3JZ0A

Linb complexed with clindamycin and ampcpp
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
266
structure length
266
Chain Sequence
LKQKELIANVKNLTESDERITACMMYGSFTKGEGDQYSDIEFYIFLKHSITSNFDSSNWLFDVAPYLMLYKNEYGTEVVIFDNLIRGEFHFLSEKDMNIIPSFKDSGYIPDTKAMLIYDETGQLENYLSEISGARPNRLTEENANFLLCNFSNLWLMGINVLKRGEYARSLELLSQLQKNTLQLIRMAEKNADNWLNMSKNLEKEISLENYKKFAKTTARLDKVELFEAYKNSLLLVMDLQSHLIEQYNLKVTHDILERLLNYISE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/antibiotic
molecule keywords Lincosamide nucleotidyltransferase
publication title Structure and mechanism of the lincosamide antibiotic adenylyltransferase LinB.
pubmed doi rcsb
source organism Enterococcus faecium
total genus 106
structure length 266
sequence length 266
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 3jz0A02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 3jz0A01
1ZQAA 2ZH1A 9ICMA 4KLTA 2Q00A 9ICBA 4F5PA 2ZH3A 2FMSA 4LVSA 8ICIA 1ZQRA 4XEVA 2ZH5A 2ZH2A 4XEKA 3C8GA 4PGYA 1ZQJA 8ICAA 3C18A 4S3NA 1ZQUA 4NM2A 4RQ1A 4FHPA 7ICIA 4RQ8A 1ZQGA 3C5GA 1R8CA 2JX0A 1ZQXA 5IILA 4UB2A 3GM3A 4K4HA 1JOGA 4Z6FA 3MGIA 1Q78A 5HREA 1ZQCA 3H38A 4RQ2A 4R66A 3C66A 1ZQFA 3L8JA 4UAYA 1ZQPA 4DO9A 4M9HA 4KLQA 5HRHA 7ICHA 8ICEA 8ICXA 3MDCA 4M0AA 4M9JA 3V7KA 4QZAA 7ICQA 4YCXA 5D46A 5D4BA 8ICLA 3RH4A 2ISPA 4M9NA 1MQ3A 4X4TA 5HR9A 5J0YA 4EBKA 3WFQE 5DEDA 2ZH4A 8ICVA 9ICJA 5EOZA 2PBEA 5IIJA 3WFOA 3JPQA 3JPTA 1UEUA 4F5RA 8ICPA 5HRBA 4XA5A 1XSNA 1R89A 5BOLA 3TFSA 5J2EA 5HC9A 4UB5A 4R64A 4RQ6A 8ICHA 5IIMA 5DBAA 2ZH9A 4X0AA 2BE3A 4XQ8A 4M9LA 1OW8A 4ATBB 3OUYA 2DRBA 4M04A 2BCVA 2GWSA 8ICNA 3WFRE 7ICGA 2YWAA 5CHGA 5CB1A 1ZQLA 5HRLA 3U3FA 2PFPA 3AJMA 4X4RA 5DKWA 1XSLA 4RWNA 5J0XA 1MQ2A 3RJGA 1PV3A 2ZHAA 4DOAA 5CWRA 4MFCA 4WC5A 3AQKA 8ICBA 2RFFA 1V4AA 4QZFA 4KLUA 4WBYA 7ICFA 4QZGA 3NYBA 5CP2A 2PFNA 3RQEA 2BCSA 2NRKA 3MDAA 2JPUA 2DRAA 8ICQA 4I2FA 3PNCA 3JPPA 1ZQSA 3LQCB 2L6FA 7ICOA 4QZBA 4LZGA 2LK4A 4LZDA 4UAWA 3OV7A 3BRJA 1KEJA 5J0TA 4E8FA 3LK9A 1ZQKA 1HUZA 4GXKA 3PMNA 1Q79A 3GM2A 1ZQZA 5J2DA 4UBBA 3RQGA 4FH5A 9ICVA 5DDMA 4UBCA 4NQFA 2PFQA 8ICWA 4R32A 3K7DA 5D49A 7ICUA 3RQFA 3U0CA 9ICEA 1JQRA 2DR9A 2M2UA 3AQMA 4YN4A 9ICAA 4P4PA 2ZH8A 4M2YA 9ICPA 4RQ0A 2VANA 9ICUA 4FHYA 3C2KA 3OGUA 3ISCA 4GXIA 2ZHBA 4E80A 4QZ8A 4PH5A 3JPNA 1ZQMA 8ICJA 1VJ7A 3S9OA 4AT7B 5HRKA 4PPXA 4P2HA 4X4PA 4RWOA 5J2CA 1RPLA 5J2IA 3RJFA 3MBYA 3B0YA 1ZZPA 1YLQA 4M9GA 4NLZA 8ICCA 4KLDA 4NKTA 4FHWA 1R8BA 4DOCA 4WC3A 2BPFA 4WC6A 2PXIA 1ZQEA 2DR7A 3HIYA 5J0WA 1ZQTA 3ISBA 4PHPA 4WC7A 1TV9A 4JWMA 1ZQWA 1BPZA 3AQLA 3JPOA 1O3UA 4PHAA 2BPCA 7ICTA 4FHVA 3UXOA 4KLEA 4KLOA 4YMMA 4I2HA 9ICCA 4O5EA 5J0PA 4FH3A 9ICGA 4I2DA 3L8IA 4IQUA 4XQ7A 5CA7A 4WC4A 2FMPA 4X4SA 2BCQA 3C5FA 4M47A 4MF2A 5BPCA 1R8AA 3RH6A 1TVAA 2Q66A 7ICSA 4E7XA 2ISOA 9ICXA 4WBZA 4Z6EA 1BPYA 5TZVA 1OU5A 3ISDA 3UXPA 4QZDA 4PHDA 4WC2A 4AT9B 4I27A 5J0UA 4KLIA 4RQ5A 3UPSA 7ICMA 5J2GA 4UD4A 4IQWA 4NY8A 3HJ4A 9ICHA 8ICRA 4KLHA 4RPZA 4TUQA 2FMQA 5J29A 4O5CA 4KLMA 1BPDA 4I2JA 3H37A 5J0RA 8ICZA 9ICKA 8ICSA 2ZH7A 1K04A 2P66A 1NOMA 4RQ3A 1JMSA 4ATBA 3HJ1A 2O5AA 5IIKA 3UQ0A 1ZQBA 5J2FA 5HRIA 3JPSA 3GDXA 5DBCA 7ICKA 3RJHA 5IIIA 4AT8B 2DR5A 9ICRA 2ZH6A 9ICWA 4QZEA 4Z6DA 4QZIA 4RQ4A 3RJJA 9ICSA 2M2WA 1XSPA 4I28A 4I2BA 1OW6A 1OW7A 4PGXA 4X5VA 1ZQHA 4O5KA 4FHXA 3AUOA 3H3AA 5HRFA 5F28E 1PX5A 4PGQA 3UQ2A 9ICFA 4NLNA 2PFOA 4K4GA 9ICQA 4F5QA 4NXZA 1BPBA 1JN3A 5DB8A 4X4QA 4UAZA 4EBJA 3V72A 4UB3A 1TFYA 1MIWA 3C8GB 4KLSA 2L6GA 4RWQA 3OVBA 5DBBA 1BPXA 1ZQIA 5DB7A 5HRDA 4RWPA 4JWNA 3L9DA 5J2AA 4UB1A 9ICNA 1MIVA 4YD2A 4I29A 3GM1A 4NLKA 9ICOA 4TURA 7ICLA 4I2EA 5CJ7A 2BCRA 4KLJA 4YMNA 2I9GA 3V7LA 3AQNA 3TFRA 4YMOA 4RT3A 4WC1A 1ZQDA 3HWTA 5HHHA 3PMLA 1KDHA 4I2GA 3O10A 1UETA 3UPQA 4IQVA 7ICEA 1WOTA 1UEVA 1QVXA 1MIYA 3RJEA 3K75D 1HUOA 4LT6A 1KTMA 5F2VO 4NKUA 4RQ7A 3V7JA 4XUSA 4TUPA 1WOLA 4R63A 2DR8A 8ICOA 3AU6A 5DDYA 1RZTA 4F5NA 9ICTA 3C2LA 4AT7A 4IG8A 3HW8A 5J2JA 4YD1A 5J0OA 1K40A 4KLLA 3TULA 7ICPA 4F5OA 1JAJA 4QZ9A 3JPRA 2ID1A 4NM1A 5DECA 3C2MA 4GXJA 5HRGA 2M2VA 4P4MA 1ZQOA 2M2TA 3OVAA 4Z6CA 4I2IA 3B71A 4UB4A 5J2BA 4WCWA 4QZCA 8ICKA 3WFPA 3HX0A 4I2AA 1NO5A 4XRHA 3OUYB 7ICRA 2BPGA 1F5AA 1K05A 2L6HA 3H39A 3MGHA 7ICVA 4MFAA 8ICFA 4EP7A 4RPXA 4X0BA 5DB9A 1UFBA 5DB6A 4X4UA 7ICNA 4K4IA 8ICUA 4FO6A 4TUSA 2BCUA 1KNYA 4MFFA 1ZQYA 3RJIA 8ICGA 9ICIA 2HHPA 3OVSA 4X4NA 1ZQNA 1ZQVA 8ICMA 4AT9A 1ZQQA 3MFNA 2DVIA 1BPEA 5HHIA 4X4OA 7ICJA 1WWPA 4WC0A 2IHMA 3AU2A 9ICLA 4KLFA 2HSBA 3B0XA 4R65A 1WTYA 8ICYA 5J0QA 4XEFA 1TFWA 1ZJMA 4X4VA 4O9MA 4P4OA 4KLGA 1ZJNA 1FA0A 4MF8A 4AT8A 3RH5A 4M5DA 4RT2A 5J2HA 3C8GD 5CR0A 2W9MA 2O1PA 4UD5A 5IIOA 3UXNA 5J2KA 3WFSC 4RPYA 4DOBA 3RJKA 2KK1A 1VFGA 4QZHA 3JYYA 4I2CA 3JZ0A 8ICTA 5BOMA 5IINA 4IQTA 4PHEA 5J0SA
chains in the Genus database with same CATH superfamily
4JCHA 2VB6A 2ZH5A 2ZH2A 3C18A 4JLXA 4U9EA 1ZQUA 1YLMA 4RQ1A 1ZQGA 3MX3A 1ZQXA 4MW8A 5IILA 4K4HA 4CBEA 1G4WR 1Q78A 4WJ0A 2GA9D 3QZCA 2MHRA 3F46A 2ZXRA 3DKAA 4BPMA 3ABKC 2J7PD 5A6JA 4KLQA 1QKRA 3ZTMA 4M0AA 2X51A 3V7KA 5D4BA 1RJ9A 2YQYA 2XLWA 3K6BA 4LEVA 4K97A 5DEDA 3SP1A 2ZH4A 1E2XA 2QNLA 2DI3A 3Q7LA 1UEUA 1C03A 3JRMO 4EWCA 3TFSA 2HUJA 3NMIA 4XPYA 4A4AA 5IIMA 3VF0A 1V54C 3LS0A 5DBAA 4KC9A 4X0AA 2BE3A 2HJ3A 5HV9A 8ICNA 1SF8A 3ZTZA 3WFRE 7ICGA 5JUAA 1YJGA 4UDVA 3S29A 5CHGA 1VYIA 2PFPA 3EG9A 1XWJA 4FESA 4CDYA 4IARA 2HKVA 3LEVA 5J0XA 5B3IA 1BR1A 3T4RA 5CWRA 2WZFA 2HN2A 5CFTA 3W2WA 1V4AA 4CSAC 1LI7A 4QZFA 4CJOA 2A69F 2XS1A 1JRAA 1J8YF 3US6A 2A6HF 2KW3C 3GWLA 2W4BA 4O69A 4E17A 4JTAB 3DJUB 2J9UA 4J7YA 2WL8A 4YT5A 4YN0B 1RMVA 2EPMX 3SXKA 1C02A 3PNCA 4MW3A 4WQKA 3JPPA 3TK0A 3LQCB 2L6FA 4H54A 2QE9A 1D1AA 2Y3DA 4UAWA 3OV7A 1VLTA 4O6AA 3FOPA 3PMNA 2OEVA 4FH5A 5B1AC 5DDMA 2OJED 2CW0F 5D49A 4KNVA 3RQFA 2A0UA 2DR9A 4P9FA 9ICAA 3AQMA 3EF2A 5JTGA 4M2YA 2VANA 4BJ1A 3RH3A 3ISCA 1JAFA 2G3KA 1LS1A 2WVNA 4J30B 2QY9A 3HNIA 4B6IA 1MMAA 4P2HA 3I5PA 2ZXWC 2LFFA 5J2CA 5J2IA 4NXTA 3ZIBA 1YLQA 4M9GA 4NLZA 4KLDA 4NKTA 4DOCA 1D1BA 2FFHA 2BPFA 2IXMA 2DR7A 2EPKX 2KC3A 5J0WA 2BL2A 4Q4ZF 5FZTA 2Q7RA 