;  8ICA A;  5J0U A;  8ICU A;  1PV3 A;  4F5P A;  4M9N A;  3V7L A;  4I2G A;  4GXJ A;  4Z6D A;  4RQ0 A;  4LVS A;  4UBC A;  5CR0 A;  3V7K A;  2BCS A;  1RPL A;  2IHM A;  3L8J A;  1UET A;  5J2A A;  9ICV A;  1R8C A;  4FH3 A;  2BPF A;  5HR9 A;  8ICF A;  4M04 A;  4I2H A;  3UQ2 A;  4JWN A;  2ZH6 A;  2Q66 A;  4I2D A;  1ZQL A;  3GM2 A;  4EBJ A;  9ICM A;  4FHP A;  8ICH A;  3C5F A;  1ZQE A;  4RQ4 A;  8ICS A;  2BCQ A;  1ZQO A;  8ICY A;  8ICN A;  1KTM A;  3C66 A;  2ZH3 A;  1MQ2 A;  3OGU A;  1OW6 A;  4XQ8 A;  3B71 A;  4XRH A;  9ICF A;  4WC0 A;  9ICO A;  1Q78 A;  3MDA A;  5IIN A;  1R8B A;  5HRG A;  4I2E A;  3OVB A;  3AQL A;  2RFF A;  1ZZP A;  4O5E A;  7ICJ A;  4I2I A;  4XUS A;  9ICW A;  4M5D A;  1K04 A;  5J2D A;  7ICK A;  1KEJ A;  9ICP A;  4TUP A;  4XQ7 A;  4QZG A;  2I9G A;  3HIY A;  3JPN A;  4RPX A;  3C2M A;  2NRK A;  5D4B A;  4UB1 A;  5J2E A;  2ZH8 A;  5HC9 A;  4YCX A;  4X4O A;  1ZQK A;  4YD1 A;  3GM3 A;  4AT8 A;  5J2B A;  4S3N A;  3RQG A;  4WBY A;  5TZV A;  5BOM A;  3B0Y A;  5IIJ A;  4KLO A;  5BOL A;  4NKU A;  7ICQ A;  3NYB A;  2L6G A;  4AT8 B;  4DO9 A;  5BPC A;  4UAY A;  4M9L A;  3RH6 A;  1XSP A;  4I2F A;  4O5K A;  5DB6 A;  9ICX A;  3U3F A;  4X4S A;  8ICJ A;  4IQT A;  4KLQ A;  1ZQF A;  4X4P A;  1ZQX A;  1ZQG A;  1MQ3 A;  4WC2 A;  4XA5 A;  1XSL A;  4KLU A;  3OV7 A;  4TUQ A;  3OVS A;  1NOM A;  4DOA A;  4X4V A;  4WBZ A;  1ZQU A;  3PMN A;  3UPQ A;  1R8A A;  4O5C A;  1BPD A;  4QZE A;  2L6F A;  1OW7 A;  1ZQD A;  3LQC B;  2PFO A;  1RZT A;  5HRD A;  3UQ0 A;  4PHP A;  5CB1 A;  7ICI A;  8ICK A;  7ICU A;  5IIO A;  4M47 A;  3TFS A;  4YN4 A;  8ICG A;  1WWP A;  5DB9 A;  3RQF A;  4KLT A;  4WC4 A;  5J0Y A;  5HHI A;  5F2V O;  8ICX A;  2ZHB A;  4QZH A;  4PGY A;  1JN3 A;  2ZH4 A;  4F5N A;  4NXZ A;  4WCW A;  9ICR A;  4XEF A;  2VAN A;  1ZQC A;  5J0Q A;  2M2V A;  2O1P A;  5CA7 A;  3WFQ E;  4O9M A;  2M2W A;  1XSN A;  3GM1 A;  3BRJ A;  4X0B A;  1MIY A;  4F5R A;  5J0P A;  4UAW A;  1KDH A;  2PFP A;  2FMP A;  2P66 A;  2ZH9 A;  4KLF A;  4MF2 A;  4XEK A;  9ICT A;  3RJF A;  1HUZ A;  3RJK A;  4EP7 A;  2DR5 A;  2ISO A;  4RWO A;  5F28 E;  1ZQW A;  7ICV A;  3AJM A;  4UB2 A;  4I2B A;  1QVX A;  3JPS A;  4YMN A;  1ZQQ A;  5EOZ A;  3RJI A;  3L8I A;  1ZQS A;  4KLH A;  4UD4 A;  8ICC A;  4RPZ A;  7ICH A;  5J2H A;  1ZQR A;  4KLL A;  4M0A A;  2Q00 A;  4UB4 A;  3UXP A;  7ICS A;  5J2I A;  4KLM A;  5DBB A;  4AT9 A;  5J2G A;  2DR9 A;  1K40 A;  3JPT A;  4WC6 A;  8ICR A;  5CHG A;  2JPU A;  3JPR A;  1TFY A;  5J0O A;  4X4Q A;  3WFS C;  5HRH A;  2PXI A;  3JYY A;  4LZD A;  4TUR A;  1BPB A;  3ISC A;  5D46 A;  1R89 A;  4UB5 A;  5CJ7 A;  4R63 A;  1VJ7 A;  4X4U A;  4QZI A;  4XEV A;  5HRB A;  2ZH7 A;  4M9H A;  3V7J A;  2KK1 A;  4K4H A;  4UAZ A;  4E7X A;  2DRA A;  4FHV A;  4JWM A;  2PFQ A;  3JPP A;  4PH5 A;  4Z6E A;  1JQR A;  4ATB A;  3JZ0 A;  5HRF A;  9ICK A;  8ICZ A;  1JMS A;  3B0X A;  3HJ1 A;  1ZQJ A;  4QZC A;  8ICP A;  4R32 A;  4I2C A;  4PPX A;  4P4O A;  5DBA A;  3RJE A;  3AU2 A;  4ATB B;  2ZHA A;  3S9O A;  8ICT A;  4MFC A;  5J2J A;  2BE3 A;  1WOL A;  7ICM A;  2M2T A;  2DR7 A;  4I2A A;  3C5G A;  1UFB A;  5DB8 A;  4PHE A;  4MFF A;  8ICV A;  4RT3 A;  4TUS A;  3AQK A;  5J2C A;  1JAJ A;  5DBC A;  1ZQH A;  4QZB A;  4P4P A;  9ICJ A;  5III A;  2BPG A;  8ICI A;  3HWT A;  4R66 A;  2BCR A;  4I28 A;  5IIK A;  9ICU A;  5HHH A;  4RT2 A;  4Z6F A;  4NQF A;  