3JZ0A

Linb complexed with clindamycin and ampcpp
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
266
structure length
266
Chain Sequence
LKQKELIANVKNLTESDERITACMMYGSFTKGEGDQYSDIEFYIFLKHSITSNFDSSNWLFDVAPYLMLYKNEYGTEVVIFDNLIRGEFHFLSEKDMNIIPSFKDSGYIPDTKAMLIYDETGQLENYLSEISGARPNRLTEENANFLLCNFSNLWLMGINVLKRGEYARSLELLSQLQKNTLQLIRMAEKNADNWLNMSKNLEKEISLENYKKFAKTTARLDKVELFEAYKNSLLLVMDLQSHLIEQYNLKVTHDILERLLNYISE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and mechanism of the lincosamide antibiotic adenylyltransferase LinB.
pubmed doi rcsb
source organism Enterococcus faecium
molecule tags Transferase/antibiotic
molecule keywords Lincosamide nucleotidyltransferase
total genus 106
structure length 266
sequence length 266
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 3jz0A02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 3jz0A01
3C2LA 3H38A 3MFNA 4EBJA 2RFFA 5CJ7A 4RPZA 4UB5A 3JPQA 3V7JA 4QZCA 4QZEA 3MDCA 1OW7A 4I2AA 7ICLA 2HHPA 3MBYA 4F5RA 4KLOA 3L9DA 1K40A 3OVBA 8ICQA 4XUSA 4WBYA 4M2YA 1R8BA 3HX0A 8ICSA 5IIOA 1MIYA 5DB7A 3PNCA 5IIKA 3RH6A 3V7KA 1UEVA 4KLJA 9ICVA 3B71A 4F5PA 5J0WA 4WC0A 5DBBA 7ICSA 4XA5A 2ZHAA 4UB4A 4NLNA 4XEVA 2DR8A 7ICTA 4RT3A 3GM1A 3HIYA 3RJKA 2HSBA 3AQKA 5HRIA 9ICCA 3HJ4A 1ZQKA 3H39A 3HJ1A 7ICRA 4RWQA 4IQTA 1ZZPA 2JX0A 1F5AA 2DRBA 2NRKA 4QZGA 4XQ8A 2BE3A 4NM1A 3AU6A 4LZGA 5DBCA 3GM3A 4PHDA 9ICGA 1V4AA 4NXZA 2IHMA 4QZBA 2L6HA 2KK1A 1ZQNA 4R64A 4X4QA 4PGYA 4X0AA 4QZ8A 4Z6EA 1ZQCA 4E8FA 4RQ4A 4YD2A 2Q00A 4X4TA 5J2FA 1QVXA 2ZH3A 3C5FA 4DOCA 4I2FA 4NKUA 4NLZA 2ZHBA 3ISBA 2BPFA 5F28E 4KLLA 5TZVA 3GDXA 4MFCA 9ICKA 4O5EA 4I2JA 2PXIA 1JAJA 5HRKA 5HRLA 1HUZA 4LZDA 9ICMA 1R89A 3OVAA 3V72A 4P2HA 7ICKA 3TULA 4UB3A 8ICEA 4O9MA 3LQCB 2W9MA 2ZH4A 2BPCA 4AT7B 1PV3A 2M2WA 2ISOA 3RJGA 3HW8A 5CHGA 4MF8A 7ICEA 4RQ3A 2ZH2A 2M2VA 4I2GA 4FHXA 9ICQA 4RQ5A 5CB1A 8ICAA 4AT9A 4WCWA 1ZQEA 4I2EA 8ICTA 2M2UA 4X5VA 1ZQQA 4IQWA 5IINA 2L6GA 3AQMA 1ZQAA 4AT8A 4YN4A 4X4VA 4KLGA 5CA7A 1TVAA 8ICIA 1BPEA 1MIVA 3C8GD 1NOMA 4PHPA 4M47A 7ICGA 3TFSA 1BPZA 2BPGA 3MGIA 3HWTA 4IG8A 8ICWA 3RJEA 5J0XA 2ZH7A 3RH5A 2ISPA 9ICFA 4FHWA 8ICVA 8ICKA 1MQ3A 4GXIA 3RJHA 4EBKA 4TUPA 1VJ7A 9ICLA 4P4PA 1ZQGA 1KDHA 4WC2A 5IIJA 8ICLA 4WC1A 4I28A 3K7DA 5J2EA 3OGUA 4JWMA 3C2KA 4NM2A 3C8GB 1ZQVA 5J2GA 1ZQSA 4RWOA 3C5GA 4WC5A 2ZH9A 2ZH5A 9ICUA 4KLMA 3JYYA 3C8GA 1KEJA 1TFWA 4DOBA 4QZAA 5HHHA 8ICGA 9ICHA 3RQGA 5DB9A 2L6FA 5HRHA 1ZQHA 3UXPA 1JOGA 3AJMA 1ZJMA 4MFAA 1BPXA 4X4RA 1OW6A 4K4HA 4IQUA 5BOLA 1OU5A 5CR0A 1UEUA 4NLKA 1K05A 1ZQPA 2PFPA 3RJFA 1ZQZA 2ZH1A 1PX5A 4UB1A 4Z6FA 4RQ8A 3UPSA 8ICPA 3UXOA 4RQ0A 4PGQA 3L8JA 4RWPA 1BPYA 1ZQIA 4P4OA 4R65A 3B0YA 4Z6CA 5HHIA 4M04A 4MF2A 4AT7A 4KLHA 4UD4A 3MGHA 1Q79A 9ICXA 4F5OA 7ICUA 5J0SA 2Q66A 7ICMA 4WC6A 8ICUA 1TV9A 5J0QA 4I2BA 9ICEA 5EOZA 4M5DA 4FO6A 8ICXA 3BRJA 4PPXA 1ZQTA 5J0UA 3U0CA 1ZQJA 1ZQFA 3RH4A 4QZFA 5HRBA 1ZQYA 2BCQA 1XSLA 5D49A 3OVSA 5J2JA 2PFQA 5J0OA 4R66A 7ICOA 4NY8A 4UAYA 4YMOA 2BCRA 1O3UA 5IILA 2FMPA 4RQ2A 9ICWA 4FHYA 3O10A 5DB8A 4RPXA 4QZHA 4PGXA 3AQLA 4YD1A 5IIIA 4PH5A 5HR9A 3JPTA 1MQ2A 4MFFA 4WC4A 1NO5A 7ICQA 8ICMA 4KLDA 4X4UA 4ATBB 3K75D 8ICCA 8ICYA 5F2VO 1BPDA 1XSNA 4PHAA 4YMNA 9ICOA 3H37A 4M9JA 7ICVA 4GXJA 4M0AA 4WC7A 4XRHA 4F5QA 9ICSA 3LK9A 5DKWA 4KLFA 4Z6DA 4LVSA 1WWPA 4KLIA 1UFBA 2I9GA 7ICFA 3C2MA 1ZQMA 4UB2A 2ID1A 4XEFA 4RQ1A 4GXKA 4NQFA 4UBCA 1JN3A 5J2CA 4UAWA 5J0TA 4X4SA 2BCSA 4KLTA 4X0BA 3PMNA 3AU2A 5HRGA 2DR5A 4FH5A 1Q78A 4QZIA 1ZQWA 2BCVA 8ICBA 7ICHA 4QZDA 4NKTA 4AT8B 3OUYA 8ICZA 4IQVA 2YWAA 1ZQDA 5J29A 9ICBA 1RPLA 5DDYA 5J2AA 1TFYA 2PFNA 4YCXA 1XSPA 7ICNA 3RQEA 2ZH6A 4DO9A 4I2DA 4I2CA 9ICJA 4I2IA 4FHPA 5DEDA 5J2KA 9ICTA 1HUOA 1ZQLA 8ICOA 5DBAA 3NYBA 5BPCA 4KLUA 9ICRA 2PBEA 5HC9A 1ZQXA 2FMQA 4YMMA 3V7LA 7ICIA 4X4NA 4WBZA 3UQ2A 9ICIA 3UPQA 5J2DA 4K4IA 3OUYB 9ICNA 2DVIA 4R32A 5J2IA 3RJJA 3C18A 3WFQE 3WFOA 1KNYA 4UBBA 5D4BA 4WC3A 3JPNA 4I2HA 3MDAA 9ICAA 1WTYA 1ZJNA 4I27A 4XEKA 2GWSA 4KLQA 4TUQA 2LK4A 5J2HA 1KTMA 5J0RA 4X4PA 8ICJA 3WFRE 1YLQA 4DOAA 3H3AA 4TUSA 3OV7A 1ZQUA 2DR9A 4R63A 4LT6A 4F5NA 3ISDA 1JQRA 4O5KA 5HREA 8ICFA 5J2BA 3JPOA 3RQFA 3C66A 1ZQRA 3PMLA 5DECA 3JPRA 1UETA 3UQ0A 2ZH8A 4ATBA 4AT9B 7ICPA 4RPYA 3UXNA 3U3FA 2M2TA 4M9HA 3JZ0A 4RQ7A 5CWRA 2O1PA 2VANA 5CP2A 1WOLA 5J0YA 4UAZA 1R8CA 4RQ6A 4E80A 1K04A 4X4OA 5IIMA 2DR7A 4M9LA 4FHVA 3AQNA 9ICPA 1WOTA 8ICHA 8ICRA 4KLEA 1ZQOA 3WFSC 3L8IA 4FH3A 1ZQBA 1RZTA 3WFPA 1BPBA 4UD5A 7ICJA 2PFOA 1OW8A 4JWNA 3JPPA 2DRAA 2P66A 4XQ7A 5BOMA 1MIWA 4I29A 1FA0A 2BCUA 4M9GA 3S9OA 4E7XA 4S3NA 4RWNA 4EP7A 2JPUA 4O5CA 5HRDA 1VFGA 4QZ9A 4PHEA 5DDMA 4RT2A 3GM2A 5J0PA 3AUOA 1R8AA 5D46A 1JMSA 4KLSA 4TURA 4M9NA 5HRFA 3B0XA 3ISCA 2FMSA 4K4GA 5DB6A 2O5AA 4P4MA 3RJIA 3TFRA 3JPSA 8ICNA
chains in the Genus database with same CATH superfamily