3JPOA 1W2WA 4PHAA 5A6BD 7ICTA 4YMMA 9ICGA 4IQUA 2C04A 4XQ7A 5CA7A 4JKVA 2BCQA 2J9WA 1YA9A 4M47A 4DRIB 5F5FA 3ZSUA 4E7XA 1ZHTA 4JIOA 1OU5A 3PDMP 3A9CA 1OR2A 4PHDA 4W8PA 5B3PA 4K9AA 4U5HA 3UPSA 1E83A 4NY3A 1APCA 2EIKC 3ITFA 5A6AA 2FMQA 4KLMA 3ZG1A 1BPDA 3TOMA 9ICKA 2ZH7A 1ZHWA 2CDQA 3VAYA 1JMSA 3HJ1A 5J2FA 2Q9CA 4EHPA 3JPSA 3GDXA 5IIIA 3HNJA 3TJ5A 1YDIA 3DJNB 2ZH6A 4QZIA 2R7UA 4Z6DA 3LAYA 3EH2A 4BJ6A 4I1MA 2Y39A 4K9BA 2EIJC 1MMNA 2XL8A 2LQGA 4NXWA 1QPUA 4O5KA 2HMQA 2X0CA 4O68A 2QLAA 2A1DD 5DS5A 1YA7O 4U5GA 1LS4A 2P1AA 3Q7GA 1T01A 2Q4FA 3SZRA 1V74B 1Z63A 2OKUA 1QQ3A 3PCVA 2OU6A 2B51A 2I15A 3JTLO 3ZC4A 4YMNA 3TFRA 2Y3GA 4RT3A 4NXXA 4E7ZA 2KGOA 4N6CA 5HHHA 3PMLA 4I2GA 3UPQA 1WOTA 3N24A 1QVXA 4E0IA 1UEVA 3ASNC 3UMHA 4BJ5C 5L0CA 5F2VO 1WOLA 2DR8A 1WATA 1JMWA 2I8BA 1PCXA 4F5NA 3HTKC 3C2LA 3L34A 3B0PA 5J2JA 1Q0GA 3WG7C 3W2VA 4LLCA 3TULA 3I4UA 4PJLA 4QZ9A 1OCOC 4G0HA 3V7OA 4DVYP 5DECA 5K0IA 5HRGA 3E9VA 2PX3A 1QZXA 1EQ1A 5J2BA 2VASA 4QZCA 1TQGA 3DE8A 3FAJA 2R7RA 2OJQA 4DRHB 4LEYA 2XSEA 1T5OA 2YL7A 4I3MA 1UFBA 2YEVA 4K4IA 1SMYF 8ICUA 2R05A 4PK4A 2HMZA 4HE8D 3IPMO 1ZQYA 3RJIA 4JJFA 9ICIA 4MTFA 2HHPA 1FMWA 4OIOF 2HN1A 1ZQNA 1M2VB 4D4XA 3E70C 2AP3A 2DVIA 3CEXA 4ANJA 5HHIA 3FMSA 4E18A 2AWCA 4K99A 3QMKA 5BQHA 4CS8C 4R65A 5COGA 4P4OA 3NRHA 4ZLCA 4MF8A 4M5DA 2NG1A 2M4EA 3C8GD 1Q0FA 4OIRF 4UD5A 4RD9A 3WFSC 4BG0A 3L0IA 2J46A 3RJKA 5D91A 4QZHA 3JYYA 3R7CA 3HKKA 4BJTA 3KL4A 5BOMA 4L6RA 5KYNA 4MQ9F 4DBQA 2V3CC 3MCRA 3CK6A 2Q00A 4F5PA 2FMSA 4LVSA 4O6YA 1ZQRA 1RXQA 2WZGA 4XEVA 2MWQA 1DOVA 4PGYA 8ICAA 4ZLDA 2L81A 7ICIA 3ATPA 1R8CA 3EJNA 1ZW2A 4Z6FA 1TKNA 4OAFA 4JE9A 3H38A 4R66A 3L8JA 1O87A 2P6VA 4E0HA 4DO9A 2R7OA 8ICEA 3IQ6A 1YYJA 8ICXA 4MNDA 1H9GA 3ABMC 4QZAA 4QDLA 1BR2A 3NKDA 3R2PA 1MQ3A 1SYQA 4A2NB 1I4YA 3AG3C 2YL1A 4EBKA 3WFQE 2YHSA 3EH1A 2A68F 5E2QA 5DLJA 8ICPA 3FXHA 4AE4B 2ASRA 1TR2A 1NU7D 2YL0A 5J2EA 3QW0A 4UB5A 4I0UA 1L7CA 2ZH9A 2Z15A 1OW8A 4ATBB 1XZPA 2HFIA 3AG2C 2UUIA 2YWAA 3JCFA 4N7RA 3M4BA 5CB1A 4WQLA 1BZ4A 3G50A 5D62A 2FCLA 1PV3A 1VK5A 4MFCA 5KYXB 1JR8A 1ST6A 2KJGA 1M2VA 4CJGA 1CGNA 2ICWG 4FAPB 3RQEA 2JPUA 8ICQA 4GEHA 3QTHA 3WHNA 4RBNA 2Q9BA 4QZBA 4LZGA 4DBRA 1KEJA 1CGME 4JRZA 2R7VA 4ONSA 1HUZA 4CSAA 1Q79A 1ZQZA 2VCAA 5D63A 3RKOF 1E85A 3MLGA 4LEZA 2L7AA 3U0CA 5L0DA 2ZH8A 4MKPA 1ORSC 3AG4C 4IAOA 9ICUA 4FHYA 2FAPB 4ER9A 8ICJA 3S9OA 4OAIZ 4PPXA 1M2OA 3FOOA 4RWOA 3LLIA 4C7OB 1D0YA 2R02A 3W8HA 4FHWA 4X0RA 2W4MA 4WC6A 4YJWA 4EEBA 1D0XA 3V5XA 4C3BA 4OD4A 3IHUA 4PFPA 1BPZA 3U9JA 1O3UA 1CGOA 2BPCA 4KLEA 3UXOA 4KLOA 1HY5A 5DQTA 2IXOA 9ICCA 2XM4A 4O5EA 1Z6AA 2IXPA 4I2DA 4JLZA 2ETSA 2P61A 3ER9B 1HMDA 4WC4A 2HZ8A 5TJ5E 2FMPA 3T6JA 4CIHA 4MF2A 5BPCA 1R8AA 1TVAA 9ICXA 4WBZA 2YLDA 4K98A 2YKZA 3UXPA 4WC2A 1JPNA 1ORJA 5A6BA 1Q0MA 4AE4A 4RDAA 3HJ4A 2Y3BA 3KMIA 4QI2A 2YVKA 4MVRA 5COFA 4TUQA 3F47A 4O5CA 5J0RA 8ICSA 2P66A 1ZQBA 4ATBA 3Q6NA 2O5AA 3UQ0A 3QVZA 2PP4A 5HRIA 2OQMA 7ICKA 3RJHA 4KI2A 4AT8B 2DR5A 2EPLX 1AEPA 2B56A 2AWYA 9ICWA 4QZEA 3U8VA 1H7IA 4RQ4A 1YVIA 4LERA 4JTCB 5KYXA 2B0JA 4I2BA 4P9TA 5AC5A 1NSGB 1H9TA 4X5VA 5BQIA 3DD7A 3EPVA 1ZQHA 2VH3A 1PX5A 3T9OA 3UQ2A 2GAFD 9ICFA 2KQ9A 5JP7A 2PFOA 5CI8A 4DVZA 1ZU4A 1BPBA 4UAZA 2HS5A 3O6XA 4UB3A 4U5CE 3K1IC 3C8GB 2L6GA 1OCRC 3TJ6A 1BPXA 1GS9A 5DB7A 5HRDA 3U2MA 1OCZC 1T6QA 3ERCC 4NLKA 1QLEC 3L1MA 3JYHA 9ICOA 5CJ7A 2BCRA 1FNTc 2DYRC 2J9VA 3V7LA 3AQNA 1PD1A 3IQ5A 1S7ZA 1G4US 3OWTA 2IYLD 4EUKB 3HWTA 5JVEA 3V5ZA 3RJEA 3K75D 3CSKA 4RQ7A 3V7JA 2J9BA 4YL3A 8ICOA 1LVKA 2D4UA 2L9JA 4OIPF 3JRTA 5T3TA 5JT4A 3HW8A 5J0OA 2NUTB 7ICPA 3VRCA 3FVYA 4C7OA 4F5OA 3JPRA 4NM1A 1RCPA 1HMOA 4GXJA 2M2VA 4P4MA 3FAPB 3OVAA 3B71A 1WN0A 4C3EA 3ABLC 2R7SA 3WFPA 1Q0DA 3LUTB 3GODA 1NO5A 4YWQA 4BJ5A 4XRHA 3H39A 3MGHA 5EGYA 3W8IA 4MFAA 4KNWA 3B9QA 2C03A 3LEOA 5CI9A 5T1DB 1FFTC 1T6UA 1KNYA 2RD9A 2BCUA 4C3DA 2J0WA 3H65A 4CX9A 1S05A 5EK0A 3OVSA 1Y4CA 2EWRA 1ZQVA 1FR0A 1YARO 1ZQQA 4WABA 2NUPB 5GPGB 2PNOA 4MTOA 7ICJA 1WWPA 1VLSA 4YL1A 1RKCA 5F5HA 4MVOA 3GEIA 2KSFA 2XLEA 3B0XA 2H7OA 1TFWA 2H8AA 3KPHA 4X4VA 4O9MA 1TFKB 1MQVA 4KLGA 4YT8A 4AT8A 5KYWB 5J2HA 4U5FE 3RIPA 5CR0A 1SZIA 4AL1A 4FX5A 3DZAA 2LFDA 4DOBA 1VFGA 1LI5A 1HW1A 1IZMA 2V26A 1E86A 3EZHA 4MVQA 4IRUA 4IQTA 1ZQAA 1V55C 4CS8A 1TWAA 4KLTA 2EIMC 2ZH3A 1LKXA 2HSQA 3X2QC 2RSEB 3C8GA 3EHNA 1ZQJA 3AG1C 4KBLA 4S3NA 5DS4A 4CS9C 4FHPA 4RQ8A 2UUHA 4P6IC 4YL0A 1JOGA 5AC4A 3LESA 1M57C 3O39A 3MGIA 1OCCC 5HREA 2YRFA 1BBHA 4MTGA 4K1OA 3JSZA 2VCCA 3Q6MA 3C66A 1ZQFA 2ZXOA 1SR2A 4UAYA 3GANA 1VYKA 1ZQPA 5HRHA 7ICHA 3KYIA 4HX0A 7ICQA 4IJJA 3ER8C 4JTDB 4O7GA 1ZHXA 2ISPA 4X4TA 5J0YA 2BBHA 3NKEA 3I5QA 1TWGA 2J45A 8ICVA 4JZAA 1YAUO 4NXVA 4NCQA 1R4TA 4NC3A 2PBEA 3K1HA 1CPRA 2NUTA 5IIJA 4F4BA 2R7QA 2CNWA 5L0HA 3PHF2 4XA5A 1R89A 3T6GB 2VCBA 1NBBA 5HC9A 5D92A 1OQCA 2H7VC 4OIQF 4LEWA 2OCCC 4J7TA 3AGTA 4PFOA 4XQ8A 4M9LA 2DRBA 4M04A 3C63A 3UMKA 5JLIA 1ZQLA 3U3FA 3X1OA 4H4KC 4AK9A 3AJMA 4MVMA 4X4RA 2XM0A 5DKWA 4RWNA 2G62A 3ZWIA 1MQ2A 4HFKB 1Z23A 3IQCA 2AU5A 5COMA 1A7EA 4WC5A 2RFFA 3QVYA 2PX0A 3MYFA 4WBYA 4W8KA 3PMRA 7ICFA 4QZGA 1D1CA 4O6MA 4KM5A 1FMVA 1NLXA 5CP2A 2NUPA 3O55A 1EKYA 2BCSA 4OAGA 5B3QA 2Y3HA 3S0XA 1LIHA 2ZXPA 1ZQSA 4WGYA 7ICOA 4CDAA 1DOWA 5L0FA 4EKWA 3QW1A 3EGDB 4LZDA 2TMVP 4DXWA 5KYWA 5L3QA 4E8FA 5J0TA 2MYSA 3SEOA 1ZVZA 2OOCA 3GM2A 4D4NA 3K33A 9ICVA 1NG1A 8ICWA 3FHDA 4R32A 3K7DA 7ICUA 3H2UA 5DS6A 2M2UA 4P4PA 2M64A 1A7DA 9ICPA 4RQ0A 4K96A 2R9RB 2Q3TA 3EZIA 4BEMJ 4LACB 2XXAB 5D61A 4GXIA 5E3CA 3JT1A 1ZQMA 5CIVA 1NFOA 1VJ7A 2CNWD 1FTSA 2O9XA 3NYMA 5A69A 5HRKA 4X4PA 4NTAA 3RJFA 3ZDLA 3NKUA 3MBYA 3B0YA 4AL0A 1R8BA 3NG1A 3CAXA 2NSFA 2D5RB 1ZQTA 3ISBA 4PJJA 4PHPA 1E84A 4WC7A 1TV9A 1ZQWA 3IQTA 1ZYRF 3AQLA 4I1OB 1VMAA 4I2HA 5J0PA 1BDJB 3NYJA 4XQ1A 4FH3A 1MMDA 2GFHA 1NZEA 2A6EF 7ICSA 2R7TA 1Y6DA 2ISOA 5E3AA 3ISDA 3SXMA 4HFFB 1NU9C 4XTKA 4QZDA 1U0BB 4AT9B 4IAQA 5J0UA 4O79A 4KLIA 1A41A 3AQBA 3RW0A 8ICRA 3DI5A 3H37A 2QUPA 2XS8A 3GWNA 1NOMA 4RQ3A 4BEJA 3CZ6A 5DBCA 1ZW3A 9ICRA 3TD7A 4EIYA 2EPOA 2YL3A 2M2WA 4Z9IA 4PGXA 4JEBA 4FHXA 3AUOA 2EINC 3FDQA 3DMDA 3WODF 3H3AA 