1BPZ A;  4KLI A;  3PNC A;  4M9J A;  5J0T A;  8ICW A;  3C18 A;  1ZQI A;  3HJ4 A;  4FH5 A;  3UPS A;  2L6H A;  4NM1 A;  1NO5 A;  7ICN A;  1UEV A;  4I27 A;  2DVI A;  1TVA A;  4NLN A;  4M2Y A;  3ISD A;  1TFW A;  4X4R A;  2PFN A;  1MIW A;  4K4I A;  4RQ1 A;  9ICS A;  5IIM A;  3LK9 A;  4AT7 A;  1VFG A;  1BPX A;  9ICE A;  9ICC A;  3UXO A;  1OW8 A;  9ICL A;  4UD5 A;  4KLE A;  5HRE A;  1F5A A;  4QZA A;  4AT7 B;  4FHX A;  5D49 A;  3MGH A;  4LZG A;  7ICG A;  1OU5 A;  2FMS A;  4RQ7 A;  3JPO A;  2PBE A;  3MGI A;  3HX0 A;  9ICA A;  3RJG A;  8ICQ A;  4RWN A;  3AUO A;  2HHP A;  1ZJM A;  8ICM A;  4PGX A;  4IG8 A;  1BPE A;  9ICH A;  4EBK A;  9ICI A;  4I29 A;  1HUO A;  8ICE A;  1ZQZ A;  4NLZ A;  3H37 A;  1WOT A;  4YMO A;  4QZ8 A;  2LK4 A;  3WFO A;  3RJJ A;  2ID1 A;  4MF8 A;  4RQ3 A;  4RPY A;  1JOG A;  2O5A A;  7ICO A;  4LT6 A;  4PGQ A;  4IQV A;  4R65 A;  4WC1 A;  3PML A;  2DRB A;  5CWR A;  4WC5 A;  1KNY A;  4AT9 B;  4KLS A;  2ISP A;  4DOB A;  7ICT A;  3RH5 A;  4RQ8 A;  4FO6 A;  4WC3 A;  4X0A A;  4IQU A;  3H3A A; 
#chains in the Genus database with same CATH topology
 3WAQ A;  3DWW A;  1DOV A;  3GOR A;  9ICB A;  5J0W A;  2WVN A;  3C2L A;  4X4N A;  3NMK A;  3L34 A;  1PX5 A;  3O10 A;  2H8A A;  2B56 A;  1FA0 A;  4NY3 A;  3UXN A;  5A6K A;  4JW1 A;  2OEV A;  1HE1 A;  1M56 C;  2BCV A;  1ZQP A;  4LDQ A;  3FVY A;  4CJG A;  3AOU A;  5COG A;  4NY8 A;  4X5V A;  3IQ6 A;  5L0J A;  2A6H F;  5A6B D;  4QZD A;  1ZU5 A;  9ICN A;  1BPY A;  3NG1 A;  3MLG A;  4C3E A;  1EI7 A;  3Q7G A;  8ICL A;  2EIM C;  1E83 A;  2HUJ A;  1K05 A;  4X0R A;  3RH4 A;  1MQV A;  4CS9 C;  2XM0 A;  3NYJ A;  1ZQM A;  2G62 A;  2HJ3 A;  2YWA A;  3C63 A;  2NUT A;  3ER9 B;  1ZHZ A;  3NKE A;  3TUL A;  1FFT C;  2R7T A;  5J2K A;  8ICO A;  3K75 D;  2NUT B;  3HW8 A;  4G7H F;  5D92 A;  4F4B A;  1T5O A;  2P7V A;  3GWL A;  3N2Z B;  2CYD A;  3V72 A;  1Q79 A;  2PNO A;  1TV9 A;  2CCY A;  3ZG1 A;  4JVS A;  3POV A;  4IQW A;  4GXI A;  2WL8 A;  1I5N A;  5CP2 A;  5DB7 A;  4W8P A;  2XLO A;  3ABM C;  2MWQ A;  1A7E A;  5J0U A;  3V7L A;  2IXM A;  4DVZ A;  4E17 A;  1S7Z A;  4RQ0 A;  4UBC A;  1LS1 A;  4O6A A;  1Z5Z A;  3F46 A;  1UET A;  9ICV A;  1T01 A;  2HSQ A;  2QLA A;  4LLC A;  3UQ2 A;  4JWN A;  5E2Q A;  1ZQL A;  1C02 A;  1YAR O;  4PJJ A;  4EBJ A;  4WGZ A;  4FHP A;  1D0X A;  4C3B A;  2BCQ A;  1WAS A;  1WN0 A;  1MQ2 A;  4XWJ A;  1OW6 A;  1NU7 D;  2IHO A;  3K1H A;  1JPJ A;  9ICO A;  4ONS A;  1R8B A;  1TFK B;  2E87 A;  3AQL A;  2GFH A;  4DOZ A;  4I2I A;  1M6T A;  2IBF A;  2WZF A;  2XM4 A;  3JRM O;  7ICK A;  3M15 A;  2ZXW C;  5A6A A;  1KEJ A;  1LI7 A;  3HNI A;  1Y6D A;  3JPN A;  4KNW A;  3EQL F;  2ZH8 A;  4O69 A;  4Q5S F;  2Y3B A;  5L0G A;  4JKV A;  2XRH A;  4K8V A;  3LEV A;  3SXY A;  4AT8 A;  3RQG A;  4WBY A;  4AT8 B;  2Y3D A;  5BPC A;  4UAY A;  3E9V A;  4M9L A;  1XSP A;  3VF0 A;  3U3F A;  1IZM A;  1ZQX A;  3OEO A;  3T6G B;  3U9J A;  3RH3 A;  1MQ3 A;  1ZQG A;  3L1M A;  2Q4F A;  4E7S A;  1ORS C;  1ZQU A;  4WBZ A;  3PMN A;  3UPQ A;  4O5C A;  2L6F A;  3UR3 C;  2OQM A;  3LQC B;  1V54 C;  4YT8 A;  4O6Y A;  3HLZ A;  4PHP A;  3H65 A;  2GA9 D;  3FAP B;  5T1D B;  3KL4 A;  4Q7C A;  8ICX A;  1YYJ A;  4QZH A;  2ZH4 A;  3ZQY A;  4WCW A;  3IHU A;  9ICR A;  4XEF A;  5J0Q A;  2M2V A;  2O1P A;  5CA7 A;  2XL6 A;  1OR3 A;  2HMQ A;  3EZI A;  5J0P A;  1S05 A;  3EGX A;  2OJE D;  2PF4 E;  2P66 