4MTFA 2P1AA 2J8WA 3LJBA 5CJ7A 3V7JA 3U9JA 4QZEA 1KU2A 1OW7A 2G3KA 7ICLA 3FHDA 4FAPB 1T01A 1O5HA 4ULWA 2FFHA 2XLVA 1R8BA 3HX0A 8ICSA 4PFOA 1MIYA 3SXZA 3RH6A 3LUTB 1UEVA 4WC0A 2ZXRA 4XA5A 4DOZA 4Q7CA 7ICTA 4LEVA 4RT3A 5F5HA 3MBGA 2EWRA 1ZYRF 2UUIA 2PF4E 3V5YA 2NSGA 3HJ1A 2LIGA 1DOWA 5CI9A 3J06A 5CFUA 3DJUB 2FGYA 1D0ZA 3S84A 3GM3A 4NCQA 4PHDA 3TK0A 5GPGB 4QZBA 4G7HF 2NG1A 2BL2A 4P9FA 3AG1C 4JURI 2IOQA 4YD2A 2Q00A 1Z6AA 1BR4A 3CQZA 1QVXA 2VCBA 1VMAA 4DOCA 4DRHB 2YHSA 2B0JA 2ZHBA 2CDQA 2QLAA 3GDXA 4CDYA 5HRLA 1HUZA 4LZDA 3K33A 4EWCA 1ZHXA 8ICEA 3KL4A 3SNHA 1PV3A 3UGOA 2J9BA 1Q0KA 5CHGA 2RD9A 2Q9CA 2M2VA 1ORSC 1HW1A 2C03A 4GEHA 3LAYA 4AT9A 1H9TA 2HN2A 5JVEA 1ZQQA 4IQWA 5IINA 2L6GA 5JRAA 4AT8A 4PFPA 4LEZA 4YN4A 3K1IA 4O7GA 1VOMA 5CA7A 2J9WA 4JEBA 3GORA 5JTGA 3C8GD 3NKEA 1NOMA 7ICGA 2Y69C 4IG8A 8ICWA 3RJEA 5J0XA 3UMHA 2QUPA 2Y39A 2R7UA 4CIHA 5KYXA 3C7JA 3HNLA 8ICKA 1MQ3A 1PD0A 3EHMA 1Q0GA 1MNEA 1KDHA 4WC1A 4JWMA 3C2KA 1WASA 3C8GB 2OCCC 1VLTA 1ZQSA 4GYTA 3C8GA 2MYSA 3DI5A 8ICGA 5DB9A 5HRHA 2PX3A 2Y3GA 3WAQA 2IHOA 4C7OA 1E2XA 4IQUA 1YDIA 1TFKB 1ORYA 4EBBA 1OU5A 1U6HA 4NLKA 1TKNA 4Z6FA 3L1MA 2AVKA 4KBLA 5EHHA 3S90A 1GPJA 4YT8A 1T5OA 1ZQIA 4N06A 3B0YA 5HHIA 2D5RB 5L0JA 4MF2A 4AT7A 3HNJA 3MGHA 1M2OA 5COMA 1C02A 3NMKA 4MNDA 2VASA 3QZCA 2XXAB 5J0QA 4I3MA 3DXJF 8ICXA 4PPXA 1M2VB 1ZQJA 1F1MA 2HUJA 2BCQA 5F5FA 2A69F 2YQYA 4G78A 3K1IC 3JSEO 4NY8A 3T6JA 1NLXA 2HJMA 5DB8A 4PGXA 4QZHA 3AQLA 1E83A 4PH5A 2LFFA 5HR9A 4K9AA 4K98A 3DAFA 2GWWA 4J32B 2A6HF 3I5PA 4X4UA 2P7VA 1BPDA 4PHAA 4OIOF 3HJCA 2OG2A 4M9JA 4GXJA 1LIHA 4WC7A 3U9MA 4G7ZF 3M4BA 2DGJA 5A6BD 5DKWA 3A11A 4KLIA 2CNWD 4C3EA 7ICFA 1E85A 3UR3C 2TMVP 4UBCA 1JMWA 4PJNA 2XSEA 4LEWA 1CGNA 2BCSA 1BDJB 4X0BA 2L81A 3W4YA 2WVOA 4JIOA 2DR5A 1RJ9B 1NFOA 4QZIA 2PP4A 1OCOC 8ICZA 4AT8B 3IQCA 5J29A 2QNLA 1CPQA 5B1BC 4OAHA 4I2CA 4DO9A 3CZ6A 3B9QA 4I2IA 3FVYA 1JRAA 5DEDA 3VYWA 4OIQF 1ZQLA 3SP1A 5DBAA 5A6JA 3JT1A 3JYHA 2PBEA 5HC9A 1LM3B 1SZIA 2FMQA 2VCCA 3G50A 3H65A 3T9OA 4X4NA 3UQ2A 4PJJA 1OR3A 5L0CA 2YL1A 4R32A 2H8AA 1KNYA 4YL3A 1CPRA 2YLDA 5A6AA 4WC3A 3JPNA 3MDAA 3LESA 4I27A 5KYUB 4PK4A 4MVUA 2GWSA 4X4PA 3DWWA 1MMAA 1YLQA 4B6IA 3HTKC 3CEXA 3LS0A 5A6BA 3OV7A 1V55C 5D62A 4LT6A 3EQLF 2IXNA 3AG2C 5J2BA 3EF2A 3C8ZA 4J7YA 4G0HA 2ZH8A 3Q6NA 3O39A 4MVRA 4HFFB 2EPMX 5L0DA 4Q4ZF 4M9HA 2Q9BA 3JZ0A 5CWRA 1LVKA 2WVNA 2L9JA 4UDVA 4YT5A 4E80A 1Z3IX 4X4OA 3EGDA 4FHVA 1ST6A 1WN0A 1CGME 3N0TA 4FH3A 1ZQBA 3WFPA 2H7BA 4MVOA 1BPBA 4UD5A 1OW8A 4JWNA 4P9TA 4XQ7A 1MIWA 2PNOA 1YA9A 2R9RB 2KYHA 1YYJA 2XXAA 4RWNA 2P6VA 4O79A 4ZLCA 3EH1A 2MHRA 4U5FE 1ZW2A 4X0RA 4M63A 4PHEA 4RT2A 3CK6A 1YA7O 4JE9A 1QPUA 2HN1A 4FESA 2OEVA 4KLSA 3EGXB 5HRFA 2KW3C 3U2MA 2O5AA 4P4MA 4I1MA 5BUOA 3H38A 2A68F 3MFNA 5KYYA 3MDCA 4I2AA 3AG4C 3MBYA 1TWCA 1Z23A 3RKOF 1K40A 4M2YA 2EINC 1LI7A 2AU5A 5IIOA 5DB7A 3PNCA 4MTOA 2KGOA 9ICVA 2HS5A 2XM0A 1D0YA 3WHNA 2ZHAA 4UB4A 1FNTc 3RJKA 2HSBA 2PX0A 5HRIA 5KYXB 4NTFA 3RYLA 1V74B 7ICRA 4RWQA 4IQTA 4LEYA 2DRBA 1LS4A 2NRKA 4QZGA 4NM1A 3W2WA 4LZGA 9ICGA 4NXZA 4CIPA 3ZG1A 2B0HA 2L6HA 2KK1A 4W8PA 4X4QA 4PGYA 4X0AA 4Z6EA 2CYDA 3LEVA 5KYWB 4F4BA 1Z7Qc 2HFIA 4IGGA 3C5FA 3QVYA 3PHZA 3EH2A 2HKVA 3ISBA 5CHEA 9ICKA 4O5EA 1U0BB 3H2VA 2R25A 3IQ5A 1A0BA 4DJ9A 2WZFA 5DS6A 9ICMA 3OVAA 3IEEA 4E17A 4O67A 3IHUA 2R05A 3KPHA 4AT7B 1VB5A 2M2WA 4XLNF 3ZQYA 2R7TA 4GQHA 4I2GA 4FHXA 3DKAA 3NVOA 8ICAA 4WCWA 8ICTA 2M2UA 3AQMA 1SF8A 1I4ZA 4JTDB 2M64A 2VB6A 1TWGA 1TVAA 1DOVA 1BPEA 4WH5A 4NTBA 4PHPA 4XPXA 1BPZA 1D1AA 3EG9A 2GFHA 5JSLA 1FR0A 1IW7F 2EPNA 3ABLC 3QW1A 2ICWG 3RH5A 2ISPA 9ICFA 2OEXA 8ICVA 4EBKA 5L0HA 1LI5A 4EV6A 2Q7RA 4I28A 2J7PA 4WJ0A 2J0WA 5J2GA 4RWOA 2HJ3A 2ZH9A 2R7QA 5D61A 4U5HA 1XZPA 4QZAA 9ICHA 3EFOA 4CDAA 1YLMA 3EGXA 1JOGA 3RF3A 3AJMA 1ZJMA 1AEPA 4MFAA 4A2NB 4EUKB 1BZ4A 4K4HA 3AQBA 4OD4A 4H4KC 1NBBA 3ECSA 2PFPA 2Q9AA 1MNDA 1ZQZA 2ZH1A 1PX5A 4UB1A 3UPSA 4PGQA 4RWPA 4JRZA 4IWBA 1BPYA 1HW2A 4IRUA 1FMVA 3DE8A 4M04A 2XLHA 3PDMP 3GODA 3SYNA 9ICXA 2PFDA 1MQVA 5AC5A 5L0FA 1FTSA 1MMGA 2X51A 4MVQA 4C3DA 4WC6A 3C63A 1GQAA 4AE4B 3K66A 9ICEA 1RKEB 3M15A 1RMVA 3BRJA 3U0CA 5HRBA 1ZQYA 4J7TA 3ABKC 2P61A 1YARO 4EHPA 4R66A 1H6GA 4YMOA 4ER9A 2FMPA 9ICWA 4N4WA 2I8BA 4FHYA 3O10A 3S0XA 1MQ2A 4WC4A 1NO5A 1Z5ZA 3ATPA 7ICQA 3QTHA 4KLDA 3U8PA 1FMWA 8ICYA 1RJ9A 3CSKA 4YMNA 3RVZA 3DM9B 4O6AA 4XRHA 5BQHA 4FX5A 2J0XA 4W8KA 3LLKA 4Z6DA 4KB6A 2LD6A 3VAYA 2DB4A 4CSAC 4GXKA 1QSPA 4NQFA 4K99A 5E3CA 1YYXA 1Y6DA 4KLTA 3DE9A 5KYUA 2LCHA 3JTLO 2Q3TA 4QDLA 3GEHA 1VK5A 1Q78A 2YLIA 4D4NA 4IQVA 3ZSUA 2X0CA 1E84A 1C17M 3F46A 3AGTA 3MCRA 3TJ5A 4K0DA 2DYSC 1XSPA 4JCHA 2ZH6A 2QE9A 2XLDA 4I2DA 3EJNA 2W45A 4WGYA 3UMIA 4EEBA 1HY5A 1SMYF 4NXXA 3MYIA 4YMMA 7ICIA 4CS9C 4EKWA 4WBZA 4LDRA 5J2DA 3OUYB 2DVIA 4KNWA 3WFQE 4CJGA 3LNRA 1BBHA 1M6TA 1APCA 9ICAA 1ZJNA 1SR2A 4KC9A 5JP7A 3UNGC 1E86A 1J8YF 3SXKA 4KLQA 2A0BA 5COFA 2LK4A 4IAOA 1KTMA 2KQ9A 3US6A 4CS9A 2J45A 4DOAA 4I1OB 5AGFA 3LS1A 1ZQUA 2W4MA 3FXHA 4F5NA 4NY3A 4NXWA 5HREA 4BEJA 5DS4A 3JPOA 2QY9A 3W2VA 3N24A 2VH3A 2LSEA 5JS5A 3T4RA 4JJFA 5DECA 3JPRA 1UETA 4YL0A 4AT9B 3SZRA 4WOYA 1R8CA 5IIMA 2WB7A 4M9LA 3FAPB 1VYIA 3NMJA 1ZHYA 2D4UA 1ZQOA 2EPOA 4OAIZ 3EG9B 3LNMB 1RZTA 2PFOA 4HX0A 5BOMA 2O9XA 5T3TA 4M9GA 3F47A 4E7XA 2Z15A 4EP7A 2A0UA 2JPUA 4ANJA 5HRDA 2UUHA 4A4AA 5B3PA 5DDMA 5J0PA 1AUEA 3AUOA 1R8AA 5D46A 4BJ1A 3B0XA 3ISCA 1GS9A 1M57C 5DB6A 3RJIA 3KH2A 3TFRA 3FMSA 4BG0A 1VLSA 4PJMA 3EZIA 4CX9A 2L7AA 4EBJA 4RPZA 3JPQA 3NYJA 1ZHZA 4JVSA 4NXUA 1LKXA 2HHPA 4XPYA 4DRIB 4F5RA 4KLOA 3L9DA 8ICQA 4XUSA 3JRMO 4WBYA 2XLEA 3G4ZA 3KMIA 1D0XA 3V7KA 4KLJA 2EPLX 3H2UA 3NKDA 4CBEA 4F5PA 1UG7A 7ICSA 4NLNA 2B4VA 2DR8A 5KYWA 5KYNA 2R7SA 9ICCA 1ZZPA 3A9CA 3ITFA 2JX0A 2BE3A 3AU6A 4N7RA 5HSWA 3DM5A 1OQCA 1ZQNA 4R64A 5JLIA 3BEHA 4QZ8A 2IUBA 2VCAA 5JT4A 1ZQCA 4RQ4A 4KI2A 4WGZA 5J2FA 4E0IA 4NKUA 2DI3A 3IQ6A 2GA0A 4LLEA 2BPFA 2W4BA 5TZVA 2J7PD 4I2JA 4H54A 1JAJA 5HRKA 1PD1A 2HV7A 4EEDA 4RDAA 7ICKA 3TULA 4O9MA 3LQCB 2W9MA 1ZHTA 3ZQVA 2BPCA 5IY5C 2IYLD 4FO1A 5EK0A 1S05A 3HW8A 3ZIBA 2H7OA 4MF8A 7ICEA 4RQ3A 2ASRA 2XRHA 9ICQA 1LE4A 2XLMA 4X5VA 3NMIA 4DVYP 1OXBA 3TD7A 1ZQAA 1SYQA 4I44A 1A7DA 4U5DE 4X4VA 3EGDB 3I5QA 3RW0A 3M4CA 5A6KA 4IB4A 2BBJA 2F22A 1AVOB 4M47A 2IXMA 2XLOA 2BPGA 3MGIA 3HWTA 4Q5SF 3GEEA 5AC4A 