5F28E 4CIPA 3UNGC 3NMJA 2BE5F 4K4GA 2CCYA 4X4QA 1JN3A 4EBJA 4YK5A 3V72A 3NDBB 2Y69C 1TFYA 1FAPB 1O5HA 3DWWA 3TOLA 3OVBA 2XL6A 2P0NA 3EGDA 4RWPA 5CFSA 3L9DA 5J2AA 4I29A 5B3SC 4WH5A 1AVOB 2W45A 1MNDA 4OAHA 4YMOA 4WC1A 3AGUA 1ZQDA 1PD0A 3J06A 1KDHA 3O10A 3S84A 4IQVA 3C8ZA 1MIYA 2P7VA 5CHEA 3K1IA 4NKUA 2BC5A 4N06A 2XLMA 4XUSA 4TUPA 2HV7A 2XXAA 4Q5SF 3HJCA 9ICTA 1TFOB 4PACA 4IG8A 5KYYB 4O6NA 1JAJA 3C2MA 2M2TA 4Z6CA 1MMGA 1VTMP 4WCWA 2BBJA 4XPXA 8ICKA 3HX0A 2R25A 3IEEA 1LM3B 3OUYB 7ICRA 2BPGA 1ZHZA 1F5AA 2L6HA 2WVQA 8ICFA 4GQHA 4LDQA 4EP7A 4JEAA 4RPXA 4X0BA 3KKBA 4X4UA 1HW2A 4FO6A 4TUSA 1AUEA 3DE9A 1NFNA 4X4NA 3LJBA 8ICMA 4AT9A 3MFNA 3LNMB 1U89A 3ECSA 1MNEA 1WTYA 3A11A 3SYNA 1HE9A 8ICYA 5J0QA 4XEFA 4U5EE 4K7BA 3RVZA 4U5BE 2EILC 1ZJNA 4CS7A 2W9YA 3RVYA 3EFOB 3RH5A 5FCLA 4NXUA 3T6BA 2W9MA 2GWWA 5J2KA 4Z9JA 4RPYA 5BQGA 3G4ZA 1GPJA 1WGWA 3GEEA 2E87A 8ICTA 3OEOA 3RFYA 4AX2A 3ZQYA 3B29A 1OKKA 2F22A 5J0SA 4XJEA 2ZH1A 9ICMA 1XZQA 9ICBA 8ICIA 1UG7A 4KB6A 2LD6A 4O67A 3LNRA 4XEKA 5B1BC 1Z7Qc 3N2ZB 4NM2A 3C5GA 5L3VA 2JX0A 4UB2A 3GM3A 1Q0KA 5A6KA 2YZSA 3EHMA 1ZQCA 4RQ2A 4MVUA 4M9HA 2B0HA 2FGYA 2H7BA 3ZVRA 3MDCA 4M9JA 1VOMA 1WASA 4YCXA 5D46A 3VM6A 8ICLA 3RH4A 1GGQA 1J8MF 4M9NA 2ZD9A 3C7JA 4CS9A 3OA1A 2WB7A 3DXJF 5HR9A 1G8XA 4M63A 2LSEA 9ICJA 5KYYA 4U5DE 5EOZA 256BA 3WFOA 3JPQA 3JPTA 4F5RA 1EI7A 5HRBA 4PJNA 1XSNA 5BOLA 1ZHYA 3HNLA 4R64A 4RQ6A 8ICHA 3C62A 5E33A 1A0BA 3OUYA 1ZU5A 2HV6A 2BCVA 2GWSA 1YZAA 3U9MA 1H6GA 3K66A 5HRLA 2R7WA 1Z5ZA 3LLKA 1TWHA 3DAFA 1XSLA 3V5YA 3RJGA 4IB4A 2ZHAA 4DOAA 8ICBA 3AQKA 1HE1A 5IY5C 1OKKD 4KLUA 4DRJB 4PR9A 3M15A 4JC7A 3ASOC 3CQZA 3NYBA 1LE2A 2PFNA 5BUOA 1IW7F 2NRKA 3MDAA 2DRAA 1LPEA 2LP4A 4I2FA 4DJ9A 2PF4E 2OEXA 2YLGA 3M1CB 4N4WA 2LK4A 1T6IA 3BRJA 4LDRA 3EFOA 3SXYA 5CFUA 3LK9A 1ZQKA 4QI0A 3NVOA 4GXKA 3EGXB 5J2DA 4UBBA 3RQGA 4LDKA 4UBCA 1FFHA 2XLDA 4NQFA 2PFQA 1OXKA 2LIGA 5L0JA 1T9KA 1Z3IX 9ICEA 1JQRA 3U3BA 1R5ID 4YN4A 5AGFA 2WZLA 3UGOA 5KYUB 2NPUA 2XRHA 3JSEO 4FWVA 3NWIA 4EBBA 3C2KA 3OGUA 2XLVA 2ZHBA 4E80A 4QZ8A 4PH5A 5JS5A 3JPNA 5JSLA 4AT7B 2KYHA 4IWBA 4G78A 1ORYA 2HJMA 2DGJA 1RPLA 1RKEB 1ZZPA 8ICCA 1KU2A 4K8VA 4WC3A 2PXIA 1ZQEA 3HIYA 4FO1A 2GA0A 4J32B 2A0BA 4XPWA 4N6HA 4JWMA 4JJGA 4FHVA 2IBFA 3AOUA 3B0VC 2AVKA 3L8IA 2GDCA 4X4SA 3C5FA 3DAGA 3RH6A 2Q66A 2ZPAA 3B0UX 4Z6EA 4EEDA 1BPYA 3U2LA 5TZVA 2GAQA 3MYIA 4U9DA 4BJ6C 1VB5A 4Q7CA 3SNHA 2EPNA 2XLHA 4XLNF 4I27A 4RQ5A 7ICMA 5J2GA 4UD4A 4IQWA 4NY8A 1GQAA 9ICHA 2WVOA 4KLHA 4RPZA 1M56C 5J29A 2OG2A 4I2JA 8ICZA 2PFDA 2LCHA 1K04A 2J0XA 5IIKA 3RYLA 3JCUQ 2CYDA 3UGPA 1LE4A 1M6TA 4K0DA 1JPJA 3RJJA 9ICSA 1XSPA 4I28A 3EQLF 4WGZA 2DB4A 1OW6A 2NSGA 1OW7A 2XL4A 4OINF 3WAQA 4JVSA 4MVSA 5HRFA 4PGQA 3HNKA 2J8WA 1YYXA 4NLNA 4JCZA 9ICQA 4EV6A 4F5QA 3U8PA 4NXZA 5DB8A 3KYJA 2IXNA 1B68A 3HLZA 3NYLA 4G7ZF 1MIWA 4KLSA 4RWQA 5DBBA 2Q9AA 3VYWA 1ZQIA 5DQZA 4JWNA 1I4ZA 1N1CA 2DYSC 4UB1A 9ICNA 1MIVA 4YD2A 4YT2A 3GM1A 3EGXA 4I44A 4TURA 7ICLA 4I2EA 2KNHA 4KLJA 2I9GA 3S27A 2R03A 3SXZA 3AQCA 1U6HA 5HSWA 2JD3A 3POVA 4XLPF 1UETA 7ICEA 4YT4A 5KYUA 4IGGA 4CDVA 3S90A 1HUOA 4LT6A 1KTMA 4GYTA 3MBGA 4Z9HA 5L0IA 1RJ9B 4R63A 5EHHA 2YLIA 2VC9A 3AU6A 5DDYA 1RZTA 3BEHA 4AT7A 2IM8A 2IUBA 4YD1A 1K40A 4EGWA 4KLLA 1YZCA 1RKEA 1I5NA 1CPQA 2ID1A 1OR3A 2IHOA 1OXBA 1ZQOA 3M79A 4DOZA 3ZQVA 4I2IA 1C17M 1EA8A 4UB4A 4I2AA 3KH2A 3GORA 3W4YA 1F1MA 4G7HF 1K05A 7ICVA 3EG9B 4MS2A 4E7SA 4MVZA 2J7PA 3NMKA 5DB9A 5DB6A 7ICNA 3OWGA 4PJMA 4MFFA 5T3WA 8ICGA 4WOYA 1TWCA 3PHZA 4G7OF 4NTBA 3DM5A 4ULWA 3G4XA 1L3PA 3UMIA 1BPEA 2IOQA 4X4OA 4NTFA 4ULVA 3AU2A 4WC0A 2IHMA 3RF3A 4OD5A 3S28A 3UR3C 4JW1A 9ICLA 3H2VA 4KLFA 2HSBA 4HEAJ 2R7XA 3M4CA 1ZJMA 1D0ZA 1FA0A 3DM9B 5L0GA 1A7VA 4RT2A 3GEHA 2XLOA 2B4VA 4JURI 2O1PA 1G5ZA 5IIOA 3UXNA 1BR4A 2G3VA 1QSPA 5JRAA 5DVWA 2KK1A 3N0TA 3U5SA 4I2CA 2QTVA 3TQOA 3JZ0A 1GM5A 2CGEA 5IINA 4LLEA 3LS1A 4PHEA 4XWJA
chains in the Genus database with same CATH topology
1ZQAA 2ZH1A 9ICMA 4KLTA 2Q00A 9ICBA 4F5PA 2ZH3A 2FMSA 4LVSA 8ICIA 1ZQRA 4XEVA 2ZH5A 2ZH2A 4XEKA 3C8GA 4PGYA 1ZQJA 8ICAA 3C18A 4S3NA 1ZQUA 4NM2A 4RQ1A 4FHPA 7ICIA 4RQ8A 1ZQGA 3C5GA 1R8CA 2JX0A 1ZQXA 5IILA 4UB2A 3GM3A 4K4HA 1JOGA 4Z6FA 3MGIA 1Q78A 5HREA 1ZQCA 3H38A 4RQ2A 4R66A 3C66A 1ZQFA 3L8JA 4UAYA 1ZQPA 4DO9A 4M9HA 4KLQA 5HRHA 7ICHA 8ICEA 8ICXA 3MDCA 4M0AA 4M9JA 3V7KA 4QZAA 7ICQA 4YCXA 5D46A 5D4BA 8ICLA 3RH4A 2ISPA 4M9NA 1MQ3A 4X4TA 5HR9A 5J0YA 4EBKA 3WFQE 5DEDA 2ZH4A 8ICVA 9ICJA 5EOZA 2PBEA 5IIJA 3WFOA 3JPQA 3JPTA 1UEUA 4F5RA 8ICPA 5HRBA 4XA5A 1XSNA 1R89A 5BOLA 3TFSA 5J2EA 5HC9A 4UB5A 4R64A 4RQ6A 8ICHA 5IIMA 5DBAA 2ZH9A 4X0AA 2BE3A 4XQ8A 4M9LA 1OW8A 4ATBB 3OUYA 2DRBA 4M04A 2BCVA 2GWSA 8ICNA 3WFRE 7ICGA 2YWAA 5CHGA 5CB1A 1ZQLA 5HRLA 3U3FA 2PFPA 3AJMA 4X4RA 5DKWA 1XSLA 4RWNA 5J0XA 1MQ2A 3RJGA 1PV3A 2ZHAA 4DOAA 5CWRA 4MFCA 4WC5A 3AQKA 8ICBA 2RFFA 1V4AA 4QZFA 4KLUA 4WBYA 7ICFA 4QZGA 3NYBA 5CP2A 2PFNA 3RQEA 2BCSA 2NRKA 3MDAA 2JPUA 2DRAA 8ICQA 4I2FA 3PNCA 3JPPA 1ZQSA 3LQCB 2L6FA 7ICOA 4QZBA 4LZGA 2LK4A 4LZDA 4UAWA 3OV7A 3BRJA 1KEJA 5J0TA 4E8FA 3LK9A 1ZQKA 1HUZA 4GXKA 3PMNA 1Q79A 3GM2A 1ZQZA 5J2DA 4UBBA 3RQGA 4FH5A 9ICVA 5DDMA 4UBCA 4NQFA 2PFQA 8ICWA 4R32A 3K7DA 5D49A 7ICUA 3RQFA 3U0CA 9ICEA 1JQRA 2DR9A 2M2UA 3AQMA 4YN4A 9ICAA 4P4PA 2ZH8A 4M2YA 9ICPA 4RQ0A 2VANA 9ICUA 4FHYA 3C2KA 3OGUA 3ISCA 4GXIA 2ZHBA 4E80A 4QZ8A 4PH5A 3JPNA 1ZQMA 8ICJA 1VJ7A 3S9OA 4AT7B 5HRKA 4PPXA 4P2HA 4X4PA 4RWOA 5J2CA 1RPLA 5J2IA 3RJFA 3MBYA 3B0YA 1ZZPA 1YLQA 4M9GA 4NLZA 8ICCA 4KLDA 4NKTA 4FHWA 1R8BA 4DOCA 4WC3A 2BPFA 4WC6A 2PXIA 1ZQEA 2DR7A 3HIYA 5J0WA 1ZQTA 3ISBA 4PHPA 4WC7A 1TV9A 4JWMA 1ZQWA 1BPZA 3AQLA 3JPOA 1O3UA 4PHAA 2BPCA 7ICTA 4FHVA 3UXOA 4KLEA 4KLOA 4YMMA 4I2HA 9ICCA 4O5EA 5J0PA 4FH3A 9ICGA 4I2DA 3L8IA 4IQUA 4XQ7A 5CA7A 4WC4A 2FMPA 4X4SA 2BCQA 3C5FA 4M47A 4MF2A 5BPCA 1R8AA 3RH6A 1TVAA 2Q66A 7ICSA 4E7XA 2ISOA 9ICXA 4WBZA 4Z6EA 1BPYA 5TZVA 1OU5A 3ISDA 3UXPA 4QZDA 4PHDA 4WC2A 4AT9B 4I27A 5J0UA 4KLIA 4RQ5A 3UPSA 7ICMA 5J2GA 4UD4A 4IQWA 4NY8A 3HJ4A 9ICHA 8ICRA 4KLHA 4RPZA 4TUQA 2FMQA 5J29A 4O5CA 4KLMA 1BPDA 4I2JA 3H37A 