A;  4KLF A;  2FFH A;  4E0I A;  4XEK A;  3SNH A;  3RJF A;  1HUZ A;  3GEE A;  2ISO A;  5KYW A;  5F28 E;  1ZQW A;  3ASO C;  1QVX A;  3FHD A;  3RJI A;  1ZQS A;  5KYW B;  3TD7 A;  7ICH A;  3LS0 A;  3UXP A;  4AT9 A;  1ORY A;  2J7P D;  3B9Q A;  1B68 A;  3IQT A;  4HFK B;  1CGO A;  3T9O A;  5CHG A;  4FX5 A;  3AG3 C;  3R7C A;  3Q6N A;  2J0W A;  1MMG A;  1OXK A;  2MYS A;  3UGP A;  2IUB A;  2F22 A;  1VYI A;  4A2N B;  5HRB A;  4CS7 A;  3A9C A;  4Z9J A;  2ZH7 A;  4JCH A;  3EJN A;  5DS5 A;  2GAQ A;  4AK9 A;  4E7X A;  4FHV A;  3TOM A;  4JWM A;  1OQC A;  2BE5 F;  3V5Y A;  5IY5 C;  1YDI A;  5KYN A;  3V7O A;  1JMS A;  1ZQJ A;  1UG7 A;  4CX9 A;  3U8V A;  3AG4 C;  2B0H A;  3QW1 A;  4U9D A;  1ZHX A;  3RW0 A;  3S9O A;  2IM8 A;  5BQI A;  1RKE A;  4MFC A;  4OIR F;  5J2J A;  1WOL A;  2A68 F;  1OKK A;  2M2T A;  1RKE B;  256B A;  1D0Z A;  2DGJ A;  5DB8 A;  8ICV A;  4TUS A;  1JAJ A;  3U9M A;  5DBC A;  9ICJ A;  2BPG A;  3FAJ A;  2CGE A;  3VRC A;  2BCR A;  2O9X A;  2EIL C;  4I28 A;  4RT2 A;  4NQF A;  1TKN A;  3DM5 A;  4JEA A;  3DE8 A;  1FFH A;  2YHS A;  2W4M A;  2L6H A;  7ICN A;  3KYI A;  1G5Z A;  4O79 A;  1UEV A;  2A6E F;  1H9G A;  2QNL A;  1JAF A;  4K97 A;  2GA0 A;  4O68 A;  2UUI A;  1TQG A;  1MIW A;  1JMW A;  1AUE A;  5GPG B;  5IIM A;  1Q0G A;  1SF8 A;  9ICC A;  3EF2 A;  3LNR A;  1FR0 A;  5HRE A;  1F5A A;  3KMI A;  1FMV A;  4O7G A;  3B0V C;  4FHX A;  5D49 A;  3TOL A;  3EGD B;  4LZG A;  7ICG A;  1OU5 A;  1U89 A;  2PBE A;  8ICQ A;  3OWT A;  5T3T A;  1J8M F;  3DI5 A;  1ZJM A;  1VLT A;  8ICM A;  4EBK A;  4I29 A;  3IPM O;  5DVW A;  2YQY A;  1EQ1 A;  1BR1 A;  4U5B E;  4NLZ A;  4K98 A;  4YMO A;  4PR9 A;  3K66 A;  3JRT A;  4MF8 A;  1LPE A;  1ZHY A;  1ZW3 A;  4RPY A;  4HEA J;  1F1M A;  5JUA A;  4PGQ A;  1RKC A;  1JR8 A;  3U3B A;  4MQ9 F;  2BL2 A;  3HNJ A;  5CWR A;  2DRB A;  2GAF D;  2Q3T A;  4MVM A;  4KLS A;  3S84 A;  4FO6 A;  3UMI A;  3H3A A;  3LJB A;  4FO1 A;  1ZU4 A;  1JPN A;  1O87 A;  4KB6 A;  2JX0 A;  3OVA A;  3CK6 A;  2LSE A;  1D1B A;  1SMY F;  5F5H A;  1HW1 A;  4MS2 A;  5CI9 A;  4I2J A;  1ZQA A;  4EED A;  2NG1 A;  1QLE C;  3ZC4 A;  3AQN A;  3F47 A;  2B0J A;  4NXV A;  2QY9 A;  4G78 A;  3MFN A;  2IXN A;  4F5Q A;  3MBY A;  2LQG A;  4MKP A;  3K1I C;  3L9D A;  4FHW A;  1XZQ A;  2ZH2 A;  1NLX A;  4P2H A;  4NLK A;  4I44 A;  2Q7R A;  1A7V A;  3DZA A;  4RQ6 A;  4FWV A;  4O6M A;  1ZJN A;  4YWQ A;  1LKX A;  5L0F A;  2NUP B;  4WH5 A;  2J9V A;  4PHA A;  2OOC A;  2VH3 A;  5DED A;  4H54 A;  7ICL A;  1HE9 A;  3RF3 A;  4RQ5 A;  5EK0 A;  3FOP A;  2ZXO A;  5B3P A;  2YL1 A;  2W4B A;  4UBB A;  4KLJ A;  2V26 A;  1LE2 A;  4QZF A;  2KNH A;  4C7O B;  4NM2 A;  1LE4 A;  3M4C A;  4CBE A;  3SYN A;  1ZQY A;  4JJG A;  1YLQ A;  2M2U A;  5HRL A;  3AQM A;  2MHR A;  4D4X A;  2TMV P;  1MIV A;  5J0S A;  2PP4 A;  3T6J A;  1TR2 A;  1MND A;  4QZ9 A;  3RJH A;  9ICG A;  2Y39 A;  5D62 A;  3W2W A;  2HS5 A;  3Q7L A;  4PFO A;  1PV3 A;  4F5P A;  1YJG A;  4EHP A;  4GXJ A;  3NMI A;  4Z6D A;  4ER9 A;  3V5Z A;  4N6C A;  2BCS A;  3B0U X;  1RPL A;  2OJQ A;  2LP4 A;  3LEO A;  3MYF A;  1Z3I X;  4FH3 A;  4I2H A;  2ZXP A;  1LM3 B;  4JLZ A;  4I2D A;  4KC9 A;  3GM2 A;  2OKU A;  9ICM A;  8ICH A;  1E85 A;  3L0I A;  3C5F A;  1A0B A;  4RQ4 A;  1E86 A;  1M57 C;  3ZSU A;  2RD9 A;  1ZHW A;  8ICN A;  4I1O B;  1KTM A;  1PD0 A;  2R7X A;  2HZ8 A;  4JJF A;  1Q0M A;  5AC4 A;  