3O55A 3RJHA 1VJ7A 2YZSA 4MVMA 4Z9IA 9ICLA 5IIJA 3TQOA 8ICLA 5L3QA 3K7DA 5J2EA 2R7VA 3U3BA 3OGUA 3Q7GA 3SXMA 1ZQVA 3C5GA 2ZH5A 9ICUA 1HMDA 3JYYA 1KEJA 1TFWA 4DOBA 4RBNA 5DQZA 1N1CA 1BPXA 3U2LA 4X4RA 3O6XA 2EILC 5BOLA 3RFYA 1ZQPA 1M2VA 1OCZC 1LE2A 3GWLA 4PACA 3R7CA 3UXOA 4RQ0A 5CI8A 4R65A 4U9EA 5T1DB 1CGOA 5L3VA 2EIJC 4DBQA 4UD4A 1TR2A 2HMZA 3AG3C 4JLXA 1Q79A 4F5OA 4BJTA 7ICUA 2Q66A 7ICMA 8ICUA 3KYJA 1TV9A 4I2BA 2IM8A 2WL8A 1BR1A 4BJ5C 4M5DA 2YEVA 4FO6A 5D92A 1O87A 1ZQTA 2GAQA 1ZQFA 4QZFA 1TFOB 1R5ID 5D49A 3Q6MA 1MMNA 5J2JA 2EIKC 2PFQA 2EIMC 2YVKA 1ZVZA 5J0OA 2OJQA 2R7RA 3S29A 4UAYA 1O3UA 4RQ2A 1H9GA 1ZU4A 4RPXA 4OINF 4XJEA 4YD1A 5B3IA 5IIIA 3JPTA 1JAFA 3CAXA 1GGQA 5FCLA 2XLWA 8ICMA 5L0IA 4ATBB 3K75D 3S28A 8ICCA 3UMKA 5F2VO 1XSNA 9ICOA 5JUAA 2BE5F 4M0AA 4YT2A 2NUPA 1WGWA 1GM5A 4F5QA 9ICSA 1OKKA 4OIRF 3LK9A 2R7XA 3M1CB 1WWPA 5CFTA 1B68A 3C2MA 3ER9B 3K1HA 2ID1A 4UB2A 4XEFA 2ZPAA 4CJOA 2WZGA 2LP4A 2ETSA 3EHNA 3PCVA 4MVZA 4WABA 3VM6A 4UAWA 1W2WA 4X4SA 4IAQA 5E2QA 3AU2A 5E33A 5HRGA 4FH5A 2V26A 2ZXPA 2BCVA 7ICHA 1C03A 4QZDA 1JR8A 2YWAA 1ZQDA 4O6MA 9ICBA 1RPLA 2XL4A 3W8HA 5COGA 1TFYA 2PFNA 3R2PA 1OKKD 2OJED 4DVZA 1OCRC 3ZC4A 5B3SC 1G8XA 3RQEA 1Q0DA 1TQGA 4LERA 9ICTA 2NUTA 1HUOA 2KJGA 2YL7A 3NYBA 2YRFA 9ICRA 3HNIA 3V7LA 3M79A 3RIPA 2WZLA 4CS8C 9ICNA 4JLZA 5J2IA 2GDCA 3RJJA 3WFOA 3U5SA 1A7EA 1HE1A 1V54C 2BC5A 3SEOA 1YAUO 4I2HA 3V5XA 3VF0A 4C3BA 3T6BA 1G4US 3ZDLA 4NXTA 3JSZA 3TOMA 5J2HA 4JEAA 5DS5A 1LPEA 4TUSA 2DR9A 1TWHA 4R63A 1JQRA 4O5KA 2GAFD 1U89A 3RH3A 2EPKX 3C66A 5D91A 3DJNB 3QMKA 3PMLA 4O6YA 4ATBA 2Y3BA 1VTMP 2A6EF 3AOUA 3UXNA 1M56C 3NRHA 3U3FA 4MTGA 1Q0MA 3C62A 1Y4CA 1TWAA 5CP2A 4UAZA 3MX3A 1K04A 4XQ1A 2DR7A 3AQNA 9ICPA 1WOTA 1R4TA 3ZWIA 2LQGA 4O6NA 3QW0A 4QI2A 5T3WA 3E9VA 4KLEA 3WFSC 3L8IA 4XWJA 2QTVA 4IJJA 3JPPA 2DRAA 1FAPB 1RCPA 4I0UA 4XLPF 2BCUA 3S9OA 3FOOA 4S3NA 1YVIA 2R02A 3ABMC 1ZW3A 3G4XA 1I4YA 4O5CA 4QZ9A 3GM2A 2I15A 3OA1A 3IPMO 2GA9D 1D1BA 3NKUA 2IXOA 1JMSA 4TURA 4M9NA 2FMSA 1RKCA 3JPSA 8ICNA 2KNHA 3C2LA 1QKRA 2RFFA 4UB5A 3Q7LA 2IBFA 4MS2A 4QZCA 2CGEA 5BQGA 1T6QA 4P6IC 4ZLDA 2C04A 1RXQA 3OVBA 3OEOA 4JCZA 5DVWA 1YZAA 4G7OF 4CS8A 4LACB 1A7VA 5IIKA 2KC3A 1S7ZA 5TJ5E 2OU6A 3B71A 5J0WA 5DBBA 4XEVA 2ZD9A 3GM1A 3HIYA 2AWCA 2RSEB 3AQKA 3DAGA 3HJ4A 2HV6A 1ZQKA 3H39A 4XPWA 2XS8A 5B1AC 2J9UA 4NC3A 2ZXOA 2Q4FA 4YK5A 1F5AA 4U9DA 3WODF 3JCFA 3FDQA 1T9KA 4XQ8A 3L0IA 3ZTMA 1Q0FA 5DBCA 1OR2A 1V4AA 4CDVA 2IHMA 2FAPB 2NPUA 3WG7C 4N6HA 4RD9A 2AWYA 3TJ6A 4E8FA 4E7SA 2VC9A 3NWIA 4X4TA 3GANA 2ZH3A 4I2FA 4NLZA 5KYYB 4AX2A 1NG1A 5F28E 4KLLA 4PJLA 4BPMA 4MFCA 4AL0A 1L3PA 2PXIA 2V3CC 4CSAA 2J46A 4LDQA 5B3QA 4N6CA 2HZ8A 4AL1A 1YJGA 4K7BA 1OCCC 1R89A 1Z63A 3V72A 4P2HA 4UB3A 3PHF2 4QI0A 3OWGA 2ZH4A 5EGYA 4E7ZA 2ISOA 3RJGA 4NTAA 3DZAA 1NU9C 2ZH2A 4U5CE 2B51A 4RQ5A 5CB1A 1ZQEA 3UGPA 4I2EA 3N2ZB 4J30B 2ZXWC 3DD7A 3NDBB 2JD3A 2YKZA 4Z9JA 3W8IA 4PR9A 3EZHA 5E3AA 4KLGA 8ICIA 4JTCB 3VRCA 2MWQA 1MIVA 4HEAJ 2IXPA 4EIYA 2FCLA 2HSQA 3EFOB 1XZQA 4YL1A 3TFSA 4BJ5A 2XL6A 3AQCA 3LEOA 3ERCC 4FWVA 3JRTA 1JPJA 4JJGA 2ZH7A 1T6IA 4MW8A 2CNWA 4FHWA 4AK9A 4GXIA 4TUPA 4P4PA 1ZQGA 4ULVA 2H7VC 4WC2A 3ZVRA 4NM2A 4WC5A 1I5NA 1XWJA 1MMDA 4KLMA 2G62A 3MYFA 5HHHA 4K9BA 1IZMA 3RQGA 2L6FA 3IQTA 1ZQHA 3UXPA 3I4UA 1ORJA 3JCUQ 1EA8A 1OW6A 2CW0F 4U5BE 2XM4A 2YLGA 3B29A 5CR0A 1UEUA 1K05A 3RJFA 4RQ8A 8ICPA 5DLJA 1OXKA 3L8JA 3SXYA 4P4OA 4Z6CA 2J9VA 1PCXA 3ZTZA 4CS7A 4KLHA 256BA 4HFKB 3POVA 3FAJA 5J0SA 5EOZA 4OIPF 5L0GA 5J0UA 3RH4A 2W9YA 4LLCA 1XSLA 3NG1A 3OVSA 4DRJB 5FZTA 1QZXA 4YWQA 1YZCA 7ICOA 4ONSA 4C7OB 5IILA 2BCRA 1G5ZA 2R03A 2KSFA 4HE8D 5HV9A 4MFFA 1WATA 3MLGA 5BQIA 3X1OA 3HNKA 4D4XA 3FOPA 3T6GB 4O69A 4KM5A 1D1CA 2NUPB 3H37A 4WQLA 2WVQA 7ICVA 3AGUA 1HMOA 2R7OA 4KLFA 4K97A 4DBRA 4LVSA 1UFBA 2I9GA 2M4EA 4DXWA 1ZQMA 1HE9A 4RQ1A 2Y3DA 1A41A 4BEMJ 3ASOC 4WQKA 3NYLA 1JN3A 5A69A 5J2CA 5J0TA 2E87A 3DMDA 3PMNA 4K1OA 4Z9HA 4JZAA 3X2QC 2NUTB 1H7IA 1FFHA 3B0VC 1ZQWA 3EPVA 8ICBA 3TOLA 2YL3A 3QVZA 4NKTA 4L6RA 3OUYA 1J8MF 5DDYA 5J2AA 4BJ6A 1EKYA 4YT4A 2OOCA 4MKPA 1EI7A 4YCXA 4O68A 3V7OA 7ICNA 2AP3A 9ICJA 3L34A 2XL8A 4FHPA 5J2KA 3U8VA 3KYIA 2XS1A 3K6BA 8ICOA 5BPCA 4KLUA 3OWTA 4YJWA 4KNVA 5D63A 1ZQXA 4OAGA 1NSGB 9ICIA 3RVYA 3UPQA 4K4IA 1T6UA 1EQ1A 3C18A 5CFSA 5DQTA 4UBBA 2HMQA 5D4BA 4EGWA 4JC7A 1WTYA 4JKVA 4XEKA 1QQ3A 4MVSA 1LS1A 3GEIA 2G3VA 4MW3A 4K8VA 4TUQA 3S27A 2A1DD 3KKBA 4MQ9F 3V5ZA 5J0RA 8ICJA 3WFRE 5K0IA 3H3AA 4OAFA 2CCYA 3ISDA 2OQMA 4OD5A 2BBHA 4YN0B 4U5GA 3ASNC 8ICFA 4JW1A 3RQFA 1ZQRA 4E18A 3GWNA 4NXVA 3UQ0A 1ZU5A 7ICPA 4RPYA 4BJ6C 3HKKA 1JPNA 2LFDA 2M2TA 4RQ7A 1L7CA 4AE4A 2O1PA 2VANA 5J0YA 1WOLA 4RQ6A 2P0NA 4IARA 3LLIA 8ICHA 1QLEC 4K96A 2DYRC 1ZHWA 3ER8C 4U5EE 4LDKA 8ICRA 1FFTC 1VYKA 4JTAB 1G4WR 7ICJA 4XTKA 2P66A 4I29A 1RKEA 2YL0A 2NSFA 1FA0A 3E70C 1NZEA 3NYMA 1BR2A 5CIVA 3HLZA 2OKUA 1VFGA 2Y3HA 3PMRA 1NFNA 3B0PA 2B56A 4K4GA 2R7WA 4E0HA 3B0UX 1NU7D
chains in the Genus database with same CATH topology
3C2LA 3H38A 3MFNA 4EBJA 2RFFA 5CJ7A 4RPZA 4UB5A 3JPQA 3V7JA 4QZCA 4QZEA 3MDCA 1OW7A 4I2AA 7ICLA 2HHPA 3MBYA 4F5RA 4KLOA 3L9DA 1K40A 3OVBA 8ICQA 4XUSA 4WBYA 4M2YA 1R8BA 3HX0A 8ICSA 5IIOA 1MIYA 5DB7A 3PNCA 5IIKA 3RH6A 3V7KA 1UEVA 4KLJA 9ICVA 3B71A 4F5PA 5J0WA 4WC0A 5DBBA 7ICSA 4XA5A 2ZHAA 4UB4A 4NLNA 4XEVA 2DR8A 7ICTA 4RT3A 3GM1A 3HIYA 3RJKA 2HSBA 3AQKA 5HRIA 9ICCA 3HJ4A 1ZQKA 3H39A 3HJ1A 7ICRA 4RWQA 4IQTA 1ZZPA 2JX0A 1F5AA 2DRBA 2NRKA 4QZGA 4XQ8A 2BE3A 4NM1A 3AU6A 4LZGA 5DBCA 3GM3A 4PHDA 9ICGA 1V4AA 4NXZA 2IHMA 4QZBA 2L6HA 2KK1A 1ZQNA 4R64A 4X4QA 4PGYA 4X0AA 4QZ8A 4Z6EA 1ZQCA 4E8FA 4RQ4A 4YD2A 2Q00A 4X4TA 5J2FA 1QVXA 2ZH3A 3C5FA 4DOCA 4I2FA 4NKUA 4NLZA 2ZHBA 3ISBA 2BPFA 5F28E 4KLLA 5TZVA 3GDXA 4MFCA 9ICKA 4O5EA 4I2JA 2PXIA 1JAJA 5HRKA 5HRLA 1HUZA 4LZDA 9ICMA 1R89A 3OVAA 3V72A 4P2HA 7ICKA 3TULA 4UB3A 8ICEA 4O9MA 3LQCB 2W9MA 2ZH4A 2BPCA 4AT7B 1PV3A 2M2WA 2ISOA 3RJGA 3HW8A 5CHGA 4MF8A 7ICEA 4RQ3A 2ZH2A 2M2VA 4I2GA 4FHXA 9ICQA 4RQ5A 5CB1A 8ICAA 4AT9A 4WCWA 1ZQEA 4I2EA 8ICTA 2M2UA 4X5VA 1ZQQA 4IQWA 5IINA 2L6GA 3AQMA 1ZQAA 4AT8A 4YN4A 4X4VA 4KLGA 5CA7A 1TVAA 8ICIA 1BPEA 1MIVA 3C8GD 1NOMA 4PHPA 4M47A 7ICGA 3TFSA 1BPZA 2BPGA 3MGIA 3HWTA 4IG8A 8ICWA 3RJEA 5J0XA 2ZH7A 3RH5A 2ISPA 9ICFA 4FHWA 8ICVA 8ICKA 1MQ3A 4GXIA 3RJHA 4EBKA 4TUPA 1VJ7A 9ICLA 4P4PA 1ZQGA 1KDHA 4WC2A 5IIJA 8ICLA 4WC1A 4I28A 3K7DA 5J2EA 3OGUA 4JWMA 3C2KA 4NM2A 3C8GB 1ZQVA 5J2GA 1ZQSA 4RWOA 3C5GA 4WC5A 2ZH9A 2ZH5A 9ICUA 4KLMA 3JYYA 3C8GA 1KEJA 1TFWA 4DOBA 4QZAA 5HHHA 8ICGA 9ICHA 3RQGA 5DB9A 2L6FA 5HRHA 1ZQHA 3UXPA 1JOGA 3AJMA 1ZJMA 4MFAA 1BPXA 4X4RA 1OW6A 4K4HA 4IQUA 5BOLA 1OU5A 5CR0A 1UEUA 4NLKA 1K05A 1ZQPA 2PFPA 3RJFA 1ZQZA 2ZH1A 1PX5A 4UB1A 4Z6FA 4RQ8A 3UPSA 8ICPA 3UXOA 4RQ0A 4PGQA 3L8JA 4RWPA 1BPYA 1ZQIA 4P4OA 4R65A 3B0YA 4Z6CA 5HHIA 4M04A 4MF2A 4AT7A 4KLHA 4UD4A 3MGHA 1Q79A 9ICXA 4F5OA 7ICUA 5J0SA 2Q66A 7ICMA 4WC6A 8ICUA 1TV9A 5J0QA 4I2BA 9ICEA 5EOZA 4M5DA 4FO6A 8ICXA 3BRJA 4PPXA 1ZQTA 5J0UA 3U0CA 1ZQJA 1ZQFA 3RH4A 4QZFA 5HRBA 1ZQYA 2BCQA 1XSLA 5D49A 3OVSA 5J2JA 2PFQA 5J0OA 4R66A 7ICOA 4NY8A 4UAYA 4YMOA 2BCRA 1O3UA 5IILA 2FMPA 4RQ2A 9ICWA 4FHYA 3O10A 5DB8A 4RPXA 4QZHA 4PGXA 3AQLA 4YD1A 5IIIA 4PH5A 5HR9A 3JPTA 1MQ2A 4MFFA 4WC4A 1NO5A 7ICQA 8ICMA 4KLDA 4X4UA 4ATBB 3K75D 8ICCA 8ICYA 5F2VO 1BPDA 1XSNA 4PHAA 4YMNA 9ICOA 3H37A 4M9JA 7ICVA 4GXJA 4M0AA 4WC7A 4XRHA 4F5QA 9ICSA 3LK9A 5DKWA 4KLFA 4Z6DA 4LVSA 1WWPA 4KLIA 1UFBA 2I9GA 7ICFA 3C2MA 1ZQMA 4UB2A 2ID1A 4XEFA 4RQ1A 4GXKA 4NQFA 4UBCA 1JN3A 5J2CA 4UAWA 5J0TA 4X4SA 2BCSA 4KLTA 4X0BA 3PMNA 3AU2A 5HRGA 2DR5A 4FH5A 1Q78A 4QZIA 1ZQWA 2BCVA 8ICBA 7ICHA 4QZDA 4NKTA 4AT8B 3OUYA 8ICZA 4IQVA 2YWAA 1ZQDA 5J29A 9ICBA 1RPLA 5DDYA 5J2AA 1TFYA 2PFNA 4YCXA 1XSPA 7ICNA 3RQEA 2ZH6A 4DO9A 4I2DA 4I2CA 9ICJA 4I2IA 4FHPA 5DEDA 5J2KA 9ICTA 1HUOA 1ZQLA 8ICOA 5DBAA 3NYBA 5BPCA 4KLUA 9ICRA 2PBEA 5HC9A 1ZQXA 2FMQA 4YMMA 3V7LA 7ICIA 4X4NA 4WBZA 3UQ2A 9ICIA 3UPQA 5J2DA 4K4IA 3OUYB 9ICNA 2DVIA 4R32A 5J2IA 3RJJA 3C18A 3WFQE 3WFOA 1KNYA 4UBBA 5D4BA 4WC3A 3JPNA 4I2HA 3MDAA 9ICAA 1WTYA 1ZJNA 4I27A 4XEKA 2GWSA 4KLQA 4TUQA 2LK4A 5J2HA 1KTMA 5J0RA 4X4PA 8ICJA 3WFRE 1YLQA 4DOAA 3H3AA 4TUSA 3OV7A 1ZQUA 2DR9A 4R63A 4LT6A 4F5NA 3ISDA 1JQRA 4O5KA 5HREA 8ICFA 5J2BA 3JPOA 3RQFA 3C66A 1ZQRA 3PMLA 5DECA 3JPRA 1UETA 3UQ0A 2ZH8A 4ATBA 4AT9B 7ICPA 4RPYA 3UXNA 3U3FA 2M2TA 4M9HA 3JZ0A 4RQ7A 5CWRA 2O1PA 2VANA 5CP2A 1WOLA 5J0YA 4UAZA 1R8CA 4RQ6A 4E80A 1K04A 4X4OA 5IIMA 2DR7A 4M9LA 4FHVA 3AQNA 9ICPA 1WOTA 8ICHA 8ICRA 4KLEA 1ZQOA 3WFSC 3L8IA 4FH3A 1ZQBA 1RZTA 3WFPA 1BPBA 4UD5A 7ICJA 2PFOA 1OW8A 4JWNA 3JPPA 2DRAA 2P66A 4XQ7A 5BOMA 1MIWA 4I29A 1FA0A 2BCUA 4M9GA 3S9OA 4E7XA 4S3NA 4RWNA 4EP7A 2JPUA 4O5CA 5HRDA 1VFGA 4QZ9A 4PHEA 5DDMA 4RT2A 3GM2A 5J0PA 3AUOA 1R8AA 5D46A 1JMSA 4KLSA 4TURA 4M9NA 5HRFA 3B0XA 3ISCA 2FMSA 4K4GA 5DB6A 2O5AA 4P4MA 3RJIA 3TFRA 3JPSA 8ICNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C2L A;  3H38 A;  3MFN A;  4EBJ A;  2RFF A;  5CJ7 A;  4RPZ A;  4UB5 A;  3JPQ A;  3V7J A;  4QZC A;  4QZE A;  3MDC A;  1OW7 A;  4I2A A;  7ICL A;  2HHP A;  3MBY A;  4F5R A;  4KLO A;  3L9D A;  1K40 A;  3OVB A;  8ICQ A;  4XUS A;  4WBY A;  4M2Y A;  1R8B A;  3HX0 A;  8ICS A;  5IIO A;  1MIY A;  5DB7 A;  3PNC A;  5IIK A;  3RH6 A;  3V7K A;  1UEV A;  4KLJ A;  9ICV A;  3B71 A;  4F5P A;  5J0W A;  4WC0 A;  5DBB A;  7ICS A;  4XA5 A;  2ZHA A;  4UB4 A;  4NLN A;  4XEV A;  2DR8 A;  7ICT A;  4RT3 A;  3GM1 A;  3HIY A;  3RJK A;  2HSB A;  3AQK A;  5HRI A;  9ICC A;  3HJ4 A;  1ZQK A;  3H39 A;  3HJ1 A;  7ICR A;  4RWQ A;  4IQT A;  1ZZP A;  2JX0 A;  1F5A A;  2DRB A;  2NRK A;  4QZG A;  4XQ8 A;  2BE3 A;  4NM1 A;  3AU6 A;  4LZG A;  5DBC A;  3GM3 A;  4PHD A;  9ICG A;  1V4A A;  4NXZ A;  2IHM A;  4QZB A;  2L6H A;  2KK1 A;  1ZQN A;  4R64 A;  4X4Q A;  4PGY A;  4X0A A;  4QZ8 A;  4Z6E A;  1ZQC A;  4E8F A;  4RQ4 A;  4YD2 A;  2Q00 A;  4X4T A;  5J2F A;  1QVX A;  2ZH3 A;  3C5F A;  4DOC A;  4I2F A;  4NKU A;  4NLZ A;  2ZHB A;  3ISB A;  2BPF A;  5F28 E;  4KLL A;  5TZV A;  3GDX A;  4MFC A;  9ICK A;  4O5E A;  4I2J A;  2PXI A;  1JAJ A;  5HRK A;  5HRL A;  1HUZ A;  4LZD A;  9ICM A;  1R89 A;  3OVA A;  3V72 A;  4P2H A;  7ICK A;  3TUL A;  4UB3 A;  8ICE A;  4O9M A;  3LQC B;  2W9M A;  2ZH4 A;  2BPC A;  4AT7 B;  1PV3 A;  2M2W A;  2ISO A;  3RJG A;  3HW8 A;  5CHG A;  4MF8 A;  7ICE A;  4RQ3 A;  2ZH2 A;  2M2V A;  4I2G A;  4FHX A;  9ICQ A;  4RQ5 A;  5CB1 A;  8ICA A;  4AT9 A;  4WCW A;  1ZQE A;  4I2E A;  8ICT A;  2M2U A;  4X5V A;  1ZQQ A;  4IQW A;  5IIN A;  2L6G A;  3AQM A;  1ZQA A;  4AT8 A;  4YN4 A;  4X4V A;  4KLG A;  5CA7 A;  1TVA A;  8ICI A;  1BPE A;  1MIV A;  3C8G D;  1NOM A;  4PHP A;  4M47 A;  7ICG A;  3TFS A;  1BPZ A;  2BPG A;  3MGI A;  3HWT A;  4IG8 A;  8ICW A;  3RJE A;  5J0X A;  2ZH7 A;  3RH5 A;  2ISP A;  9ICF A;  4FHW A;  8ICV A;  8ICK A;  1MQ3 A;  4GXI A;  3RJH A;  4EBK A;  4TUP A;  1VJ7 A;  9ICL A;  4P4P A;  1ZQG A;  1KDH A;  4WC2 A;  5IIJ A;  8ICL A;  4WC1 A;  4I28 A;  3K7D A;  5J2E A;  3OGU A;  4JWM A;  3C2K A;  4NM2 A;  3C8G B;  1ZQV A;  5J2G A;  1ZQS A;  4RWO A;  3C5G A;  4WC5 A;  2ZH9 A;  2ZH5 A;  9ICU A;  4KLM A;  