5J0RA 8ICZA 9ICKA 8ICSA 2ZH7A 1K04A 2P66A 1NOMA 4RQ3A 1JMSA 4ATBA 3HJ1A 2O5AA 5IIKA 3UQ0A 1ZQBA 5J2FA 5HRIA 3JPSA 3GDXA 5DBCA 7ICKA 3RJHA 5IIIA 4AT8B 2DR5A 9ICRA 2ZH6A 9ICWA 4QZEA 4Z6DA 4QZIA 4RQ4A 3RJJA 9ICSA 2M2WA 1XSPA 4I28A 4I2BA 1OW6A 1OW7A 4PGXA 4X5VA 1ZQHA 4O5KA 4FHXA 3AUOA 3H3AA 5HRFA 5F28E 1PX5A 4PGQA 3UQ2A 9ICFA 4NLNA 2PFOA 4K4GA 9ICQA 4F5QA 4NXZA 1BPBA 1JN3A 5DB8A 4X4QA 4UAZA 4EBJA 3V72A 4UB3A 1TFYA 1MIWA 3C8GB 4KLSA 2L6GA 4RWQA 3OVBA 5DBBA 1BPXA 1ZQIA 5DB7A 5HRDA 4RWPA 4JWNA 3L9DA 5J2AA 4UB1A 9ICNA 1MIVA 4YD2A 4I29A 3GM1A 4NLKA 9ICOA 4TURA 7ICLA 4I2EA 5CJ7A 2BCRA 4KLJA 4YMNA 2I9GA 3V7LA 3AQNA 3TFRA 4YMOA 4RT3A 4WC1A 1ZQDA 3HWTA 5HHHA 3PMLA 1KDHA 4I2GA 3O10A 1UETA 3UPQA 4IQVA 7ICEA 1WOTA 1UEVA 1QVXA 1MIYA 3RJEA 3K75D 1HUOA 4LT6A 1KTMA 5F2VO 4NKUA 4RQ7A 3V7JA 4XUSA 4TUPA 1WOLA 4R63A 2DR8A 8ICOA 3AU6A 5DDYA 1RZTA 4F5NA 9ICTA 3C2LA 4AT7A 4IG8A 3HW8A 5J2JA 4YD1A 5J0OA 1K40A 4KLLA 3TULA 7ICPA 4F5OA 1JAJA 4QZ9A 3JPRA 2ID1A 4NM1A 5DECA 3C2MA 4GXJA 5HRGA 2M2VA 4P4MA 1ZQOA 2M2TA 3OVAA 4Z6CA 4I2IA 3B71A 4UB4A 5J2BA 4WCWA 4QZCA 8ICKA 3WFPA 3HX0A 4I2AA 1NO5A 4XRHA 3OUYB 7ICRA 2BPGA 1F5AA 1K05A 2L6HA 3H39A 3MGHA 7ICVA 4MFAA 8ICFA 4EP7A 4RPXA 4X0BA 5DB9A 1UFBA 5DB6A 4X4UA 7ICNA 4K4IA 8ICUA 4FO6A 4TUSA 2BCUA 1KNYA 4MFFA 1ZQYA 3RJIA 8ICGA 9ICIA 2HHPA 3OVSA 4X4NA 1ZQNA 1ZQVA 8ICMA 4AT9A 1ZQQA 3MFNA 2DVIA 1BPEA 5HHIA 4X4OA 7ICJA 1WWPA 4WC0A 2IHMA 3AU2A 9ICLA 4KLFA 2HSBA 3B0XA 4R65A 1WTYA 8ICYA 5J0QA 4XEFA 1TFWA 1ZJMA 4X4VA 4O9MA 4P4OA 4KLGA 1ZJNA 1FA0A 4MF8A 4AT8A 3RH5A 4M5DA 4RT2A 5J2HA 3C8GD 5CR0A 2W9MA 2O1PA 4UD5A 5IIOA 3UXNA 5J2KA 3WFSC 4RPYA 4DOBA 3RJKA 2KK1A 1VFGA 4QZHA 3JYYA 4I2CA 3JZ0A 8ICTA 5BOMA 5IINA 4IQTA 4PHEA 5J0SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZQA A;  2ZH1 A;  9ICM A;  4KLT A;  2Q00 A;  9ICB A;  4F5P A;  2ZH3 A;  2FMS A;  4LVS A;  8ICI A;  1ZQR A;  4XEV A;  2ZH5 A;  2ZH2 A;  4XEK A;  3C8G A;  4PGY A;  1ZQJ A;  8ICA A;  3C18 A;  4S3N A;  1ZQU A;  4NM2 A;  4RQ1 A;  4FHP A;  7ICI A;  4RQ8 A;  1ZQG A;  3C5G A;  1R8C A;  2JX0 A;  1ZQX A;  5IIL A;  4UB2 A;  3GM3 A;  4K4H A;  1JOG A;  4Z6F A;  3MGI A;  1Q78 A;  5HRE A;  1ZQC A;  3H38 A;  4RQ2 A;  4R66 A;  3C66 A;  1ZQF A;  3L8J A;  4UAY A;  1ZQP A;  4DO9 A;  4M9H A;  4KLQ A;  5HRH A;  7ICH A;  8ICE A;  8ICX A;  3MDC A;  4M0A A;  4M9J A;  3V7K A;  4QZA A;  7ICQ A;  4YCX A;  5D46 A;  5D4B A;  8ICL A;  3RH4 A;  2ISP A;  4M9N A;  1MQ3 A;  4X4T A;  5HR9 A;  5J0Y A;  4EBK A;  3WFQ E;  5DED A;  2ZH4 A;  8ICV A;  9ICJ A;  5EOZ A;  2PBE A;  5IIJ A;  3WFO A;  3JPQ A;  3JPT A;  1UEU A;  4F5R A;  8ICP A;  5HRB A;  4XA5 A;  1XSN A;  1R89 A;  5BOL A;  3TFS A;  5J2E A;  5HC9 A;  4UB5 A;  4R64 A;  4RQ6 A;  8ICH A;  5IIM A;  5DBA A;  2ZH9 A;  4X0A A;  2BE3 A;  4XQ8 A;  4M9L A;  1OW8 A;  4ATB B;  3OUY A;  2DRB A;  4M04 A;  2BCV A;  2GWS A;  8ICN A;  3WFR E;  7ICG A;  2YWA A;  5CHG A;  5CB1 A;  1ZQL A;  5HRL A;  3U3F A;  2PFP A;  3AJM A;  4X4R A;  5DKW A;  1XSL A;  4RWN A;  5J0X A;  1MQ2 A;  3RJG A;  1PV3 A;  2ZHA A;  4DOA A;  5CWR A;  4MFC A;  4WC5 A;  3AQK A;  8ICB A;  2RFF A;  1V4A A;  4QZF A;  4KLU A;  4WBY A;  7ICF A;  4QZG A;  3NYB A;  5CP2 A;  2PFN A;  3RQE A;  2BCS A;  2NRK A;  3MDA A;  2JPU A;  2DRA A;  8ICQ A;  4I2F A;  3PNC A;  3JPP A;  1ZQS A;  3LQC B;  2L6F A;  7ICO A;  4QZB A;  4LZG A;  2LK4 A;  4LZD A;  4UAW A;  3OV7 A;  3BRJ A;  1KEJ A;  5J0T A;  4E8F A;  3LK9 A;  1ZQK A;  1HUZ A;  4GXK A;  3PMN A;  1Q79 A;  3GM2 A;  1ZQZ A;  5J2D A;  4UBB A;  3RQG A;  4FH5 A;  9ICV A;  5DDM A;  4UBC A;  4NQF A;  2PFQ A;  8ICW A;  4R32 A;  3K7D A;  5D49 A;  7ICU A;  3RQF A;  3U0C A;  9ICE A;  1JQR A;  2DR9 A;  2M2U A;  3AQM A;  4YN4 A;  9ICA A;  4P4P A;  2ZH8 A;  4M2Y A;  9ICP A;  4RQ0 A;  2VAN A;  9ICU A;  4FHY A;  3C2K A;  3OGU A;  3ISC A;  4GXI A;  2ZHB A;  4E80 A;  4QZ8 A;  4PH5 A;  3JPN A;  1ZQM A;  8ICJ A;  1VJ7 A;  3S9O A;  4AT7 B;  5HRK A;  4PPX A;  4P2H A;  4X4P A;  4RWO A;  5J2C A;  1RPL A;  5J2I A;  3RJF A;  3MBY A;  3B0Y A;  1ZZP A;  1YLQ A;  4M9G A;  4NLZ A;  8ICC A;  4KLD A;  4NKT A;  4FHW A;  1R8B A;  4DOC A;  4WC3 A;  2BPF A;  4WC6 A;  2PXI A;  1ZQE A;  2DR7 A;  3HIY A;  5J0W A;  1ZQT A;  3ISB A;  4PHP A;  4WC7 A;  1TV9 A;  4JWM A;  1ZQW A;  1BPZ A;  3AQL A;  3JPO A;  1O3U A;  4PHA A;  2BPC A;  7ICT A;  4FHV A;  3UXO A;  4KLE A;  4KLO A;  4YMM A;  4I2H A;  9ICC A;  4O5E A;  5J0P A;  4FH3 A;  9ICG A;  4I2D A;  3L8I A;  4IQU A;  4XQ7 A;  5CA7 A;  4WC4 A;  2FMP A;  4X4S A;  2BCQ A;  3C5F A;  4M47 A;  4MF2 A;  5BPC A;  1R8A A;  3RH6 A;  1TVA A;  2Q66 A;  7ICS A;  4E7X A;  2ISO A;  9ICX A;  4WBZ A;  4Z6E A;  1BPY A;  5TZV A;  1OU5 A;  3ISD A;  3UXP A;  4QZD A;  4PHD A;  4WC2 A;  4AT9 B;  4I27 A;  5J0U A;  4KLI A;  4RQ5 A;  3UPS A;  7ICM A;  5J2G A;  4UD4 A;  4IQW A;  4NY8 A;  3HJ4 A;  9ICH A;  8ICR A;  4KLH A;  4RPZ A;  4TUQ A;  2FMQ A;  5J29 A;  4O5C A;  4KLM A;  1BPD A;  4I2J A;  3H37 A;  5J0R A;  8ICZ A;  9ICK A;  8ICS A;  2ZH7 A;  1K04 A;  2P66 A;  1NOM A;  4RQ3 A;  1JMS A;  4ATB A;  3HJ1 A;  2O5A A;  5IIK A;  3UQ0 A;  1ZQB A;  5J2F A;  5HRI A;  3JPS A;  3GDX A;  5DBC A;  7ICK A;  3RJH A;  5III A;  4AT8 B;  2DR5 A;  9ICR A;  2ZH6 A;  9ICW A;  4QZE A;  4Z6D A;  4QZI A;  4RQ4 A;  3RJJ A;  9ICS A;  2M2W A;  1XSP A;  4I28 A;  4I2B A;  1OW6 A;  1OW7 A;  4PGX A;  4X5V A;  1ZQH A;  4O5K A;  4FHX A;  3AUO A;  3H3A A;  5HRF A;  5F28 E;  1PX5 A;  4PGQ A;  3UQ2 A;  9ICF A;  4NLN A;  2PFO A;  4K4G A;  9ICQ A;  4F5Q A;  4NXZ A;  1BPB A;  1JN3 A;  5DB8 A;  4X4Q A;  4UAZ A;  4EBJ A;  3V72 A;  4UB3 A;  1TFY A;  1MIW A;  3C8G B;  4KLS A;  2L6G A;  4RWQ A;  3OVB A;  5DBB A;  1BPX A;  1ZQI A;  5DB7 A;  5HRD A;  4RWP A;  4JWN A;  3L9D A;  5J2A A;  4UB1 A;  9ICN A;  1MIV A;  4YD2 A;  4I29 A;  3GM1 A;  4NLK A;  9ICO A;  4TUR A;  7ICL A;  4I2E A;  5CJ7 A;  2BCR A;  4KLJ A;  4YMN A;  2I9G A;  3V7L A;  3AQN A;  3TFR A;  4YMO A;  4RT3 A;  4WC1 A;  1ZQD A;  3HWT A;  5HHH A;  3PML A;  1KDH A;  4I2G A;  3O10 A;  1UET A;  3UPQ A;  4IQV A;  7ICE A;  1WOT A;  1UEV A;  1QVX A;  1MIY A;  3RJE A;  3K75 D;  1HUO A;  4LT6 A;  1KTM A;  5F2V O;  4NKU A;  4RQ7 A;  3V7J A;  4XUS A;  4TUP A;  1WOL A;  4R63 A;  2DR8 A;  8ICO A;  3AU6 A;  5DDY A;  1RZT A;  4F5N A;  9ICT A;  3C2L A;  4AT7 A;  4IG8 A;  3HW8 A;  5J2J A;  4YD1 A;  5J0O A;  1K40 A;  4KLL A;  3TUL A;  7ICP A;  4F5O A;  1JAJ A;  4QZ9 A;  3JPR A;  2ID1 A;  4NM1 A;  5DEC A;  3C2M A;  4GXJ A;  5HRG A;  2M2V A;  4P4M A;  1ZQO A;  2M2T A;  3OVA A;  4Z6C A;  4I2I A;  3B71 A;  4UB4 A;  5J2B A;  4WCW A;  4QZC A;  8ICK A;  3WFP A;  3HX0 A;  4I2A A;  1NO5 A;  4XRH A;  3OUY B;  7ICR A;  2BPG A;  1F5A A;  1K05 A;  2L6H A;  3H39 A;  3MGH A;  7ICV A;  4MFA A;  8ICF A;  4EP7 A;  4RPX A;  4X0B A;  5DB9 A;  1UFB A;  5DB6 A;  4X4U A;  7ICN A;  4K4I A;  8ICU A;  4FO6 A;  4TUS A;  2BCU A;  1KNY A;  4MFF A;  1ZQY A;  3RJI A;  8ICG A;  9ICI A;  2HHP A;  3OVS A;  4X4N A;  1ZQN A;  1ZQV A;  8ICM A;  4AT9 A;  1ZQQ A;  3MFN A;  2DVI A;  1BPE A;  5HHI A;  4X4O A;  7ICJ A;  1WWP A;  4WC0 A;  2IHM A;  3AU2 A;  9ICL A;  4KLF A;  2HSB A;  3B0X A;  4R65 A;  1WTY A;  8ICY A;  5J0Q A;  4XEF A;  1TFW A;  1ZJM A;  4X4V A;  4O9M A;  4P4O A;  4KLG A;  1ZJN A;  1FA0 A;  4MF8 A;  4AT8 A;  3RH5 A;  4M5D A;  4RT2 A;  5J2H A;  3C8G D;  5CR0 A;  2W9M A;  2O1P A;  4UD5 A;  5IIO A;  3UXN A;  5J2K A;  3WFS C;  4RPY A;  4DOB A;  3RJK A;  2KK1 A;  1VFG A;  4QZH A;  3JYY A;  4I2C A;  3JZ0 A;  8ICT A;  5BOM A;  5IIN A;  4IQT A;  4PHE A;  5J0S A; 
#chains in the Genus database with same CATH topology
 4JCH A;  2VB6 A;  2ZH5 A;  2ZH2 A;  3C18 A;  4JLX A;  4U9E A;  1ZQU A;  1YLM A;  4RQ1 A;  1ZQG A;  3MX3 A;  1ZQX A;  4MW8 A;  5IIL A;  4K4H A;  4CBE A;  1G4W R;  1Q78 A;  4WJ0 A;  2GA9 D;  3QZC A;  2MHR A;  3F46 A;  2ZXR A;  3DKA A;  4BPM A;  3ABK C;  2J7P D;  5A6J A;  4KLQ A;  1QKR A;  3ZTM A;  4M0A A;  2X51 A;  3V7K A;  5D4B A;  1RJ9 A;  2YQY A;  2XLW A;  3K6B A;  4LEV A;  4K97 A;  5DED A;  3SP1 A;  2ZH4 A;  1E2X A;  2QNL A;  2DI3 A;  3Q7L A;  1UEU A;  1C03 A;  3JRM O;  4EWC A;  3TFS A;  2HUJ A;  3NMI A;  4XPY A;  4A4A A;  5IIM A;  3VF0 A;  1V54 C;  3LS0 A;  5DBA A;  4KC9 A;  4X0A A;  2BE3 A;  2HJ3 A;  5HV9 A;  8ICN A;  1SF8 A;  3ZTZ A;  3WFR E;  7ICG A;  5JUA A;  1YJG A;  4UDV A;  3S29 A;  5CHG A;  1VYI A;  2PFP A;  3EG9 A;  1XWJ A;  4FES A;  4CDY A;  4IAR A;  2HKV A;  3LEV A;  5J0X A;  5B3I A;  1BR1 A;  3T4R A;  5CWR A;  2WZF A;  2HN2 A;  5CFT A;  3W2W A;  1V4A A;  4CSA C;  1LI7 A;  4QZF A;  4CJO A;  2A69 F;  2XS1 A;  1JRA A;  1J8Y F;  3US6 A;  2A6H F;  2KW3 C;  3GWL A;  2W4B A;  4O69 A;  4E17 A;  4JTA B;  3DJU B;  2J9U A;  4J7Y A;  2WL8 A;  4YT5 A;  4YN0 B;  1RMV A;  2EPM X;  3SXK A;  1C02 A;  3PNC A;  4MW3 A;  4WQK A;  3JPP A;  3TK0 A;  3LQC B;  2L6F A;  4H54 A;  2QE9 A;  1D1A A;  2Y3D A;  4UAW A;  3OV7 A;  1VLT A;  4O6A A;  3FOP A;  3PMN A;  2OEV A;  4FH5 A;  5B1A C;  5DDM A;  2OJE D;  2CW0 F;  5D49 A;  4KNV A;  3RQF A;  2A0U A;  2DR9 A;  4P9F A;  9ICA A;  3AQM A;  3EF2 A;  5JTG A;  4M2Y A;  2VAN A;  4BJ1 A;  3RH3 A;  3ISC A;  1JAF A;  2G3K A;  1LS1 A;  2WVN A;  4J30 B;  2QY9 A;  3HNI A;  4B6I A;  1MMA A;  4P2H A;  3I5P A;  2ZXW C;  2LFF A;  5J2C A;  5J2I A;  4NXT A;  3ZIB A;  1YLQ A;  4M9G A;  4NLZ A;  4KLD A;  4NKT A;  4DOC A;  1D1B A;  2FFH A;  2BPF A;  2IXM A;  2DR7 A;  2EPK X;  2KC3 A;  5J0W A;  2BL2 A;  4Q4Z F;  5FZT A;  2Q7R A;  3JPO A;  1W2W A;  4PHA A;  5A6B D;  7ICT A;  4YMM A;  9ICG A;  4IQU A;  2C04 A;  4XQ7 A;  5CA7 A;  4JKV A;  2BCQ A;  2J9W A;  1YA9 A;  4M47 A;  4DRI B;  5F5F A;  3ZSU A;  4E7X A;  1ZHT A;  4JIO A;  1OU5 A;  3PDM P;  3A9C A;  1OR2 A;  4PHD A;  4W8P A;  5B3P A;  4K9A A;  4U5H A;  3UPS A;  1E83 A;  4NY3 A;  1APC A;  2EIK C;  3ITF A;  5A6A A;  2FMQ A;  4KLM A;  3ZG1 A;  1BPD A;  3TOM A;  9ICK A;  2ZH7 A;  1ZHW A;  2CDQ A;  3VAY A;  1JMS A;  3HJ1 A;  5J2F A;  2Q9C A;  4EHP A;  3JPS A;  3GDX A;  5III A;  3HNJ A;  3TJ5 A;  1YDI A;  3DJN B;  2ZH6 A;  4QZI A;  2R7U A;  4Z6D A;  3LAY A;  3EH2 A;  4BJ6 A;  4I1M A;  2Y39 A;  4K9B A;  2EIJ C;  1MMN A;  2XL8 A;  2LQG A;  4NXW A;  1QPU A;  4O5K A;  2HMQ A;  2X0C A;  4O68 A;  2QLA A;  2A1D D;  5DS5 A;  1YA7 O;  4U5G A;  1LS4 A;  2P1A A;  3Q7G A;  1T01 A;  2Q4F A;  3SZR A;  1V74 B;  1Z63 A;  2OKU A;  1QQ3 A;  3PCV A;  2OU6 A;  2B51 A;  2I15 A;  3JTL O;  3ZC4 A;  4YMN A;  3TFR A;  2Y3G A;  4RT3 A;  4NXX A;  4E7Z A;  2KGO A;  4N6C A;  5HHH A;  3PML A;  4I2G A;  3UPQ A;  1WOT A;  3N24 A;  1QVX A;  4E0I A;  1UEV A;  3ASN C;  3UMH A;  4BJ5 C;  5L0C A;  5F2V O;  1WOL A;  2DR8 A;  1WAT A;  1JMW A;  2I8B A;  1PCX A;  4F5N A;  3HTK C;  3C2L A;  3L34 A;  3B0P A;  5J2J A;  1Q0G A;  3WG7 C;  3W2V A;  4LLC A;  3TUL A;  3I4U A;  4PJL A;  4QZ9 A;  1OCO C;  4G0H A;  3V7O A;  4DVY P;  5DEC A;  5K0I A;  5HRG A;  3E9V A;  2PX3 A;  1QZX A;  1EQ1 A;  5J2B A;  2VAS A;  4QZC A;  1TQG A;  3DE8 A;  3FAJ A;  2R7R A;  2OJQ A;  4DRH B;  4LEY A;  2XSE A;  1T5O A;  2YL7 A;  4I3M A;  1UFB A;  2YEV A;  4K4I A;  1SMY F;  8ICU A;  2R05 A;  4PK4 A;  2HMZ A;  4HE8 D;  3IPM O;  1ZQY A;  3RJI A;  4JJF A;  9ICI A;  4MTF A;  2HHP A;  1FMW A;  4OIO F;  2HN1 A;  1ZQN A;  1M2V B;  4D4X A;  3E70 C;  2AP3 A;  2DVI A;  3CEX A;  4ANJ A;  5HHI A;  3FMS A;  4E18 A;  2AWC A;  4K99 A;  3QMK A;  5BQH A;  4CS8 C;  4R65 A;  5COG A;  4P4O A;  3NRH A;  4ZLC A;  4MF8 A;  4M5D A;  2NG1 A;  2M4E A;  3C8G D;  1Q0F A;  4OIR F;  4UD5 A;  4RD9 A;  3WFS C;  4BG0 A;  3L0I A;  2J46 A;  3RJK A;  5D91 A;  4QZH A;  3JYY A;  3R7C A;  3HKK A;  4BJT A;  3KL4 A;  5BOM A;  4L6R A;  5KYN A;  4MQ9 F;  4DBQ A;  2V3C C;  3MCR A;  3CK6 A;  2Q00 A;  4F5P A;  2FMS A;  4LVS A;  4O6Y A;  1ZQR A;  1RXQ A;  2WZG A;  4XEV A;  2MWQ A;  1DOV A;  4PGY A;  8ICA A;  4ZLD A;  2L81 A;  7ICI A;  3ATP A;  1R8C A;  3EJN A;  1ZW2 A;  4Z6F A;  1TKN A;  4OAF A;  4JE9 A;  3H38 A;  4R66 A;  3L8J A;  1O87 A;  2P6V A;  4E0H A;  4DO9 A;  2R7O A;  8ICE A;  3IQ6 A;  1YYJ A;  8ICX A;  4MND A;  1H9G A;  3ABM C;  4QZA A;  4QDL