9ICF A;  2OU6 A;  1Q78 A;  2HN1 A;  5HRG A;  3OWG A;  4XPW A;  4U9E A;  4XUS A;  9ICW A;  5EHH A;  4NXW A;  1VB5 A;  3NKD A;  4C3D A;  1K04 A;  2LFD A;  3LUT B;  5A69 A;  9ICP A;  4TUP A;  5B3S C;  4WAB A;  2J0X A;  2B4V A;  4QZG A;  2I9G A;  3HIY A;  4RPX A;  2NRK A;  5D4B A;  2V3C C;  4UB1 A;  4MVQ A;  5J2E A;  1I4Z A;  4YCX A;  1ZQK A;  2R9R B;  4GEH A;  3QZC A;  5TZV A;  4KLO A;  4NKU A;  1RXQ A;  2L6G A;  2XSE A;  4WQL A;  4RD9 A;  3RKO F;  4CS8 C;  4O5K A;  3RFY A;  4X4S A;  4EKW A;  8ICJ A;  1ZQF A;  2XL8 A;  3S90 A;  1RJ9 A;  4WC2 A;  2QE9 A;  1NOM A;  1V55 C;  1VK5 A;  4JTA B;  3U8P A;  1Z6A A;  4QZE A;  2YL0 A;  1ZQD A;  3O55 A;  4YN0 B;  2PFO A;  1RZT A;  4IAO A;  3SXM A;  2R25 A;  8ICK A;  5BUO A;  3KPH A;  4OIP F;  1R5I D;  1VLS A;  3DXJ F;  3TFS A;  8ICG A;  3RQF A;  4KLT A;  1WGW A;  2ZHB A;  2EWR A;  4PGY A;  4NXZ A;  3DAG A;  2VAN A;  3JCF A;  4O9M A;  4BG0 A;  1TFO B;  1LS4 A;  1XSN A;  3GM1 A;  4F5R A;  4X0B A;  1MIY A;  2EPL X;  1W2W A;  1KU2 A;  2PFP A;  3PMR A;  2KW3 C;  2ZH9 A;  2EPK X;  4CSA C;  1Q0K A;  9ICT A;  4JCZ A;  4EP7 A;  4DRI B;  3AJM A;  2PX3 A;  4DBR A;  1ZQQ A;  4P9T A;  5J2H A;  1ZQR A;  4UB4 A;  3GWN A;  2KSF A;  5J2I A;  4KLM A;  3JPT A;  1JRA A;  3PDM P;  1J8Y F;  1E84 A;  1TFY A;  5J0O A;  3WFS C;  4Z9I A;  2R02 A;  3JYY A;  2AVK A;  5JP7 A;  5A6B A;  1A41 A;  4NTA A;  4FAP B;  4UB5 A;  2YKZ A;  3WHN A;  3DE9 A;  4O6N A;  1Z63 A;  2R7W A;  2UUH A;  1EKY A;  2Q9C A;  4M9H A;  5COF A;  1XZP A;  2KK1 A;  5D63 A;  3M79 A;  3UGO A;  4UAZ A;  4JTD B;  1C17 M;  3QVZ A;  2A0U A;  2CW0 F;  3ER8 C;  1JQR A;  3ASN C;  3O6X A;  1IW7 F;  4YT2 A;  8ICP A;  4PPX A;  3GEH A;  4Q4Z F;  5DBA A;  3RJE A;  5JSL A;  2BE3 A;  2A69 F;  7ICM A;  4I2A A;  4CS9 A;  4IB4 A;  4QI0 A;  3C5G A;  1UFB A;  4ZLD A;  4HX0 A;  3SXZ A;  4OAH A;  3DJN B;  2B51 A;  4RT3 A;  4BJ6 A;  4B6I A;  1ZQH A;  4QZB A;  4P4P A;  1OCC C;  1OCZ C;  1QPU A;  1NU9 C;  5IIK A;  3DJU B;  4Z6F A;  1VMA A;  4M9J A;  1NSG B;  2LIG A;  8ICW A;  4LEZ A;  1ZQI A;  4PJL A;  1BBH A;  4NM1 A;  1NO5 A;  2DVI A;  4ULW A;  2EPM X;  4M2Y A;  4N06 A;  1OKK D;  2PFN A;  1QKR A;  4G7Z F;  3CSK A;  9ICS A;  4YL1 A;  2XLV A;  5L0D A;  1YAU O;  1BPX A;  9ICE A;  9ICL A;  3QTH A;  3U2L A;  3V5X A;  3EH2 A;  3HKK A;  4K7B A;  5K0I A;  2FMS A;  4EEB A;  4RQ7 A;  9ICA A;  3HX0 A;  3UNG C;  3A11 A;  4RWN A;  3EGX B;  4PGX A;  4AE4 A;  4IG8 A;  1BPE A;  9ICI A;  3EH1 A;  3ATP A;  2R7V A;  4OIQ F;  2PFD A;  4AE4 B;  1WOT A;  1BZ4 A;  3WFO A;  3ABL C;  4LDR A;  1Z7Q c;  2ZXR A;  4LT6 A;  4IQV A;  2YVK A;  1SZI A;  3PML A;  2XS1 A;  3EPV A;  4AT9 B;  1TWC A;  2YLG A;  3RH5 A;  2A1D D;  4IQU A;  4W8K A;  3C7J A;  2I15 A;  4IJJ A;  1OXB A;  1ZQN A;  4MTG A;  4E80 A;  2HMZ A;  2HJM A;  2VC9 A;  5E3C A;  4LEY A;  2J9W A;  4UB3 A;  2R03 A;  1UEU A;  3C8G A;  1NG1 A;  2CNW A;  3H38 A;  1M2V A;  3RQE A;  2VB6 A;  5JTG A;  2W9M A;  3ZDL A;  7ICR A;  1MNE A;  1GPJ A;  4R64 A;  3C8G B;  4KLG A;  4X4T A;  4YD2 A;  1L7C A;  5JS5 A;  5J0X A;  2HSB A;  3GDX A;  4K4G A;  5HRI A;  4K99 A;  1GM5 A;  1ST6 A;  3NKU A;  3ZTZ A;  4WC7 A;  2GWW A;  3LAY A;  4WOY A;  4RQ2 A;  2GWS A;  3FDQ A;  5L3V A;  4MTO A;  2DYR C;  3ZTM A;  1OR2 A;  4BJ5 C;  2KJG A;  2KQ9 A;  4HE8 D;  4YMM A;  4Z6C A;  4DOC A;  3TFR A;  3JSE O;  1Q0D A;  7ICF A;  5CFS