3JYY A;  3C8G A;  1KEJ A;  1TFW A;  4DOB A;  4QZA A;  5HHH A;  8ICG A;  9ICH A;  3RQG A;  5DB9 A;  2L6F A;  5HRH A;  1ZQH A;  3UXP A;  1JOG A;  3AJM A;  1ZJM A;  4MFA A;  1BPX A;  4X4R A;  1OW6 A;  4K4H A;  4IQU A;  5BOL A;  1OU5 A;  5CR0 A;  1UEU A;  4NLK A;  1K05 A;  1ZQP A;  2PFP A;  3RJF A;  1ZQZ A;  2ZH1 A;  1PX5 A;  4UB1 A;  4Z6F A;  4RQ8 A;  3UPS A;  8ICP A;  3UXO A;  4RQ0 A;  4PGQ A;  3L8J A;  4RWP A;  1BPY A;  1ZQI A;  4P4O A;  4R65 A;  3B0Y A;  4Z6C A;  5HHI A;  4M04 A;  4MF2 A;  4AT7 A;  4KLH A;  4UD4 A;  3MGH A;  1Q79 A;  9ICX A;  4F5O A;  7ICU A;  5J0S A;  2Q66 A;  7ICM A;  4WC6 A;  8ICU A;  1TV9 A;  5J0Q A;  4I2B A;  9ICE A;  5EOZ A;  4M5D A;  4FO6 A;  8ICX A;  3BRJ A;  4PPX A;  1ZQT A;  5J0U A;  3U0C A;  1ZQJ A;  1ZQF A;  3RH4 A;  4QZF A;  5HRB A;  1ZQY A;  2BCQ A;  1XSL A;  5D49 A;  3OVS A;  5J2J A;  2PFQ A;  5J0O A;  4R66 A;  7ICO A;  4NY8 A;  4UAY A;  4YMO A;  2BCR A;  1O3U A;  5IIL A;  2FMP A;  4RQ2 A;  9ICW A;  4FHY A;  3O10 A;  5DB8 A;  4RPX A;  4QZH A;  4PGX A;  3AQL A;  4YD1 A;  5III A;  4PH5 A;  5HR9 A;  3JPT A;  1MQ2 A;  4MFF A;  4WC4 A;  1NO5 A;  7ICQ A;  8ICM A;  4KLD A;  4X4U A;  4ATB B;  3K75 D;  8ICC A;  8ICY A;  5F2V O;  1BPD A;  1XSN A;  4PHA A;  4YMN A;  9ICO A;  3H37 A;  4M9J A;  7ICV A;  4GXJ A;  4M0A A;  4WC7 A;  4XRH A;  4F5Q A;  9ICS A;  3LK9 A;  5DKW A;  4KLF A;  4Z6D A;  4LVS A;  1WWP A;  4KLI A;  1UFB A;  2I9G A;  7ICF A;  3C2M A;  1ZQM A;  4UB2 A;  2ID1 A;  4XEF A;  4RQ1 A;  4GXK A;  4NQF A;  4UBC A;  1JN3 A;  5J2C A;  4UAW A;  5J0T A;  4X4S A;  2BCS A;  4KLT A;  4X0B A;  3PMN A;  3AU2 A;  5HRG A;  2DR5 A;  4FH5 A;  1Q78 A;  4QZI A;  1ZQW A;  2BCV A;  8ICB A;  7ICH A;  4QZD A;  4NKT A;  4AT8 B;  3OUY A;  8ICZ A;  4IQV A;  2YWA A;  1ZQD A;  5J29 A;  9ICB A;  1RPL A;  5DDY A;  5J2A A;  1TFY A;  2PFN A;  4YCX A;  1XSP A;  7ICN A;  3RQE A;  2ZH6 A;  4DO9 A;  4I2D A;  4I2C A;  9ICJ A;  4I2I A;  4FHP A;  5DED A;  5J2K A;  9ICT A;  1HUO A;  1ZQL A;  8ICO A;  5DBA A;  3NYB A;  5BPC A;  4KLU A;  9ICR A;  2PBE A;  5HC9 A;  1ZQX A;  2FMQ A;  4YMM A;  3V7L A;  7ICI A;  4X4N A;  4WBZ A;  3UQ2 A;  9ICI A;  3UPQ A;  5J2D A;  4K4I A;  3OUY B;  9ICN A;  2DVI A;  4R32 A;  5J2I A;  3RJJ A;  3C18 A;  3WFQ E;  3WFO A;  1KNY A;  4UBB A;  5D4B A;  4WC3 A;  3JPN A;  4I2H A;  3MDA A;  9ICA A;  1WTY A;  1ZJN A;  4I27 A;  4XEK A;  2GWS A;  4KLQ A;  4TUQ A;  2LK4 A;  5J2H A;  1KTM A;  5J0R A;  4X4P A;  8ICJ A;  3WFR E;  1YLQ A;  4DOA A;  3H3A A;  4TUS A;  3OV7 A;  1ZQU A;  2DR9 A;  4R63 A;  4LT6 A;  4F5N A;  3ISD A;  1JQR A;  4O5K A;  5HRE A;  8ICF A;  5J2B A;  3JPO A;  3RQF A;  3C66 A;  1ZQR A;  3PML A;  5DEC A;  3JPR A;  1UET A;  3UQ0 A;  2ZH8 A;  4ATB A;  4AT9 B;  7ICP A;  4RPY A;  3UXN A;  3U3F A;  2M2T A;  4M9H A;  3JZ0 A;  4RQ7 A;  5CWR A;  2O1P A;  2VAN A;  5CP2 A;  1WOL A;  5J0Y A;  4UAZ A;  1R8C A;  4RQ6 A;  4E80 A;  1K04 A;  4X4O A;  5IIM A;  2DR7 A;  4M9L A;  4FHV A;  3AQN A;  9ICP A;  1WOT A;  8ICH A;  8ICR A;  4KLE A;  1ZQO A;  3WFS C;  3L8I A;  4FH3 A;  1ZQB A;  1RZT A;  3WFP A;  1BPB A;  4UD5 A;  7ICJ A;  2PFO A;  1OW8 A;  4JWN A;  3JPP A;  2DRA A;  2P66 A;  4XQ7 A;  5BOM A;  1MIW A;  4I29 A;  1FA0 A;  2BCU A;  4M9G A;  3S9O A;  4E7X A;  4S3N A;  4RWN A;  4EP7 A;  2JPU A;  4O5C A;  5HRD A;  1VFG A;  4QZ9 A;  4PHE A;  5DDM A;  4RT2 A;  3GM2 A;  5J0P A;  3AUO A;  1R8A A;  5D46 A;  1JMS A;  4KLS A;  4TUR A;  4M9N A;  5HRF A;  3B0X A;  3ISC A;  2FMS A;  4K4G A;  5DB6 A;  2O5A A;  4P4M A;  3RJI A;  3TFR A;  3JPS A;  8ICN A; 
#chains in the Genus database with same CATH topology
 4MTF A;  2P1A A;  2J8W A;  3LJB A;  5CJ7 A;  3V7J A;  3U9J A;  4QZE A;  1KU2 A;  1OW7 A;  2G3K A;  7ICL A;  3FHD A;  4FAP B;  1T01 A;  1O5H A;  4ULW A;  2FFH A;  2XLV A;  1R8B A;  3HX0 A;  8ICS A;  4PFO A;  1MIY A;  3SXZ A;  3RH6 A;  3LUT B;  1UEV A;  4WC0 A;  2ZXR A;  4XA5 A;  4DOZ A;  4Q7C A;  7ICT A;  4LEV A;  4RT3 A;  5F5H A;  3MBG A;  2EWR A;  1ZYR F;  2UUI A;  2PF4 E;  3V5Y A;  2NSG A;  3HJ1 A;  2LIG A;  1DOW A;  5CI9 A;  3J06 A;  5CFU A;  3DJU B;  2FGY A;  1D0Z A;  3S84 A;  3GM3 A;  4NCQ A;  4PHD A;  3TK0 A;  5GPG B;  4QZB A;  4G7H F;  2NG1 A;  2BL2 A;  4P9F A;  3AG1 C;  4JUR I;  2IOQ A;  4YD2 A;  2Q00 A;  1Z6A A;  1BR4 A;  3CQZ A;  1QVX A;  2VCB A;  1VMA A;  4DOC A;  4DRH B;  2YHS A;  2B0J A;  2ZHB A;  2CDQ A;  2QLA A;  3GDX A;  4CDY A;  5HRL A;  1HUZ A;  4LZD A;  3K33 A;  4EWC A;  1ZHX A;  8ICE A;  3KL4 A;  3SNH A;  1PV3 A;  3UGO A;  2J9B A;  1Q0K A;  5CHG A;  2RD9 A;  2Q9C A;  2M2V A;  1ORS C;  1HW1 A;  2C03 A;  4GEH A;  3LAY A;  4AT9 A;  1H9T A;  2HN2 A;  5JVE A;  1ZQQ A;  4IQW A;  5IIN A;  2L6G A;  5JRA A;  4AT8 A;  4PFP A;  4LEZ A;  4YN4 A;  3K1I A;  4O7G A;  1VOM A;  5CA7 A;  2J9W A;  4JEB A;  3GOR A;  5JTG A;  3C8G D;  3NKE A;  1NOM A;  7ICG A;  2Y69 C;  4IG8 A;  8ICW A;  3RJE A;  5J0X A;  3UMH A;  2QUP A;  2Y39 A;  2R7U A;  4CIH A;  5KYX A;  3C7J A;  3HNL A;  8ICK A;  1MQ3 A;  1PD0 A;  3EHM A;  1Q0G A;  1MNE A;  1KDH A;  4WC1 A;  4JWM A;  3C2K A;  1WAS A;  3C8G B;  2OCC C;  1VLT A;  1ZQS A;  4GYT A;  3C8G A;  2MYS A;  3DI5 A;  8ICG A;  5DB9 A;  5HRH A;  2PX3 A;  2Y3G A;  3WAQ A;  2IHO A;  4C7O A;  1E2X A;  4IQU A;  1YDI A;  1TFK B;  1ORY A;  4EBB A;  1OU5 A;  1U6H A;  4NLK A;  1TKN A;  4Z6F A;  3L1M A;  2AVK A;  4KBL A;  5EHH A;  3S90 A;  1GPJ A;  4YT8 A;  1T5O A;  1ZQI A;  4N06 A;  3B0Y A;  5HHI A;  2D5R B;  5L0J A;  4MF2 A;  4AT7 A;  3HNJ A;  3MGH A;  1M2O A;  5COM A;  