A;  1BR2 A;  3NKD A;  3R2P A;  1MQ3 A;  1SYQ A;  4A2N B;  1I4Y A;  3AG3 C;  2YL1 A;  4EBK A;  3WFQ E;  2YHS A;  3EH1 A;  2A68 F;  5E2Q A;  5DLJ A;  8ICP A;  3FXH A;  4AE4 B;  2ASR A;  1TR2 A;  1NU7 D;  2YL0 A;  5J2E A;  3QW0 A;  4UB5 A;  4I0U A;  1L7C A;  2ZH9 A;  2Z15 A;  1OW8 A;  4ATB B;  1XZP A;  2HFI A;  3AG2 C;  2UUI A;  2YWA A;  3JCF A;  4N7R A;  3M4B A;  5CB1 A;  4WQL A;  1BZ4 A;  3G50 A;  5D62 A;  2FCL A;  1PV3 A;  1VK5 A;  4MFC A;  5KYX B;  1JR8 A;  1ST6 A;  2KJG A;  1M2V A;  4CJG A;  1CGN A;  2ICW G;  4FAP B;  3RQE A;  2JPU A;  8ICQ A;  4GEH A;  3QTH A;  3WHN A;  4RBN A;  2Q9B A;  4QZB A;  4LZG A;  4DBR A;  1KEJ A;  1CGM E;  4JRZ A;  2R7V A;  4ONS A;  1HUZ A;  4CSA A;  1Q79 A;  1ZQZ A;  2VCA A;  5D63 A;  3RKO F;  1E85 A;  3MLG A;  4LEZ A;  2L7A A;  3U0C A;  5L0D A;  2ZH8 A;  4MKP A;  1ORS C;  3AG4 C;  4IAO A;  9ICU A;  4FHY A;  2FAP B;  4ER9 A;  8ICJ A;  3S9O A;  4OAI Z;  4PPX A;  1M2O A;  3FOO A;  4RWO A;  3LLI A;  4C7O B;  1D0Y A;  2R02 A;  3W8H A;  4FHW A;  4X0R A;  2W4M A;  4WC6 A;  4YJW A;  4EEB A;  1D0X A;  3V5X A;  4C3B A;  4OD4 A;  3IHU A;  4PFP A;  1BPZ A;  3U9J A;  1O3U A;  1CGO A;  2BPC A;  4KLE A;  3UXO A;  4KLO A;  1HY5 A;  5DQT A;  2IXO A;  9ICC A;  2XM4 A;  4O5E A;  1Z6A A;  2IXP A;  4I2D A;  4JLZ A;  2ETS A;  2P61 A;  3ER9 B;  1HMD A;  4WC4 A;  2HZ8 A;  5TJ5 E;  2FMP A;  3T6J A;  4CIH A;  4MF2 A;  5BPC A;  1R8A A;  1TVA A;  9ICX A;  4WBZ A;  2YLD A;  4K98 A;  2YKZ A;  3UXP A;  4WC2 A;  1JPN A;  1ORJ A;  5A6B A;  1Q0M A;  4AE4 A;  4RDA A;  3HJ4 A;  2Y3B A;  3KMI A;  4QI2 A;  2YVK A;  4MVR A;  5COF A;  4TUQ A;  3F47 A;  4O5C A;  5J0R A;  8ICS A;  2P66 A;  1ZQB A;  4ATB A;  3Q6N A;  2O5A A;  3UQ0 A;  3QVZ A;  2PP4 A;  5HRI A;  2OQM A;  7ICK A;  3RJH A;  4KI2 A;  4AT8 B;  2DR5 A;  2EPL X;  1AEP A;  2B56 A;  2AWY A;  9ICW A;  4QZE A;  3U8V A;  1H7I A;  4RQ4 A;  1YVI A;  4LER A;  4JTC B;  5KYX A;  2B0J A;  4I2B A;  4P9T A;  5AC5 A;  1NSG B;  1H9T A;  4X5V A;  5BQI A;  3DD7 A;  3EPV A;  1ZQH A;  2VH3 A;  1PX5 A;  3T9O A;  3UQ2 A;  2GAF D;  9ICF A;  2KQ9 A;  5JP7 A;  2PFO A;  5CI8 A;  4DVZ A;  1ZU4 A;  1BPB A;  4UAZ A;  2HS5 A;  3O6X A;  4UB3 A;  4U5C E;  3K1I C;  3C8G B;  2L6G A;  1OCR C;  3TJ6 A;  1BPX A;  1GS9 A;  5DB7 A;  5HRD A;  3U2M A;  1OCZ C;  1T6Q A;  3ERC C;  4NLK A;  1QLE C;  3L1M A;  3JYH A;  9ICO A;  5CJ7 A;  2BCR A;  1FNT c;  2DYR C;  2J9V A;  3V7L A;  3AQN A;  1PD1 A;  3IQ5 A;  1S7Z A;  1G4U S;  3OWT A;  2IYL D;  4EUK B;  3HWT A;  5JVE A;  3V5Z A;  3RJE A;  3K75 D;  3CSK A;  4RQ7 A;  3V7J A;  2J9B A;  4YL3 A;  8ICO A;  1LVK A;  2D4U A;  2L9J A;  4OIP F;  3JRT A;  5T3T A;  5JT4 A;  3HW8 A;  5J0O A;  2NUT B;  7ICP A;  3VRC A;  3FVY A;  4C7O A;  4F5O A;  3JPR A;  4NM1 A;  1RCP A;  1HMO A;  4GXJ A;  2M2V A;  4P4M A;  3FAP B;  3OVA A;  3B71 A;  1WN0 A;  4C3E A;  3ABL C;  2R7S A;  3WFP A;  1Q0D A;  3LUT B;  3GOD A;  1NO5 A;  4YWQ A;  4BJ5 A;  4XRH A;  3H39 A;  3MGH A;  5EGY A;  3W8I A;  4MFA A;  4KNW A;  3B9Q A;  2C03 A;  3LEO A;  5CI9 A;  5T1D B;  1FFT C;  1T6U A;  1KNY A;  2RD9 A;  2BCU A;  4C3D A;  2J0W A;  3H65 A;  4CX9 A;  1S05 A;  5EK0 A;  3OVS A;  1Y4C A;  2EWR A;  1ZQV A;  1FR0 A;  1YAR O;  1ZQQ A;  4WAB A;  2NUP B;  5GPG B;  2PNO A;  4MTO A;  7ICJ A;  1WWP A;  1VLS A;  4YL1 A;  1RKC A;  5F5H A;  4MVO A;  3GEI A;  2KSF A;  2XLE A;  3B0X A;  2H7O A;  1TFW A;  2H8A A;  3KPH A;  4X4V A;  4O9M A;  1TFK B;  1MQV A;  4KLG A;  4YT8 A;  4AT8 A;  5KYW B;  5J2H A;  4U5F E;  3RIP A;  5CR0 A;  1SZI A;  4AL1 A;  4FX5 A;  3DZA A;  2LFD A;  4DOB A;  1VFG A;  1LI5 A;  1HW1 A;  1IZM A;  2V26 A;  1E86 A;  3EZH A;  4MVQ A;  4IRU A;  4IQT A;  1ZQA A;  1V55 C;  4CS8 A;  1TWA A;  4KLT A;  2EIM C;  2ZH3 A;  1LKX A;  2HSQ A;  3X2Q C;  2RSE B;  3C8G A;  3EHN A;  1ZQJ A;  3AG1 C;  4KBL A;  4S3N A;  5DS4 A;  4CS9 C;  4FHP A;  4RQ8 A;  2UUH A;  4P6I C;  4YL0 A;  1JOG A;  5AC4 A;  3LES A;  1M57 C;  3O39 A;  3MGI A;  1OCC C;  5HRE A;  2YRF A;  1BBH A;  4MTG A;  4K1O A;  3JSZ A;  2VCC A;  3Q6M A;  3C66 A;  1ZQF A;  2ZXO A;  1SR2 A;  4UAY A;  3GAN A;  1VYK A;  1ZQP A;  5HRH A;  7ICH A;  3KYI A;  4HX0 A;  7ICQ A;  4IJJ A;  3ER8 C;  4JTD B;  4O7G A;  1ZHX A;  2ISP A;  4X4T A;  5J0Y A;  2BBH A;  3NKE A;  3I5Q A;  1TWG A;  2J45 A;  8ICV A;  4JZA A;  1YAU O;  4NXV A;  4NCQ A;  1R4T A;  4NC3 A;  2PBE A;  3K1H A;  1CPR A;  2NUT A;  5IIJ A;  4F4B A;  2R7Q A;  2CNW A;  5L0H A;  3PHF 2;  4XA5 A;  1R89 A;  3T6G B;  2VCB A;  1NBB A;  5HC9 A;  5D92 A;  1OQC A;  2H7V C;  4OIQ F;  4LEW A;  2OCC C;  4J7T A;  3AGT A;  4PFO A;  4XQ8 A;  4M9L A;  2DRB A;  4M04 A;  3C63 A;  3UMK A;  5JLI A;  1ZQL A;  3U3F A;  3X1O A;  4H4K C;  4AK9 A;  3AJM A;  4MVM A;  4X4R A;  2XM0 A;  5DKW A;  4RWN A;  2G62 A;  3ZWI A;  1MQ2 A;  4HFK B;  1Z23 A;  3IQC A;  2AU5 A;  5COM A;  1A7E A;  4WC5 A;  2RFF A;  3QVY A;  2PX0 A;  3MYF A;  4WBY A;  4W8K A;  3PMR A;  7ICF A;  4QZG A;  1D1C A;  4O6M A;  4KM5 A;  1FMV A;  1NLX A;  5CP2 A;  2NUP A;  3O55 A;  1EKY A;  2BCS A;  4OAG A;  5B3Q A;  2Y3H A;  3S0X A;  1LIH A;  2ZXP A;  1ZQS A;  4WGY A;  7ICO A;  4CDA A;  1DOW A;  5L0F A;  4EKW A;  3QW1 A;  3EGD B;  4LZD A;  2TMV P;  4DXW A;  5KYW A;  5L3Q A;  4E8F A;  5J0T A;  2MYS A;  3SEO A;  1ZVZ A;  2OOC A;  3GM2 A;  4D4N A;  3K33 A;  9ICV A;  1NG1 A;  8ICW A;  3FHD A;  4R32 A;  3K7D A;  7ICU A;  3H2U A;  5DS6 A;  2M2U A;  4P4P A;  2M64 A;  1A7D A;  9ICP A;  4RQ0 A;  4K96 A;  2R9R B;  2Q3T A;  3EZI A;  4BEM J;  4LAC B;  2XXA B;  5D61 A;  4GXI A;  5E3C A;  3JT1 A;  1ZQM A;  5CIV A;  1NFO A;  1VJ7 A;  2CNW D;  1FTS A;  2O9X A;  3NYM A;  5A69 A;  5HRK A;  4X4P A;  4NTA A;  3RJF A;  3ZDL A;  3NKU A;  3MBY A;  3B0Y A;  4AL0 A;  1R8B A;  3NG1 A;  3CAX A;  2NSF A;  2D5R B;  1ZQT A;  3ISB A;  4PJJ A;  4PHP A;  1E84 A;  4WC7 A;  1TV9 A;  1ZQW A;  3IQT A;  1ZYR F;  3AQL A;  4I1O B;  1VMA A;  4I2H A;  5J0P A;  1BDJ B;  3NYJ A;  4XQ1 A;  4FH3 A;  1MMD A;  2GFH A;  1NZE A;  2A6E F;  7ICS A;  2R7T A;  1Y6D A;  2ISO A;  5E3A A;  