A;  1SR2 A;  4QI2 A;  4P4M A;  1L3P A;  4EGW A;  5DKW A;  4JRZ A;  1CPR A;  1V4A A;  3AGT A;  4NKT A;  5DLJ A;  4PAC A;  2Y3H A;  2BBJ A;  3H39 A;  1HW2 A;  4YT5 A;  1A7D A;  2WB7 A;  2YLI A;  5J0R A;  5DDM A;  1MMA A;  1QZX A;  3JT1 A;  3K7D A;  5JRA A;  4BPM A;  2ZH5 A;  8ICB A;  3FOO A;  1YZC A;  2Q9A A;  2FMQ A;  4Z9H A;  4GXK A;  1LVK A;  1V74 B;  1GGQ A;  4CDV A;  2EIN C;  5J29 A;  5IIL A;  3JPQ A;  2L7A A;  2YL3 A;  4E18 A;  5KYU A;  5J2F A;  4JZA A;  1WTY A;  4ZLC A;  5DDY A;  2W9Y A;  3T6B A;  8ICA A;  5DQT A;  5KYU B;  4NTF A;  8ICU A;  3RYL A;  4M9N A;  3JTL O;  3GOD A;  4DVY P;  4LVS A;  4LEV A;  3L8J A;  4EV6 A;  2M4E A;  1M2O A;  1GS9 A;  1I4Y A;  3S28 A;  4XQ1 A;  2ZH6 A;  2Q66 A;  3TJ5 A;  1CGN A;  2J46 A;  3QW0 A;  4G0H A;  4JIO A;  3EG9 A;  5JT4 A;  8ICS A;  1ZQO A;  4LER A;  8ICY A;  4LEW A;  2HKV A;  3EG9 B;  3NYM A;  2XLD A;  3C66 A;  3FMS A;  3OGU A;  4IGG A;  3B71 A;  4WC0 A;  1G4W R;  4H4K C;  3MDA A;  5IIN A;  4JLX A;  4I2E A;  3OVB A;  2RFF A;  3CAX A;  1HY5 A;  1VYK A;  4M5D A;  1H6G A;  2EPN A;  3AQC A;  2PX0 A;  1YZA A;  4OIN F;  4XQ7 A;  2J9U A;  3C2M A;  5A6J A;  4XLP F;  5HC9 A;  5HV9 A;  1N1C A;  1YA9 A;  4CJO A;  4JC7 A;  2OEX A;  2P61 A;  4S3N A;  5BOM A;  4RBN A;  3B0Y A;  5IIJ A;  4J7T A;  4L6R A;  5BOL A;  3BEH A;  4U5D E;  1LI5 A;  3WG7 C;  7ICQ A;  5COM A;  4DO9 A;  1QQ3 A;  5DB6 A;  2XL4 A;  3NMJ A;  4A4A A;  3J06 A;  4WGY A;  4MW3 A;  4IQT A;  3EHM A;  4X4P A;  2VCA A;  4XA5 A;  1FMW A;  4TUQ A;  3OVS A;  4X4V A;  3PHZ A;  4K9A A;  3MCR A;  3DMD A;  2H7B A;  3UMK A;  1ZYR F;  4FES A;  2DI3 A;  1FAP B;  2C04 A;  7ICU A;  4NXT A;  5DS4 A;  4J32 B;  4M47 A;  2XLM A;  1VTM P;  3WOD F;  1WWP A;  3HJC A;  5DB9 A;  2YLD A;  1T6U A;  4DBQ A;  1JN3 A;  3CQZ A;  4NCQ A;  5L3Q A;  3W4Y A;  3M1C B;  1ZQC A;  3BRJ A;  1G4U S;  4JUR I;  3TJ6 A;  1KDH A;  2AP3 A;  1AVO B;  5BQH A;  3I5P A;  5KYY A;  2YL7 A;  2D5R B;  5L0C A;  3RJK A;  2DR5 A;  2G3V A;  4I2B A;  5KYY B;  4YMN A;  3L8I A;  4KLH A;  4E0H A;  3TK0 A;  3B29 A;  1D1C A;  1NFO A;  4PFP A;  4M0A A;  2Q00 A;  1DOW A;  5EGY A;  2QTV A;  5DBB A;  3LLI A;  4MVU A;  4NXU A;  5J2G A;  3HNK A;  3RIP A;  1K40 A;  3JCU Q;  4WC6 A;  4EUK B;  3NDB B;  8ICR A;  4MVS A;  4U5E E;  1D0Y A;  3LS1 A;  3JPR A;  5FZT A;  2ZPA A;  5HRH A;  1U0B B;  4TUR A;  5D46 A;  1R89 A;  5CJ7 A;  1NFN A;  3DKA A;  4R63 A;  4XTK A;  2VCC A;  4DJ9 A;  2CDQ A;  3W8I A;  1LIH A;  4QZI A;  3G4X A;  3V7J A;  3K1I A;  4K4H A;  2DRA A;  4IAR A;  4U5C E;  3PHF 2;  2PFQ A;  3JPP A;  5CFU A;  5HRF A;  9ICK A;  8ICZ A;  3B0X A;  4R32 A;  4P4O A;  2ZHA A;  5CHE A;  3K6B A;  4EIY A;  1R4T A;  1Z23 A;  2XLH A;  2J45 A;  3KKB A;  4CDA A;  3CEX A;  4P6I C;  4PHE A;  4MFF A;  4YL3 A;  1APC A;  1ZHT A;  1Q0F A;  5J2C A;  5BQG A;  5III A;  8ICI A;  1RJ9 B;  4D4N A;  4J30 B;  1PD1 A;  3IQ5 A;  4K0D A;  1BPZ A;  2R7R A;  4U5F E;  4KLI A;  4MTF A;  5B1A C;  5J0T A;  1XWJ A;  2H7O A;  4BJ6 C;  3HJ4 A;  3SZR A;  3UPS A;  3T4R A;  4I27 A;  2VCB A;  3M4B A;  1TVA A;  4I3M A;  3ISD A;  4X4R A;  2WVQ A;  4K4I A;  4RQ1 A;  4I1M A;  3ZIB A;  4AT7 A;  4KLE A;  4YL0 A;  1G8X A;  4QZA A;  2Z15 A;  4AT7 B;  3MGH A;  2LCH A;  2WVO A;  3JPO A;  5B3Q A;  4JEB A;  2RSE B;  5JVE A;  3JSZ A;  3VYW A;  9ICH A;  4BEJ A;  8ICE A;  5KYX A;  4K9B A;  2WZL A;  3H37 A;  