1C02 A;  3NMK A;  4MND A;  2VAS A;  3QZC A;  2XXA B;  5J0Q A;  4I3M A;  3DXJ F;  8ICX A;  4PPX A;  1M2V B;  1ZQJ A;  1F1M A;  2HUJ A;  2BCQ A;  5F5F A;  2A69 F;  2YQY A;  4G78 A;  3K1I C;  3JSE O;  4NY8 A;  3T6J A;  1NLX A;  2HJM A;  5DB8 A;  4PGX A;  4QZH A;  3AQL A;  1E83 A;  4PH5 A;  2LFF A;  5HR9 A;  4K9A A;  4K98 A;  3DAF A;  2GWW A;  4J32 B;  2A6H F;  3I5P A;  4X4U A;  2P7V A;  1BPD A;  4PHA A;  4OIO F;  3HJC A;  2OG2 A;  4M9J A;  4GXJ A;  1LIH A;  4WC7 A;  3U9M A;  4G7Z F;  3M4B A;  2DGJ A;  5A6B D;  5DKW A;  3A11 A;  4KLI A;  2CNW D;  4C3E A;  7ICF A;  1E85 A;  3UR3 C;  2TMV P;  4UBC A;  1JMW A;  4PJN A;  2XSE A;  4LEW A;  1CGN A;  2BCS A;  1BDJ B;  4X0B A;  2L81 A;  3W4Y A;  2WVO A;  4JIO A;  2DR5 A;  1RJ9 B;  1NFO A;  4QZI A;  2PP4 A;  1OCO C;  8ICZ A;  4AT8 B;  3IQC A;  5J29 A;  2QNL A;  1CPQ A;  5B1B C;  4OAH A;  4I2C A;  4DO9 A;  3CZ6 A;  3B9Q A;  4I2I A;  3FVY A;  1JRA A;  5DED A;  3VYW A;  4OIQ F;  1ZQL A;  3SP1 A;  5DBA A;  5A6J A;  3JT1 A;  3JYH A;  2PBE A;  5HC9 A;  1LM3 B;  1SZI A;  2FMQ A;  2VCC A;  3G50 A;  3H65 A;  3T9O A;  4X4N A;  3UQ2 A;  4PJJ A;  1OR3 A;  5L0C A;  2YL1 A;  4R32 A;  2H8A A;  1KNY A;  4YL3 A;  1CPR A;  2YLD A;  5A6A A;  4WC3 A;  3JPN A;  3MDA A;  3LES A;  4I27 A;  5KYU B;  4PK4 A;  4MVU A;  2GWS A;  4X4P A;  3DWW A;  1MMA A;  1YLQ A;  4B6I A;  3HTK C;  3CEX A;  3LS0 A;  5A6B A;  3OV7 A;  1V55 C;  5D62 A;  4LT6 A;  3EQL F;  2IXN A;  3AG2 C;  5J2B A;  3EF2 A;  3C8Z A;  4J7Y A;  4G0H A;  2ZH8 A;  3Q6N A;  3O39 A;  4MVR A;  4HFF B;  2EPM X;  5L0D A;  4Q4Z F;  4M9H A;  2Q9B A;  3JZ0 A;  5CWR A;  1LVK A;  2WVN A;  2L9J A;  4UDV A;  4YT5 A;  4E80 A;  1Z3I X;  4X4O A;  3EGD A;  4FHV A;  1ST6 A;  1WN0 A;  1CGM E;  3N0T A;  4FH3 A;  1ZQB A;  3WFP A;  2H7B A;  4MVO A;  1BPB A;  4UD5 A;  1OW8 A;  4JWN A;  4P9T A;  4XQ7 A;  1MIW A;  2PNO A;  1YA9 A;  2R9R B;  2KYH A;  1YYJ A;  2XXA A;  4RWN A;  2P6V A;  4O79 A;  4ZLC A;  3EH1 A;  2MHR A;  4U5F E;  1ZW2 A;  4X0R A;  4M63 A;  4PHE A;  4RT2 A;  3CK6 A;  1YA7 O;  4JE9 A;  1QPU A;  2HN1 A;  4FES A;  2OEV A;  4KLS A;  3EGX B;  5HRF A;  2KW3 C;  3U2M A;  2O5A A;  4P4M A;  4I1M A;  5BUO A;  3H38 A;  2A68 F;  3MFN A;  5KYY A;  3MDC A;  4I2A A;  3AG4 C;  3MBY A;  1TWC A;  1Z23 A;  3RKO F;  1K40 A;  4M2Y A;  2EIN C;  1LI7 A;  2AU5 A;  5IIO A;  5DB7 A;  3PNC A;  4MTO A;  2KGO A;  9ICV A;  2HS5 A;  2XM0 A;  1D0Y A;  3WHN A;  2ZHA A;  4UB4 A;  1FNT c;  3RJK A;  2HSB A;  2PX0 A;  5HRI A;  5KYX B;  4NTF A;  3RYL A;  1V74 B;  7ICR A;  4RWQ A;  4IQT A;  4LEY A;  2DRB A;  1LS4 A;  2NRK A;  4QZG A;  4NM1 A;  3W2W A;  4LZG A;  9ICG A;  4NXZ A;  4CIP A;  3ZG1 A;  2B0H A;  2L6H A;  2KK1 A;  4W8P A;  4X4Q A;  4PGY A;  4X0A A;  4Z6E A;  2CYD A;  3LEV A;  5KYW B;  4F4B A;  1Z7Q c;  2HFI A;  4IGG A;  3C5F A;  3QVY A;  3PHZ A;  3EH2 A;  2HKV A;  3ISB A;  5CHE A;  9ICK A;  4O5E A;  1U0B B;  3H2V A;  2R25 A;  3IQ5 A;  1A0B A;  4DJ9 A;  2WZF A;  5DS6 A;  9ICM A;  3OVA A;  3IEE A;  4E17 A;  4O67 A;  3IHU A;  2R05 A;  3KPH A;  4AT7 B;  1VB5 A;  2M2W A;  4XLN F;  3ZQY A;  2R7T A;  4GQH A;  4I2G A;  4FHX A;  3DKA A;  3NVO A;  8ICA A;  4WCW A;  8ICT A;  2M2U A;  3AQM A;  1SF8 A;  1I4Z A;  4JTD B;  2M64 A;  2VB6 A;  1TWG A;  1TVA A;  1DOV A;  1BPE A;  4WH5 A;  4NTB A;  4PHP A;  4XPX A;  1BPZ A;  1D1A A;  3EG9 A;  2GFH A;  5JSL A;  1FR0 A;  1IW7 F;  2EPN A;  3ABL C;  3QW1 A;  2ICW G;  3RH5 A;  2ISP A;  9ICF A;  2OEX A;  8ICV A;  4EBK A;  5L0H A;  1LI5 A;  4EV6 A;  2Q7R A;  4I28 A;  2J7P A;  4WJ0 A;  2J0W A;  5J2G A;  4RWO A;  2HJ3 A;  2ZH9 A;  2R7Q A;  5D61 A;  4U5H A;  1XZP A;  4QZA A;  9ICH A;  3EFO A;  4CDA A;  1YLM A;  3EGX A;  1JOG A;  3RF3 A;  3AJM A;  1ZJM A;  1AEP A;  4MFA A;  4A2N B;  4EUK B;  1BZ4 A;  4K4H A;  3AQB A;  4OD4 A;  4H4K C;  1NBB A;  3ECS A;  2PFP A;  2Q9A A;  1MND A;  1ZQZ A;  2ZH1 A;  1PX5 A;  4UB1 A;  3UPS A;  4PGQ A;  4RWP A;  4JRZ A;  4IWB A;  1BPY A;  1HW2 A;  4IRU A;  1FMV A;  3DE8 A;  4M04 A;  2XLH A;  3PDM P;  3GOD A;  3SYN A;  9ICX A;  2PFD A;  1MQV A;  5AC5 A;  5L0F A;  1FTS A;  1MMG A;  2X51 A;  4MVQ A;  4C3D A;  4WC6 A;  3C63 A;  1GQA A;  4AE4 B;  3K66 A;  9ICE A;  1RKE B;  3M15 A;  1RMV A;  3BRJ A;  3U0C A;  5HRB A;  1ZQY A;  4J7T A;  3ABK C;  2P61 A;  1YAR O;  4EHP A;  4R66 A;  1H6G A;  4YMO A;  4ER9 A;  2FMP A;  9ICW A;  4N4W A;  2I8B A;  4FHY A;  3O10 A;  3S0X A;  1MQ2 A;  4WC4 A;  1NO5 A;  1Z5Z A;  3ATP A;  7ICQ A;  3QTH A;  4KLD A;  3U8P A;  1FMW A;  8ICY A;  1RJ9 A;  3CSK A;  4YMN A;  3RVZ A;  3DM9 B;  4O6A A;  4XRH A;  5BQH A;  4FX5 A;  2J0X A;  4W8K A;  3LLK A;  4Z6D A;  4KB6 A;  2LD6 A;  3VAY A;  2DB4 A;  4CSA C;  4GXK A;  1QSP A;  4NQF A;  4K99 A;  5E3C A;  1YYX A;  1Y6D A;  4KLT A;  3DE9 A;  5KYU A;  2LCH A;  3JTL O;  2Q3T A;  4QDL A;  3GEH A;  1VK5 A;  1Q78 A;  2YLI A;  4D4N A;  4IQV A;  3ZSU A;  2X0C A;  1E84 A;  1C17 M;  3F46 A;  3AGT A;  3MCR A;  3TJ5 A;  4K0D A;  2DYS C;  1XSP A;  4JCH A;  2ZH6 A;  2QE9 A;  2XLD A;  4I2D A;  3EJN A;  2W45 A;  4WGY A;  3UMI A;  4EEB A;  1HY5 A;  1SMY F;  4NXX A;  3MYI A;  4YMM A;  7ICI A;  4CS9 C;  4EKW A;  4WBZ A;  4LDR A;  5J2D A;  3OUY B;  2DVI A;  4KNW A;  3WFQ E;  4CJG A;  3LNR A;  1BBH A;  1M6T A;  1APC A;  9ICA A;  1ZJN A;  1SR2 A;  4KC9 A;  5JP7 A;  3UNG C;  1E86 A;  1J8Y F;  3SXK A;  4KLQ A;  2A0B A;  5COF A;  2LK4 A;  4IAO A;  1KTM A;  2KQ9 A;  3US6 A;  4CS9 A;  2J45 A;  4DOA A;  4I1O B;  5AGF A;  3LS1 A;  1ZQU A;  2W4M A;  3FXH A;  4F5N A;  4NY3 