3ISD A;  3SXM A;  4HFF B;  1NU9 C;  4XTK A;  4QZD A;  1U0B B;  4AT9 B;  4IAQ A;  5J0U A;  4O79 A;  4KLI A;  1A41 A;  3AQB A;  3RW0 A;  8ICR A;  3DI5 A;  3H37 A;  2QUP A;  2XS8 A;  3GWN A;  1NOM A;  4RQ3 A;  4BEJ A;  3CZ6 A;  5DBC A;  1ZW3 A;  9ICR A;  3TD7 A;  4EIY A;  2EPO A;  2YL3 A;  2M2W A;  4Z9I A;  4PGX A;  4JEB A;  4FHX A;  3AUO A;  2EIN C;  3FDQ A;  3DMD A;  3WOD F;  3H3A A;  5F28 E;  4CIP A;  3UNG C;  3NMJ A;  2BE5 F;  4K4G A;  2CCY A;  4X4Q A;  1JN3 A;  4EBJ A;  4YK5 A;  3V72 A;  3NDB B;  2Y69 C;  1TFY A;  1FAP B;  1O5H A;  3DWW A;  3TOL A;  3OVB A;  2XL6 A;  2P0N A;  3EGD A;  4RWP A;  5CFS A;  3L9D A;  5J2A A;  4I29 A;  5B3S C;  4WH5 A;  1AVO B;  2W45 A;  1MND A;  4OAH A;  4YMO A;  4WC1 A;  3AGU A;  1ZQD A;  1PD0 A;  3J06 A;  1KDH A;  3O10 A;  3S84 A;  4IQV A;  3C8Z A;  1MIY A;  2P7V A;  5CHE A;  3K1I A;  4NKU A;  2BC5 A;  4N06 A;  2XLM A;  4XUS A;  4TUP A;  2HV7 A;  2XXA A;  4Q5S F;  3HJC A;  9ICT A;  1TFO B;  4PAC A;  4IG8 A;  5KYY B;  4O6N A;  1JAJ A;  3C2M A;  2M2T A;  4Z6C A;  1MMG A;  1VTM P;  4WCW A;  2BBJ A;  4XPX A;  8ICK A;  3HX0 A;  2R25 A;  3IEE A;  1LM3 B;  3OUY B;  7ICR A;  2BPG A;  1ZHZ A;  1F5A A;  2L6H A;  2WVQ A;  8ICF A;  4GQH A;  4LDQ A;  4EP7 A;  4JEA A;  4RPX A;  4X0B A;  3KKB A;  4X4U A;  1HW2 A;  4FO6 A;  4TUS A;  1AUE A;  3DE9 A;  1NFN A;  4X4N A;  3LJB A;  8ICM A;  4AT9 A;  3MFN A;  3LNM B;  1U89 A;  3ECS A;  1MNE A;  1WTY A;  3A11 A;  3SYN A;  1HE9 A;  8ICY A;  5J0Q A;  4XEF A;  4U5E E;  4K7B A;  3RVZ A;  4U5B E;  2EIL C;  1ZJN A;  4CS7 A;  2W9Y A;  3RVY A;  3EFO B;  3RH5 A;  5FCL A;  4NXU A;  3T6B A;  2W9M A;  2GWW A;  5J2K A;  4Z9J A;  4RPY A;  5BQG A;  3G4Z A;  1GPJ A;  1WGW A;  3GEE A;  2E87 A;  8ICT A;  3OEO A;  3RFY A;  4AX2 A;  3ZQY A;  3B29 A;  1OKK A;  2F22 A;  5J0S A;  4XJE A;  2ZH1 A;  9ICM A;  1XZQ A;  9ICB A;  8ICI A;  1UG7 A;  4KB6 A;  2LD6 A;  4O67 A;  3LNR A;  4XEK A;  5B1B C;  1Z7Q c;  3N2Z B;  4NM2 A;  3C5G A;  5L3V A;  2JX0 A;  4UB2 A;  3GM3 A;  1Q0K A;  5A6K A;  2YZS A;  3EHM A;  1ZQC A;  4RQ2 A;  4MVU A;  4M9H A;  2B0H A;  2FGY A;  2H7B A;  3ZVR A;  3MDC A;  4M9J A;  1VOM A;  1WAS A;  4YCX A;  5D46 A;  3VM6 A;  8ICL A;  3RH4 A;  1GGQ A;  1J8M F;  4M9N A;  2ZD9 A;  3C7J A;  4CS9 A;  3OA1 A;  2WB7 A;  3DXJ F;  5HR9 A;  1G8X A;  4M63 A;  2LSE A;  9ICJ A;  5KYY A;  4U5D E;  5EOZ A;  256B A;  3WFO A;  3JPQ A;  3JPT A;  4F5R A;  1EI7 A;  5HRB A;  4PJN A;  1XSN A;  5BOL A;  1ZHY A;  3HNL A;  4R64 A;  4RQ6 A;  8ICH A;  3C62 A;  5E33 A;  1A0B A;  3OUY A;  1ZU5 A;  2HV6 A;  2BCV A;  2GWS A;  1YZA A;  3U9M A;  1H6G A;  3K66 A;  5HRL A;  2R7W A;  1Z5Z A;  3LLK A;  1TWH A;  3DAF A;  1XSL A;  3V5Y A;  3RJG A;  4IB4 A;  2ZHA A;  4DOA A;  8ICB A;  3AQK A;  1HE1 A;  5IY5 C;  1OKK D;  4KLU A;  4DRJ B;  4PR9 A;  3M15 A;  4JC7 A;  3ASO C;  3CQZ A;  3NYB A;  1LE2 A;  2PFN A;  5BUO A;  1IW7 F;  2NRK A;  3MDA A;  2DRA A;  1LPE A;  2LP4 A;  4I2F A;  4DJ9 A;  2PF4 E;  2OEX A;  2YLG A;  3M1C B;  4N4W A;  2LK4 A;  1T6I A;  3BRJ A;  4LDR A;  3EFO A;  3SXY A;  5CFU A;  3LK9 A;  1ZQK A;  4QI0 A;  3NVO A;  4GXK A;  3EGX B;  5J2D A;  4UBB A;  3RQG A;  4LDK A;  4UBC A;  1FFH A;  2XLD A;  4NQF A;  2PFQ A;  1OXK A;  2LIG A;  5L0J A;  1T9K A;  1Z3I X;  9ICE A;  1JQR A;  3U3B A;  1R5I D;  4YN4 A;  5AGF A;  2WZL A;  3UGO A;  5KYU B;  2NPU A;  2XRH A;  3JSE O;  4FWV A;  3NWI A;  4EBB A;  3C2K A;  3OGU A;  2XLV A;  2ZHB A;  4E80 A;  4QZ8 A;  4PH5 A;  5JS5 A;  3JPN A;  5JSL A;  4AT7 B;  2KYH A;  4IWB A;  4G78 A;  1ORY A;  2HJM A;  2DGJ A;  1RPL A;  1RKE B;  1ZZP A;  8ICC A;  1KU2 A;  4K8V A;  4WC3 A;  2PXI A;  1ZQE A;  3HIY A;  4FO1 A;  2GA0 A;  4J32 B;  2A0B A;  4XPW A;  4N6H A;  4JWM A;  4JJG A;  4FHV A;  2IBF A;  3AOU A;  3B0V C;  2AVK A;  3L8I A;  2GDC A;  4X4S A;  3C5F A;  3DAG A;  3RH6 A;  2Q66 A;  2ZPA A;  3B0U X;  4Z6E A;  4EED A;  1BPY A;  3U2L A;  5TZV A;  2GAQ A;  3MYI A;  4U9D A;  4BJ6 C;  1VB5 A;  4Q7C A;  3SNH A;  2EPN A;  2XLH A;  4XLN F;  4I27 A;  4RQ5 A;  7ICM A;  5J2G A;  4UD4 A;  4IQW A;  4NY8 A;  1GQA A;  9ICH A;  2WVO A;  4KLH A;  4RPZ A;  1M56 C;  5J29 A;  2OG2 A;  4I2J A;  8ICZ A;  2PFD A;  2LCH A;  1K04 A;  2J0X A;  5IIK A;  3RYL A;  3JCU Q;  2CYD A;  3UGP A;  1LE4 A;  1M6T A;  4K0D A;  1JPJ A;  3RJJ A;  9ICS A;  1XSP A;  4I28 A;  3EQL F;  4WGZ A;  2DB4 A;  1OW6 A;  2NSG A;  1OW7 A;  2XL4 A;  4OIN F;  3WAQ A;  4JVS A;  4MVS A;  5HRF A;  4PGQ A;  3HNK A;  2J8W A;  1YYX A;  4NLN A;  4JCZ A;  9ICQ A;  4EV6 A;  4F5Q A;  3U8P A;  4NXZ A;  5DB8 A;  3KYJ A;  2IXN A;  1B68 A;  3HLZ A;  3NYL A;  4G7Z F;  1MIW A;  4KLS A;  4RWQ A;  5DBB A;  2Q9A A;  3VYW A;  1ZQI A;  5DQZ A;  4JWN A;  1I4Z A;  1N1C A;  2DYS C;  4UB1 A;  9ICN A;  1MIV A;  4YD2 A;  4YT2 A;  3GM1 A;  3EGX A;  4I44 A;  4TUR A;  7ICL A;  4I2E A;  2KNH A;  4KLJ A;  2I9G A;  3S27 A;  2R03 A;  3SXZ A;  3AQC A;  1U6H A;  5HSW A;  2JD3 A;  3POV A;  4XLP F;  1UET A;  7ICE A;  4YT4 A;  5KYU A;  4IGG A;  4CDV A;  3S90 A;  1HUO A;  4LT6 A;  1KTM A;  4GYT A;  3MBG A;  4Z9H A;  5L0I A;  1RJ9 B;  4R63 A;  5EHH A;  2YLI A;  2VC9 A;  3AU6 A;  5DDY A;  1RZT A;  3BEH A;  4AT7 A;  2IM8 A;  2IUB A;  4YD1 A;  1K40 A;  4EGW A;  4KLL A;  1YZC A;  1RKE A;  1I5N A;  1CPQ A;  2ID1 A;  1OR3 A;  2IHO A;  1OXB A;  1ZQO A;  3M79 A;  4DOZ A;  3ZQV A;  4I2I A;  1C17 M;  1EA8 A;  4UB4 A;  4I2A A;  3KH2 A;  3GOR A;  3W4Y A;  1F1M A;  4G7H F;  1K05 A;  7ICV A;  3EG9 B;  4MS2 A;  4E7S A;  4MVZ A;  2J7P A;  3NMK A;  5DB9 A;  5DB6 A;  7ICN A;  3OWG A;  4PJM A;  4MFF A;  5T3W A;  8ICG A;  4WOY A;  1TWC A;  3PHZ A;  4G7O F;  4NTB A;  3DM5 A;  4ULW A;  3G4X A;  1L3P A;  3UMI A;  1BPE A;  2IOQ A;  4X4O A;  4NTF A;  4ULV A;  3AU2 A;  4WC0 A;  2IHM A;  3RF3 A;  4OD5 A;  3S28 A;  3UR3 C;  4JW1 A;  9ICL A;  3H2V A;  4KLF A;  2HSB A;  4HEA J;  2R7X A;  3M4C A;  1ZJM A;  1D0Z A;  1FA0 A;  3DM9 B;  5L0G A;  1A7V A;  4RT2 A;  3GEH A;  2XLO A;  2B4V A;  4JUR I;  2O1P A;  1G5Z A;  5IIO A;  3UXN A;  1BR4 A;  2G3V A;  1QSP A;  5JRA A;  5DVW A;  2KK1 A;  3N0T A;  3U5S A;  4I2C A;  2QTV A;  3TQO A;  3JZ0 A;  1GM5 A;  2CGE A;  5IIN A;  4LLE A;  3LS1 A;  4PHE A;  4XWJ A; 