2LK4 A;  2IYL D;  5KYX B;  4AL1 A;  5CFT A;  3SXK A;  2QUP A;  4RQ3 A;  4WQK A;  4N6H A;  4XJE A;  2O5A A;  4EBB A;  4GQH A;  4LDK A;  1OCR C;  4CIH A;  4XLN F;  1TWA A;  1T6Q A;  3HNL A;  3LLK A;  2X0C A;  1NZE A;  4AL0 A;  4DOB A;  4WJ0 A;  5DQZ A;  4RQ8 A;  4X0A A;  3CZ6 A;  3PCV A;  2P0N A;  1YLM A;  3R2P A;  2XXA A;  3EHN A;  3AU6 A;  3US6 A;  4OIO F;  3ZQV A;  1ZQT A;  1HMO A;  2XXA B;  4MVZ A;  3WFP A;  7ICP A;  2ICW G;  3NRH A;  3JYH A;  3W8H A;  3OUY A;  3MX3 A;  1Y4C A;  3C62 A;  4RWQ A;  7ICE A;  3IEE A;  3WFR E;  1O3U A;  3OUY B;  2BCU A;  2KYH A;  4KLD A;  2OCC C;  4MVO A;  4XPY A;  2BBH A;  4ULV A;  4CDY A;  1RCP A;  2VAS A;  3QMK A;  4RWP A;  4NTB A;  4CS8 A;  4M9G A;  1AEP A;  3U0C A;  4RDA A;  3AGU A;  1E2X A;  4G7O F;  2EIJ C;  2GDC A;  4MW8 A;  4QDL A;  3C2K A;  3S29 A;  2R7Q A;  3U5S A;  2HN2 A;  1HMD A;  1D1A A;  1VOM A;  4UDV A;  4JE9 A;  1YYX A;  2EPO A;  3C8G D;  1BR2 A;  3KYJ A;  1H9T A;  2CNW D;  3HTK C;  4N7R A;  4NXX A;  1T9K A;  2EIK C;  4DRH B;  4F5O A;  4MND A;  4MFA A;  1NBB A;  3ISB A;  5DEC A;  4U5G A;  3W2V A;  4E8F A;  2BPC A;  1RMV A;  2ZH1 A;  2DR8 A;  5HSW A;  1ZQV A;  1ZQB A;  5F5F A;  9ICQ A;  3G50 A;  2YEV A;  5AGF A;  4IRU A;  4FHY A;  1YA7 O;  2DB4 A;  4KM5 A;  5D61 A;  5HRK A;  4LLE A;  4KI2 A;  3N0T A;  4CSA A;  3MDC A;  2P1A A;  4PHD A;  5B1B C;  4I2G A;  2D4U A;  3ITF A;  4M63 A;  4OAG A;  5CR0 A;  3V7K A;  2IHM A;  5J2A A;  1R8C A;  4LAC B;  3E70 C;  1CGM E;  2BPF A;  2W45 A;  5HR9 A;  8ICF A;  3AG2 C;  4M04 A;  3N24 A;  4YJW A;  3SEO A;  5T3W A;  3GAN A;  4PJN A;  4K1O A;  2BC5 A;  1ZQE A;  4OAF A;  2X51 A;  4DXW A;  3I5Q A;  1MMD A;  3AQB A;  2ZH3 A;  3VM6 A;  1OCO C;  1QSP A;  4KNV A;  4XQ8 A;  4XRH A;  2L9J A;  4O67 A;  3ECS A;  4O5E A;  1ZZP A;  2I8B A;  7ICJ A;  4XPX A;  1C03 A;  5L0H A;  5J2D A;  1M2V B;  3G4Z A;  2FAP B;  4X4O A;  4KBL A;  3X2Q C;  4YD1 A;  1H7I A;  5CIV A;  3GM3 A;  5J2B A;  3AG1 C;  3DD7 A;  2IOQ A;  3NYB A;  3B0P A;  3H2U A;  3O39 A;  3RH6 A;  4I2F A;  2IXP A;  9ICX A;  4AX2 A;  4KLQ A;  1XSL A;  4KLU A;  3OV7 A;  3LNM B;  4DOA A;  1FTS A;  1R8A A;  1BPD A;  3MYI A;  1OW7 A;  5B3I A;  3ABK C;  5E3A A;  3NVO A;  4U5H A;  5L0I A;  5HRD A;  3UQ0 A;  5CB1 A;  7ICI A;  2YZS A;  3U2M A;  2LFF A;  2L81 A;  5IIO A;  4YN4 A;  4GYT A;  4WC4 A;  5J0Y A;  3H2V A;  1YVI A;  5F2V O;  5HHI A;  2J7P A;  1TWG A;  2ETS A;  4BJ1 A;  4F5N A;  1O5H A;  1EA8 A;  3I4U A;  1T6I A;  2HV7 A;  3WFQ E;  3EGD A;  2M2W A;  4J7Y A;  5AC5 A;  4UAW A;  3ZVR A;  1ZW2 A;  4YT4 A;  2FMP A;  2C03 A;  4PK4 A;  4MF2 A;  1TWH A;  2FGY A;  2H7V C;  2Y69 C;  4RWO A;  3QVY A;  7ICV A;  4UB2 A;  3JPS A;  4ANJ A;  3VAY A;  5EOZ A;  4UD4 A;  2NSG A;  2ZD9 A;  3GEI A;  8ICC A;  4RPZ A;  4N4W A;  4NC3 A;  4KLL A;  1FNT c;  4DRJ B;  7ICS A;  2XS8 A;  3ERC C;  2KC3 A;  2DR9 A;  1PCX A;  3NWI A;  4BEM J;  2JPU A;  2M64 A;  2FCL A;  4PJM A;  4X4Q A;  1SYQ A;  3DAF A;  2PXI A;  2NSF A;  4LZD A;  1BPB A;  3ISC A;  4EWC A;  3S0X A;  3RVY A;  2DYS C;  2R7U A;  1VJ7 A;  4X4U A;  2YRF A;  4XEV A;  1CPQ A;  2HV6 A;  4K96 A;  4OD5 A;  3EFO A;  5FCL A;  1U6H A;  4HFF B;  3EFO B;  4OD4 A;  4PH5 A;  3LES A;  2P6V A;  4Z6E A;  2JD3 A;  4ATB A;  2KGO A;  3JZ0 A;  3K33 A;  3HJ1 A;  3RVZ A;  4QZC A;  3MBG A;  4P9F A;  4I2C A;  4BJ5 A;  3AU2 A;  4ATB B;  8ICT A;  5CI8 