A;  4NXW A;  5HRE A;  4BEJ A;  5DS4 A;  3JPO A;  2QY9 A;  3W2V A;  3N24 A;  2VH3 A;  2LSE A;  5JS5 A;  3T4R A;  4JJF A;  5DEC A;  3JPR A;  1UET A;  4YL0 A;  4AT9 B;  3SZR A;  4WOY A;  1R8C A;  5IIM A;  2WB7 A;  4M9L A;  3FAP B;  1VYI A;  3NMJ A;  1ZHY A;  2D4U A;  1ZQO A;  2EPO A;  4OAI Z;  3EG9 B;  3LNM B;  1RZT A;  2PFO A;  4HX0 A;  5BOM A;  2O9X A;  5T3T A;  4M9G A;  3F47 A;  4E7X A;  2Z15 A;  4EP7 A;  2A0U A;  2JPU A;  4ANJ A;  5HRD A;  2UUH A;  4A4A A;  5B3P A;  5DDM A;  5J0P A;  1AUE A;  3AUO A;  1R8A A;  5D46 A;  4BJ1 A;  3B0X A;  3ISC A;  1GS9 A;  1M57 C;  5DB6 A;  3RJI A;  3KH2 A;  3TFR A;  3FMS A;  4BG0 A;  1VLS A;  4PJM A;  3EZI A;  4CX9 A;  2L7A A;  4EBJ A;  4RPZ A;  3JPQ A;  3NYJ A;  1ZHZ A;  4JVS A;  4NXU A;  1LKX A;  2HHP A;  4XPY A;  4DRI B;  4F5R A;  4KLO A;  3L9D A;  8ICQ A;  4XUS A;  3JRM O;  4WBY A;  2XLE A;  3G4Z A;  3KMI A;  1D0X A;  3V7K A;  4KLJ A;  2EPL X;  3H2U A;  3NKD A;  4CBE A;  4F5P A;  1UG7 A;  7ICS A;  4NLN A;  2B4V A;  2DR8 A;  5KYW A;  5KYN A;  2R7S A;  9ICC A;  1ZZP A;  3A9C A;  3ITF A;  2JX0 A;  2BE3 A;  3AU6 A;  4N7R A;  5HSW A;  3DM5 A;  1OQC A;  1ZQN A;  4R64 A;  5JLI A;  3BEH A;  4QZ8 A;  2IUB A;  2VCA A;  5JT4 A;  1ZQC A;  4RQ4 A;  4KI2 A;  4WGZ A;  5J2F A;  4E0I A;  4NKU A;  2DI3 A;  3IQ6 A;  2GA0 A;  4LLE A;  2BPF A;  2W4B A;  5TZV A;  2J7P D;  4I2J A;  4H54 A;  1JAJ A;  5HRK A;  1PD1 A;  2HV7 A;  4EED A;  4RDA A;  7ICK A;  3TUL A;  4O9M A;  3LQC B;  2W9M A;  1ZHT A;  3ZQV A;  2BPC A;  5IY5 C;  2IYL D;  4FO1 A;  5EK0 A;  1S05 A;  3HW8 A;  3ZIB A;  2H7O A;  4MF8 A;  7ICE A;  4RQ3 A;  2ASR A;  2XRH A;  9ICQ A;  1LE4 A;  2XLM A;  4X5V A;  3NMI A;  4DVY P;  1OXB A;  3TD7 A;  1ZQA A;  1SYQ A;  4I44 A;  1A7D A;  4U5D E;  4X4V A;  3EGD B;  3I5Q A;  3RW0 A;  3M4C A;  5A6K A;  4IB4 A;  2BBJ A;  2F22 A;  1AVO B;  4M47 A;  2IXM A;  2XLO A;  2BPG A;  3MGI A;  3HWT A;  4Q5S F;  3GEE A;  5AC4 A;  3O55 A;  3RJH A;  1VJ7 A;  2YZS A;  4MVM A;  4Z9I A;  9ICL A;  5IIJ A;  3TQO A;  8ICL A;  5L3Q A;  3K7D A;  5J2E A;  2R7V A;  3U3B A;  3OGU A;  3Q7G A;  3SXM A;  1ZQV A;  3C5G A;  2ZH5 A;  9ICU A;  1HMD A;  3JYY A;  1KEJ A;  1TFW A;  4DOB A;  4RBN A;  5DQZ A;  1N1C A;  1BPX A;  3U2L A;  4X4R A;  3O6X A;  2EIL C;  5BOL A;  3RFY A;  1ZQP A;  1M2V A;  1OCZ C;  1LE2 A;  3GWL A;  4PAC A;  3R7C A;  3UXO A;  4RQ0 A;  5CI8 A;  4R65 A;  4U9E A;  5T1D B;  1CGO A;  5L3V A;  2EIJ C;  4DBQ A;  4UD4 A;  1TR2 A;  2HMZ A;  3AG3 C;  4JLX A;  1Q79 A;  4F5O A;  4BJT A;  7ICU A;  2Q66 A;  7ICM A;  8ICU A;  3KYJ A;  1TV9 A;  4I2B A;  2IM8 A;  2WL8 A;  1BR1 A;  4BJ5 C;  4M5D A;  2YEV A;  4FO6 A;  5D92 A;  1O87 A;  1ZQT A;  2GAQ A;  1ZQF A;  4QZF A;  1TFO B;  1R5I D;  5D49 A;  3Q6M A;  1MMN A;  5J2J A;  2EIK C;  2PFQ A;  2EIM C;  2YVK A;  1ZVZ A;  5J0O A;  2OJQ A;  2R7R A;  3S29 A;  4UAY A;  1O3U A;  4RQ2 A;  1H9G A;  1ZU4 A;  4RPX A;  4OIN F;  4XJE A;  4YD1 A;  5B3I A;  5III A;  3JPT A;  1JAF A;  3CAX A;  1GGQ A;  5FCL A;  2XLW A;  8ICM A;  5L0I A;  4ATB B;  3K75 D;  3S28 A;  8ICC A;  3UMK A;  5F2V O;  1XSN A;  9ICO A;  5JUA A;  2BE5 F;  4M0A A;  4YT2 A;  2NUP A;  1WGW A;  1GM5 A;  4F5Q A;  9ICS A;  1OKK A;  4OIR F;  3LK9 A;  2R7X A;  3M1C B;  1WWP A;  5CFT A;  1B68 A;  3C2M A;  3ER9 B;  3K1H A;  2ID1 A;  4UB2 A;  4XEF A;  2ZPA A;  4CJO A;  2WZG A;  2LP4 A;  2ETS A;  3EHN A;  3PCV A;  4MVZ A;  4WAB A;  3VM6 A;  4UAW A;  1W2W A;  4X4S A;  4IAQ A;  5E2Q A;  3AU2 A;  5E33 A;  5HRG A;  4FH5 A;  2V26 A;  2ZXP A;  2BCV A;  7ICH A;  1C03 A;  4QZD A;  1JR8 A;  2YWA A;  1ZQD A;  4O6M A;  9ICB A;  1RPL A;  2XL4 A;  3W8H A;  5COG A;  1TFY A;  2PFN A;  3R2P A;  1OKK D;  2OJE D;  4DVZ A;  1OCR C;  3ZC4 A;  5B3S C;  1G8X A;  3RQE A;  1Q0D A;  1TQG A;  4LER A;  9ICT A;  2NUT A;  1HUO A;  2KJG A;  2YL7 A;  3NYB A;  2YRF A;  9ICR A;  3HNI A;  3V7L A;  3M79 A;  3RIP A;  2WZL A;  4CS8 C;  9ICN A;  4JLZ A;  5J2I A;  2GDC A;  3RJJ A;  3WFO A;  3U5S A;  1A7E A;  1HE1 A;  1V54 C;  2BC5 A;  3SEO A;  1YAU O;  4I2H A;  3V5X A;  3VF0 A;  4C3B A;  3T6B A;  1G4U S;  3ZDL A;  4NXT A;  3JSZ A;  3TOM A;  5J2H A;  4JEA A;  5DS5 A;  1LPE A;  4TUS A;  2DR9 A;  1TWH A;  4R63 A;  1JQR A;  4O5K A;  2GAF D;  1U89 A;  3RH3 A;  2EPK X;  3C66 A;  5D91 A;  3DJN B;  3QMK A;  3PML A;  4O6Y A;  4ATB A;  2Y3B A;  1VTM P;  2A6E F;  3AOU A;  3UXN A;  1M56 C;  3NRH A;  3U3F A;  4MTG A;  1Q0M A;  3C62 A;  1Y4C A;  1TWA A;  5CP2 A;  4UAZ A;  3MX3 A;  1K04 A;  4XQ1 A;  2DR7 A;  3AQN A;  9ICP A;  1WOT A;  1R4T A;  3ZWI A;  2LQG A;  4O6N A;  3QW0 A;  4QI2 A;  5T3W A;  3E9V A;  4KLE A;  3WFS C;  3L8I A;  4XWJ A;  2QTV A;  4IJJ A;  3JPP A;  2DRA A;  1FAP B;  1RCP A;  4I0U A;  4XLP F;  2BCU A;  3S9O A;  3FOO A;  4S3N A;  1YVI A;  2R02 A;  3ABM C;  1ZW3 A;  3G4X A;  1I4Y A;  4O5C A;  4QZ9 A;  3GM2 A;  2I15 A;  3OA1 A;  3IPM O;  2GA9 D;  1D1B A;  3NKU A;  2IXO A;  1JMS A;  4TUR A;  4M9N A;  2FMS A;  1RKC A;  3JPS A;  8ICN A;  2KNH A;  3C2L A;  1QKR A;  2RFF A;  4UB5 A;  3Q7L A;  2IBF A;  4MS2 A;  4QZC A;  2CGE A;  5BQG A;  1T6Q A;  4P6I C;  4ZLD A;  2C04 A;  1RXQ A;  3OVB A;  3OEO A;  4JCZ A;  5DVW A;  1YZA A;  4G7O F;  4CS8 A;  4LAC B;  1A7V A;  5IIK A;  2KC3 A;  1S7Z A;  5TJ5 E;  2OU6 A;  3B71 A;  5J0W A;  5DBB A;  4XEV A;  2ZD9 A;  3GM1 A;  3HIY A;  2AWC A;  2RSE B;  3AQK A;  3DAG A;  3HJ4 A;  2HV6 A;  1ZQK A;  3H39 A;  4XPW A;  2XS8 A;  5B1A C;  2J9U A;  4NC3 A;  2ZXO A;  2Q4F A;  4YK5 A;  1F5A A;  4U9D A;  3WOD F;  3JCF A;  3FDQ A;  1T9K