#chains in the Genus database with same CATH homology
 1ZQA A;  2ZH1 A;  9ICM A;  4KLT A;  2Q00 A;  9ICB A;  4F5P A;  2ZH3 A;  2FMS A;  4LVS A;  8ICI A;  1ZQR A;  4XEV A;  2ZH5 A;  2ZH2 A;  4XEK A;  3C8G A;  4PGY A;  1ZQJ A;  8ICA A;  3C18 A;  4S3N A;  1ZQU A;  4NM2 A;  4RQ1 A;  4FHP A;  7ICI A;  4RQ8 A;  1ZQG A;  3C5G A;  1R8C A;  2JX0 A;  1ZQX A;  5IIL A;  4UB2 A;  3GM3 A;  4K4H A;  1JOG A;  4Z6F A;  3MGI A;  1Q78 A;  5HRE A;  1ZQC A;  3H38 A;  4RQ2 A;  4R66 A;  3C66 A;  1ZQF A;  3L8J A;  4UAY A;  1ZQP A;  4DO9 A;  4M9H A;  4KLQ A;  5HRH A;  7ICH A;  8ICE A;  8ICX A;  3MDC A;  4M0A A;  4M9J A;  3V7K A;  4QZA A;  7ICQ A;  4YCX A;  5D46 A;  5D4B A;  8ICL A;  3RH4 A;  2ISP A;  4M9N A;  1MQ3 A;  4X4T A;  5HR9 A;  5J0Y A;  4EBK A;  3WFQ E;  5DED A;  2ZH4 A;  8ICV A;  9ICJ A;  5EOZ A;  2PBE A;  5IIJ A;  3WFO A;  3JPQ A;  3JPT A;  1UEU A;  4F5R A;  8ICP A;  5HRB A;  4XA5 A;  1XSN A;  1R89 A;  5BOL A;  3TFS A;  5J2E A;  5HC9 A;  4UB5 A;  4R64 A;  4RQ6 A;  8ICH A;  5IIM A;  5DBA A;  2ZH9 A;  4X0A A;  2BE3 A;  4XQ8 A;  4M9L A;  1OW8 A;  4ATB B;  3OUY A;  2DRB A;  4M04 A;  2BCV A;  2GWS A;  8ICN A;  3WFR E;  7ICG A;  2YWA A;  5CHG A;  5CB1 A;  1ZQL A;  5HRL A;  3U3F A;  2PFP A;  3AJM A;  4X4R A;  5DKW A;  1XSL A;  4RWN A;  5J0X A;  1MQ2 A;  3RJG A;  1PV3 A;  2ZHA A;  4DOA A;  5CWR A;  4MFC A;  4WC5 A;  3AQK A;  8ICB A;  2RFF A;  1V4A A;  4QZF A;  4KLU A;  4WBY A;  7ICF A;  4QZG A;  3NYB A;  5CP2 A;  2PFN A;  3RQE A;  2BCS A;  2NRK A;  3MDA A;  2JPU A;  2DRA A;  8ICQ A;  4I2F A;  3PNC A;  3JPP A;  1ZQS A;  3LQC B;  2L6F A;  7ICO A;  4QZB A;  4LZG A;  2LK4 A;  4LZD A;  4UAW A;  3OV7 A;  3BRJ A;  1KEJ A;  5J0T A;  4E8F A;  3LK9 A;  1ZQK A;  1HUZ A;  4GXK A;  3PMN A;  1Q79 A;  3GM2 A;  1ZQZ A;  5J2D A;  4UBB A;  3RQG A;  4FH5 A;  9ICV A;  5DDM A;  4UBC A;  4NQF A;  2PFQ A;  8ICW A;  4R32 A;  3K7D A;  5D49 A;  7ICU A;  3RQF A;  3U0C A;  9ICE A;  1JQR A;  2DR9 A;  2M2U A;  3AQM A;  4YN4 A;  9ICA A;  4P4P A;  2ZH8 A;  4M2Y A;  9ICP A;  4RQ0 A;  2VAN A;  9ICU A;  4FHY A;  3C2K A;  3OGU A;  3ISC A;  4GXI A;  2ZHB A;  4E80 A;  4QZ8 A;  4PH5 A;  3JPN A;  1ZQM A;  8ICJ A;  1VJ7 A;  3S9O A;  4AT7 B;  5HRK A;  4PPX A;  4P2H A;  4X4P A;  4RWO A;  5J2C A;  1RPL A;  5J2I A;  3RJF A;  3MBY A;  3B0Y A;  1ZZP A;  1YLQ A;  4M9G A;  4NLZ A;  8ICC A;  4KLD A;  4NKT A;  4FHW A;  1R8B A;  4DOC A;  4WC3 A;  2BPF A;  4WC6 A;  2PXI A;  1ZQE A;  2DR7 A;  3HIY A;  5J0W A;  1ZQT A;  3ISB A;  4PHP A;  4WC7 A;  1TV9 A;  4JWM A;  1ZQW A;  1BPZ A;  3AQL A;  3JPO A;  1O3U A;  4PHA A;  2BPC A;  7ICT A;  4FHV A;  3UXO A;  4KLE A;  4KLO A;  4YMM A;  4I2H A;  9ICC A;  4O5E A;  5J0P A;  4FH3 A;  9ICG A;  4I2D A;  3L8I A;  4IQU A;  4XQ7 A;  5CA7 A;  4WC4 A;  2FMP A;  4X4S A;  2BCQ A;  3C5F A;  4M47 A;  4MF2 A;  5BPC A;  1R8A A;  3RH6 A;  1TVA A;  2Q66 A;  7ICS A;  4E7X A;  2ISO A;  9ICX A;  4WBZ A;  4Z6E A;  1BPY A;  5TZV A;  1OU5 A;  3ISD A;  3UXP A;  4QZD A;  4PHD A;  4WC2 A;  4AT9 B;  4I27 A;  5J0U A;  4KLI A;  4RQ5 A;  3UPS A;  7ICM A;  5J2G A;  4UD4 A;  4IQW A;  4NY8 A;  3HJ4 A;  9ICH A;  8ICR A;  4KLH A;  4RPZ A;  4TUQ A;  2FMQ A;  5J29 A;  4O5C A;  4KLM A;  1BPD A;  4I2J A;  3H37 A;  5J0R A;  8ICZ A;  9ICK A;  8ICS A;  2ZH7 A;  1K04 A;  2P66 A;  1NOM A;  4RQ3 A;  1JMS A;  4ATB A;  3HJ1 A;  2O5A A;  5IIK A;  3UQ0 A;  1ZQB A;  5J2F A;  5HRI A;  3JPS A;  3GDX A;  5DBC A;  7ICK A;  3RJH A;  5III A;  4AT8 B;  2DR5 A;  9ICR A;  2ZH6 A;  9ICW A;  4QZE A;  4Z6D A;  4QZI A;  4RQ4 A;  3RJJ A;  9ICS A;  2M2W A;  1XSP A;  4I28 A;  4I2B A;  1OW6 A;  1OW7 A;  4PGX A;  4X5V A;  1ZQH A;  4O5K A;  4FHX A;  3AUO A;  3H3A A;  5HRF A;  5F28 E;  1PX5 A;  4PGQ A;  3UQ2 A;  9ICF A;  4NLN A;  2PFO A;  4K4G A;  9ICQ A;  4F5Q A;  4NXZ A;  1BPB A;  1JN3 A;  5DB8 A;  4X4Q A;  4UAZ A;  4EBJ A;  3V72 A;  4UB3 A;  1TFY A;  1MIW A;  3C8G B;  4KLS A;  2L6G A;  4RWQ A;  3OVB A;  5DBB A;  1BPX A;  1ZQI A;  5DB7 A;  5HRD A;  4RWP A;  4JWN A;  3L9D A;  5J2A A;  4UB1 A;  9ICN A;  1MIV A;  4YD2 A;  4I29 A;  3GM1 A;  4NLK A;  9ICO A;  4TUR A;  7ICL A;  4I2E A;  5CJ7 A;  2BCR A;  4KLJ A;  4YMN A;  2I9G A;  3V7L A;  3AQN A;  3TFR A;  4YMO A;  4RT3 A;  4WC1 A;  1ZQD A;  3HWT A;  5HHH A;  3PML A;  1KDH A;  4I2G A;  3O10 A;  1UET A;  3UPQ A;  4IQV A;  7ICE A;  1WOT A;  1UEV A;  1QVX A;  1MIY A;  3RJE A;  3K75 D;  1HUO A;  4LT6 A;  1KTM A;  5F2V O;  4NKU A;  4RQ7 A;  3V7J A;  4XUS A;  4TUP A;  1WOL A;  4R63 A;  2DR8 A;  8ICO A;  3AU6 A;  5DDY A;  1RZT A;  4F5N A;  9ICT A;  3C2L A;  4AT7 A;  4IG8 A;  3HW8 A;  5J2J A;  4YD1 A;  5J0O A;  1K40 A;  4KLL A;  3TUL A;  7ICP A;  4F5O A;  1JAJ A;  4QZ9 A;  3JPR A;  2ID1 A;  4NM1 A;  5DEC A;  3C2M A;  4GXJ A;  5HRG A;  2M2V A;  4P4M A;  1ZQO A;  2M2T A;  3OVA A;  4Z6C A;  4I2I A;  3B71 A;  4UB4 A;  5J2B A;  4WCW A;  4QZC A;  8ICK A;  3WFP A;  3HX0 A;  4I2A A;  1NO5 A;  4XRH A;  3OUY B;  7ICR A;  2BPG A;  1F5A A;  1K05 A;  2L6H A;  3H39 A;  3MGH A;  7ICV A;  4MFA A;  8ICF A;  4EP7 A;  4RPX A;  4X0B A;  5DB9 A;  1UFB A;  5DB6 A;  4X4U A;  7ICN A;  4K4I A;  8ICU A;  4FO6 A;  4TUS A;  2BCU A;  1KNY A;  4MFF A;  1ZQY A;  3RJI A;  8ICG A;  9ICI A;  2HHP A;  3OVS A;  4X4N A;  1ZQN A;  1ZQV A;  8ICM A;  4AT9 A;  1ZQQ A;  3MFN A;  2DVI A;  1BPE A;  5HHI A;  4X4O A;  7ICJ A;  1WWP A;  4WC0 A;  2IHM A;  3AU2 A;  9ICL A;  4KLF A;  2HSB A;  3B0X A;  4R65 A;  1WTY A;  8ICY A;  5J0Q A;  4XEF A;  1TFW A;  1ZJM A;  4X4V A;  4O9M A;  4P4O A;  4KLG A;  1ZJN A;  1FA0 A;  4MF8 A;  4AT8 A;  3RH5 A;  4M5D A;  4RT2 A;  5J2H A;  3C8G D;  5CR0 A;  2W9M A;  2O1P A;  4UD5 A;  5IIO A;  3UXN A;  5J2K A;  3WFS C;  4RPY A;  4DOB A;  3RJK A;  2KK1 A;  1VFG A;  4QZH A;  3JYY A;  4I2C A;  3JZ0 A;  8ICT A;  5BOM A;  5IIN A;  4IQT A;  4PHE A;  5J0S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...