A;  2NUP A;  2AWY A;  2DR7 A;  2OG2 A;  5D91 A;  4BJT A;  3FXH A;  5DS6 A;  3DM9 B;  2R7S A;  1WAT A;  3SP1 A;  5JLI A;  4IAQ A;  3AQK A;  4JTC B;  3C8Z A;  3HWT A;  1GQA A;  4R66 A;  2WZG A;  9ICU A;  2XLE A;  5HHH A;  3PNC A;  4E7Z A;  4C7O A;  3C18 A;  3UMH A;  3NYL A;  1ZVZ A;  4FH5 A;  2ASR A;  1BR4 A;  4OAI Z;  4NLN A;  3ZWI A;  1TFW A;  2AU5 A;  3OA1 A;  4IWB A;  3LK9 A;  1VFG A;  3IQC A;  3UXO A;  1OW8 A;  4CIP A;  4UD5 A;  4MVR A;  1BDJ B;  3X1O A;  5E33 A;  3EZH A;  3S27 A;  4I0U A;  2A0B A;  2G3K A;  3MGI A;  3RJG A;  3KH2 A;  3AUO A;  2HHP A;  5TJ5 E;  1HUO A;  2Y3G A;  2NPU A;  1ZQZ A;  2LD6 A;  3Q6M A;  4QZ8 A;  1MMN A;  3RJJ A;  2J8W A;  2ID1 A;  2IXO A;  2AWC A;  1JOG A;  2XLW A;  7ICO A;  2R7O A;  4R65 A;  2HFI A;  4WC1 A;  1ORJ A;  2R05 A;  4WC5 A;  2Q9B A;  1KNY A;  4YK5 A;  2ISP A;  7ICT A;  2J9B A;  3TQO A;  4WC3 A; 
#chains in the Genus database with same CATH homology
 3AU6 A;  1ZQN A;  2JX0 A;  9ICB A;  3OVA A;  4E80 A;  1ZQT A;  3WFP A;  4UB3 A;  5J0W A;  7ICP A;  4I2J A;  1UEU A;  1ZQA A;  3C2L A;  4X4N A;  3C8G A;  3AQN A;  1PX5 A;  3O10 A;  3H38 A;  3OUY A;  3RQE A;  2W9M A;  3MFN A;  7ICR A;  1FA0 A;  4RWQ A;  4R64 A;  4KLG A;  3C8G B;  7ICE A;  3WFR E;  4X4T A;  1O3U A;  4YD2 A;  3OUY B;  4F5Q A;  3MBY A;  3UXN A;  2BCU A;  3L9D A;  5J0X A;  2HSB A;  4FHW A;  4KLD A;  3GDX A;  2ZH2 A;  2BCV A;  4P2H A;  1ZQP A;  4K4G A;  4NLK A;  5HRI A;  4NY8 A;  4X5V A;  4RWP A;  4RQ6 A;  4QZD A;  4M9G A;  4WC7 A;  3U0C A;  1ZJN A;  4RQ2 A;  2GWS A;  9ICN A;  4PHA A;  1BPY A;  3C2K A;  5DED A;  8ICL A;  1K05 A;  3RH4 A;  4YMM A;  4Z6C A;  4DOC A;  7ICL A;  3TFR A;  3C8G D;  4RQ5 A;  7ICF A;  1ZQM A;  4P4M A;  2YWA A;  4UBB A;  4KLJ A;  5DKW A;  3TUL A;  1V4A A;  4F5O A;  4QZF A;  4NM2 A;  5J2K A;  4NKT A;  8ICO A;  3K75 D;  4MFA A;  3ISB A;  3HW8 A;  3H39 A;  5DEC A;  4E8F A;  1ZQY A;  2BPC A;  2ZH1 A;  2DR8 A;  5J0R A;  1ZQV A;  1YLQ A;  1ZQB A;  5DDM A;  2M2U A;  3V72 A;  1Q79 A;  2ZH5 A;  3K7D A;  9ICQ A;  5HRL A;  8ICB A;  3AQM A;  1TV9 A;  4FHY A;  2FMQ A;  4GXK A;  1MIV A;  4IQW A;  5J0S A;  5J29 A;  5IIL A;  3JPQ A;  4GXI A;  5J2F A;  5HRK A;  4QZ9 A;  5CP2 A;  3RJH A;  5DB7 A;  9ICG A;  3MDC A;  1WTY A;  5DDY A;  4PHD A;  8ICA A;  5J0U A;  8ICU A;  1PV3 A;  4F5P A;  4M9N A;  3V7L A;  4I2G A;  4GXJ A;  4Z6D A;  4RQ0 A;  4LVS A;  4UBC A;  5CR0 A;  3V7K A;  2BCS A;  1RPL A;  2IHM A;  3L8J A;  1UET A;  5J2A A;  9ICV A;  1R8C A;  4FH3 A;  2BPF A;  5HR9 A;  8ICF A;  4M04 A;  4I2H A;  3UQ2 A;  4JWN A;  2ZH6 A;  2Q66 A;  4I2D A;  1ZQL A;  3GM2 A;  4EBJ A;  9ICM A;  4FHP A;  8ICH A;  3C5F A;  1ZQE A;  4RQ4 A;  8ICS A;  2BCQ A;  1ZQO A;  8ICY A;  8ICN A;  1KTM A;  3C66 A;  2ZH3 A;  1MQ2 A;  3OGU A;  1OW6 A;  4XQ8 A;  3B71 A;  4XRH A;  9ICF A;  4WC0 A;  9ICO A;  1Q78 A;  3MDA A;  5IIN A;  1R8B A;  5HRG A;  4I2E A;  3OVB A;  3AQL A;  2RFF A;  1ZZP A;  4O5E A;  7ICJ A;  4I2I A;  4XUS A;  9ICW A;  4M5D A;  1K04 A;  5J2D A;  7ICK A;  1KEJ A;  9ICP A;  4TUP A;  4XQ7 A;  4QZG A;  2I9G A;  3HIY A;  3JPN A;  4RPX A;  3C2M A;  2NRK A;  5D4B A;  4UB1 A;  5J2E A;  2ZH8 A;  5HC9 A;  4YCX A;  4X4O A;  1ZQK A;  4YD1 A;  3GM3 A;  4AT8 A;  5J2B A;  4S3N A;  3RQG A;  4WBY A;  5TZV A;  5BOM A;  3B0Y A;  5IIJ A;  4KLO A;  5BOL A;  4NKU A;  7ICQ A;  3NYB A;  2L6G A;  4AT8 B;  4DO9 A;  5BPC A;  4UAY A;  4M9L A;  3RH6 A;  1XSP A;  4I2F A;  4O5K A;  5DB6 A;  9ICX A;  3U3F A;  4X4S A;  8ICJ A;  4IQT A;  4KLQ A;  1ZQF A;  4X4P A;  1ZQX A;  1ZQG A;  1MQ3 A;  4WC2 A;  4XA5 A;  1XSL A;  4KLU A;  3OV7 A;  4TUQ A;  3OVS A;  1NOM A;  4DOA A;  4X4V A;  4WBZ A;  1ZQU A;  3PMN A;  3UPQ A;  1R8A A;  4O5C A;  1BPD A;  4QZE A;  2L6F A;  1OW7 A;  1ZQD A;  3LQC B;  2PFO A;  1RZT A;  5HRD A;  3UQ0 A;  4PHP A;  5CB1 A;  7ICI A;  8ICK A;  7ICU A;  5IIO A;  4M47 A;  3TFS A;  4YN4 A;  8ICG A;  1WWP A;  5DB9 A;  3RQF A;  4KLT A;  4WC4 A;  5J0Y A;  5HHI A;  5F2V O;  8ICX A;  2ZHB A;  4QZH A;  4PGY A;  1JN3 A;  2ZH4 A;  4F5N A;  4NXZ A;  4WCW A;  9ICR A;  4XEF A;  2VAN A;  1ZQC A;  5J0Q A;  2M2V A;  2O1P A;  5CA7 A;  3WFQ E;  4O9M A;  2M2W A;  1XSN A;  3GM1 A;  3BRJ A;  4X0B A;  1MIY A;  4F5R A;  5J0P A;  4UAW A;  1KDH A;  2PFP A;  2FMP A;  2P66 A;  2ZH9 A;  4KLF A;  4MF2 A;  4XEK A;  9ICT A;  3RJF A;  1HUZ A;  3RJK A;  4EP7 A;  2DR5 A;  2ISO A;  4RWO A;  5F28 E;  1ZQW A;  7ICV A;  3AJM A;  4UB2 A;  4I2B A;  1QVX A;  3JPS A;  4YMN A;  1ZQQ A;  5EOZ A;  3RJI A;  3L8I A;  1ZQS A;  4KLH A;  4UD4 A;  8ICC A;  4RPZ A;  7ICH A;  5J2H A;  1ZQR A;  4KLL A;  4M0A A;  2Q00 A;  4UB4 A;  3UXP A;  7ICS A;  5J2I A;  4KLM A;  5DBB A;  4AT9 A;  5J2G A;  2DR9 A;  1K40 A;  3JPT A;  4WC6 A;  8ICR A;  5CHG A;  2JPU A;  3JPR A;  1TFY A;  5J0O A;  4X4Q A;  3WFS C;  5HRH A;  2PXI A;  3JYY A;  4LZD A;  4TUR A;  1BPB A;  3ISC A;  5D46 A;  1R89 A;  4UB5 A;  5CJ7 A;  4R63 A;  1VJ7 A;  4X4U A;  4QZI A;  4XEV A;  5HRB A;  2ZH7 A;  4M9H A;  3V7J A;  2KK1 A;  4K4H A;  4UAZ A;  4E7X A;  2DRA A;  4FHV A;  4JWM A;  2PFQ A;  3JPP A;  4PH5 A;  4Z6E A;  1JQR A;  4ATB A;  3JZ0 A;  5HRF A;  9ICK A;  8ICZ A;  1JMS A;  3B0X A;  3HJ1 A;  1ZQJ A;  4QZC A;  8ICP A;  4R32 A;  4I2C A;  4PPX A;  4P4O A;  5DBA A;  3RJE A;  3AU2 A;  4ATB B;  2ZHA A;  3S9O A;  8ICT A;  4MFC A;  5J2J A;  2BE3 A;  1WOL A;  7ICM A;  2M2T A;  2DR7 A;  4I2A A;  3C5G A;  1UFB A;  5DB8 A;  4PHE A;  4MFF A;  8ICV A;  4RT3 A;  4TUS A;  3AQK A;  5J2C A;  1JAJ A;  5DBC A;  1ZQH A;  4QZB A;  4P4P A;  9ICJ A;  5III A;  2BPG A;  8ICI A;  3HWT A;  4R66 A;  2BCR A;  4I28 A;  5IIK A;  9ICU A;  5HHH A;  4RT2 A;  4Z6F A;  4NQF A;  1BPZ A;  4KLI A;  3PNC A;  4M9J A;  5J0T A;  8ICW A;  3C18 A;  1ZQI A;  3HJ4 A;  4FH5 A;  3UPS A;  2L6H A;  4NM1 A;  1NO5 A;  7ICN A;  1UEV A;  4I27 A;  2DVI A;  1TVA A;  4NLN A;  4M2Y A;  3ISD A;  1TFW A;  4X4R A;  2PFN A;  1MIW A;  4K4I A;  4RQ1 A;  9ICS A;  5IIM A;  3LK9 A;  4AT7 A;  1VFG A;  1BPX A;  9ICE A;  9ICC A;  3UXO A;  1OW8 A;  9ICL A;  4UD5 A;  4KLE A;  5HRE A;  1F5A A;  4QZA A;  4AT7 B;  4FHX A;  5D49 A;  3MGH A;  4LZG A;  7ICG A;  1OU5 A;  2FMS A;  4RQ7 A;  3JPO A;  2PBE A;  3MGI A;  3HX0 A;  9ICA A;  3RJG A;  8ICQ A;  4RWN A;  3AUO A;  2HHP A;  1ZJM A;  8ICM A;  4PGX A;  4IG8 A;  1BPE A;  9ICH A;  4EBK A;  9ICI A;  4I29 A;  1HUO A;  8ICE A;  1ZQZ A;  4NLZ A;  3H37 A;  1WOT A;  4YMO A;  4QZ8 A;  2LK4 A;  3WFO A;  3RJJ A;  2ID1 A;  4MF8 A;  4RQ3 A;  4RPY A;  1JOG A;  2O5A A;  7ICO A;  4LT6 A;  4PGQ A;  4IQV A;  4R65 A;  4WC1 A;  3PML A;  2DRB A;  5CWR A;  4WC5 A;  1KNY A;  4AT9 B;  4KLS A;  2ISP A;  4DOB A;  7ICT A;  3RH5 A;  4RQ8 A;  4FO6 A;  4WC3 A;  4X0A A;  4IQU A;  3H3A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...