A;  4XQ8 A;  3L0I A;  3ZTM A;  1Q0F A;  5DBC A;  1OR2 A;  1V4A A;  4CDV A;  2IHM A;  2FAP B;  2NPU A;  3WG7 C;  4N6H A;  4RD9 A;  2AWY A;  3TJ6 A;  4E8F A;  4E7S A;  2VC9 A;  3NWI A;  4X4T A;  3GAN A;  2ZH3 A;  4I2F A;  4NLZ A;  5KYY B;  4AX2 A;  1NG1 A;  5F28 E;  4KLL A;  4PJL A;  4BPM A;  4MFC A;  4AL0 A;  1L3P A;  2PXI A;  2V3C C;  4CSA A;  2J46 A;  4LDQ A;  5B3Q A;  4N6C A;  2HZ8 A;  4AL1 A;  1YJG A;  4K7B A;  1OCC C;  1R89 A;  1Z63 A;  3V72 A;  4P2H A;  4UB3 A;  3PHF 2;  4QI0 A;  3OWG A;  2ZH4 A;  5EGY A;  4E7Z A;  2ISO A;  3RJG A;  4NTA A;  3DZA A;  1NU9 C;  2ZH2 A;  4U5C E;  2B51 A;  4RQ5 A;  5CB1 A;  1ZQE A;  3UGP A;  4I2E A;  3N2Z B;  4J30 B;  2ZXW C;  3DD7 A;  3NDB B;  2JD3 A;  2YKZ A;  4Z9J A;  3W8I A;  4PR9 A;  3EZH A;  5E3A A;  4KLG A;  8ICI A;  4JTC B;  3VRC A;  2MWQ A;  1MIV A;  4HEA J;  2IXP A;  4EIY A;  2FCL A;  2HSQ A;  3EFO B;  1XZQ A;  4YL1 A;  3TFS A;  4BJ5 A;  2XL6 A;  3AQC A;  3LEO A;  3ERC C;  4FWV A;  3JRT A;  1JPJ A;  4JJG A;  2ZH7 A;  1T6I A;  4MW8 A;  2CNW A;  4FHW A;  4AK9 A;  4GXI A;  4TUP A;  4P4P A;  1ZQG A;  4ULV A;  2H7V C;  4WC2 A;  3ZVR A;  4NM2 A;  4WC5 A;  1I5N A;  1XWJ A;  1MMD A;  4KLM A;  2G62 A;  3MYF A;  5HHH A;  4K9B A;  1IZM A;  3RQG A;  2L6F A;  3IQT A;  1ZQH A;  3UXP A;  3I4U A;  1ORJ A;  3JCU Q;  1EA8 A;  1OW6 A;  2CW0 F;  4U5B E;  2XM4 A;  2YLG A;  3B29 A;  5CR0 A;  1UEU A;  1K05 A;  3RJF A;  4RQ8 A;  8ICP A;  5DLJ A;  1OXK A;  3L8J A;  3SXY A;  4P4O A;  4Z6C A;  2J9V A;  1PCX A;  3ZTZ A;  4CS7 A;  4KLH A;  256B A;  4HFK B;  3POV A;  3FAJ A;  5J0S A;  5EOZ A;  4OIP F;  5L0G A;  5J0U A;  3RH4 A;  2W9Y A;  4LLC A;  1XSL A;  3NG1 A;  3OVS A;  4DRJ B;  5FZT A;  1QZX A;  4YWQ A;  1YZC A;  7ICO A;  4ONS A;  4C7O B;  5IIL A;  2BCR A;  1G5Z A;  2R03 A;  2KSF A;  4HE8 D;  5HV9 A;  4MFF A;  1WAT A;  3MLG A;  5BQI A;  3X1O A;  3HNK A;  4D4X A;  3FOP A;  3T6G B;  4O69 A;  4KM5 A;  1D1C A;  2NUP B;  3H37 A;  4WQL A;  2WVQ A;  7ICV A;  3AGU A;  1HMO A;  2R7O A;  4KLF A;  4K97 A;  4DBR A;  4LVS A;  1UFB A;  2I9G A;  2M4E A;  4DXW A;  1ZQM A;  1HE9 A;  4RQ1 A;  2Y3D A;  1A41 A;  4BEM J;  3ASO C;  4WQK A;  3NYL A;  1JN3 A;  5A69 A;  5J2C A;  5J0T A;  2E87 A;  3DMD A;  3PMN A;  4K1O A;  4Z9H A;  4JZA A;  3X2Q C;  2NUT B;  1H7I A;  1FFH A;  3B0V C;  1ZQW A;  3EPV A;  8ICB A;  3TOL A;  2YL3 A;  3QVZ A;  4NKT A;  4L6R A;  3OUY A;  1J8M F;  5DDY A;  5J2A A;  4BJ6 A;  1EKY A;  4YT4 A;  2OOC A;  4MKP A;  1EI7 A;  4YCX A;  4O68 A;  3V7O A;  7ICN A;  2AP3 A;  9ICJ A;  3L34 A;  2XL8 A;  4FHP A;  5J2K A;  3U8V A;  3KYI A;  2XS1 A;  3K6B A;  8ICO A;  5BPC A;  4KLU A;  3OWT A;  4YJW A;  4KNV A;  5D63 A;  1ZQX A;  4OAG A;  1NSG B;  9ICI A;  3RVY A;  3UPQ A;  4K4I A;  1T6U A;  1EQ1 A;  3C18 A;  5CFS A;  5DQT A;  4UBB A;  2HMQ A;  5D4B A;  4EGW A;  4JC7 A;  1WTY A;  4JKV A;  4XEK A;  1QQ3 A;  4MVS A;  1LS1 A;  3GEI A;  2G3V A;  4MW3 A;  4K8V A;  4TUQ A;  3S27 A;  2A1D D;  3KKB A;  4MQ9 F;  3V5Z A;  5J0R A;  8ICJ A;  3WFR E;  5K0I A;  3H3A A;  4OAF A;  2CCY A;  3ISD A;  2OQM A;  4OD5 A;  2BBH A;  4YN0 B;  4U5G A;  3ASN C;  8ICF A;  4JW1 A;  3RQF A;  1ZQR A;  4E18 A;  3GWN A;  4NXV A;  3UQ0 A;  1ZU5 A;  7ICP A;  4RPY A;  4BJ6 C;  3HKK A;  1JPN A;  2LFD A;  2M2T A;  4RQ7 A;  1L7C A;  4AE4 A;  2O1P A;  2VAN A;  5J0Y A;  1WOL A;  4RQ6 A;  2P0N A;  4IAR A;  3LLI A;  8ICH A;  1QLE C;  4K96 A;  2DYR C;  1ZHW A;  3ER8 C;  4U5E E;  4LDK A;  8ICR A;  1FFT C;  1VYK A;  4JTA B;  1G4W R;  7ICJ A;  4XTK A;  2P66 A;  4I29 A;  1RKE A;  2YL0 A;  2NSF A;  1FA0 A;  3E70 C;  1NZE A;  3NYM A;  1BR2 A;  5CIV A;  3HLZ A;  2OKU A;  1VFG A;  2Y3H A;  3PMR A;  1NFN A;  3B0P A;  2B56 A;  4K4G A;  2R7W A;  4E0H A;  3B0U X;  1NU7 D; 
#chains in the Genus database with same CATH homology
 3C2L A;  3H38 A;  3MFN A;  4EBJ A;  2RFF A;  5CJ7 A;  4RPZ A;  4UB5 A;  3JPQ A;  3V7J A;  4QZC A;  4QZE A;  3MDC A;  1OW7 A;  4I2A A;  7ICL A;  2HHP A;  3MBY A;  4F5R A;  4KLO A;  3L9D A;  1K40 A;  3OVB A;  8ICQ A;  4XUS A;  4WBY A;  4M2Y A;  1R8B A;  3HX0 A;  8ICS A;  5IIO A;  1MIY A;  5DB7 A;  3PNC A;  5IIK A;  3RH6 A;  3V7K A;  1UEV A;  4KLJ A;  9ICV A;  3B71 A;  4F5P A;  5J0W A;  4WC0 A;  5DBB A;  7ICS A;  4XA5 A;  2ZHA A;  4UB4 A;  4NLN A;  4XEV A;  2DR8 A;  7ICT A;  4RT3 A;  3GM1 A;  3HIY A;  3RJK A;  2HSB A;  3AQK A;  5HRI A;  9ICC A;  3HJ4 A;  1ZQK A;  3H39 A;  3HJ1 A;  7ICR A;  4RWQ A;  4IQT A;  1ZZP A;  2JX0 A;  1F5A A;  2DRB A;  2NRK A;  4QZG A;  4XQ8 A;  2BE3 A;  4NM1 A;  3AU6 A;  4LZG A;  5DBC A;  3GM3 A;  4PHD A;  9ICG A;  1V4A A;  4NXZ A;  2IHM A;  4QZB A;  2L6H A;  2KK1 A;  1ZQN A;  4R64 A;  4X4Q A;  4PGY A;  4X0A A;  4QZ8 A;  4Z6E A;  1ZQC A;  4E8F A;  4RQ4 A;  4YD2 A;  2Q00 A;  4X4T A;  5J2F A;  1QVX A;  2ZH3 A;  3C5F A;  4DOC A;  4I2F A;  4NKU A;  4NLZ A;  2ZHB A;  3ISB A;  2BPF A;  5F28 E;  4KLL A;  5TZV A;  3GDX A;  4MFC A;  9ICK A;  4O5E A;  4I2J A;  2PXI A;  1JAJ A;  5HRK A;  5HRL A;  1HUZ A;  4LZD A;  9ICM A;  1R89 A;  3OVA A;  3V72 A;  4P2H A;  7ICK A;  3TUL A;  4UB3 A;  8ICE A;  4O9M A;  3LQC B;  2W9M A;  2ZH4 A;  2BPC A;  4AT7 B;  1PV3 A;  2M2W A;  2ISO A;  3RJG A;  3HW8 A;  5CHG A;  4MF8 A;  7ICE A;  4RQ3 A;  2ZH2 A;  2M2V A;  4I2G A;  4FHX A;  9ICQ A;  4RQ5 A;  5CB1 A;  8ICA A;  4AT9 A;  4WCW A;  1ZQE A;  4I2E A;  8ICT A;  2M2U A;  4X5V A;  1ZQQ A;  4IQW A;  5IIN A;  2L6G A;  3AQM A;  1ZQA A;  4AT8 A;  4YN4 A;  4X4V A;  4KLG A;  5CA7 A;  1TVA A;  8ICI A;  1BPE A;  1MIV A;  3C8G D;  1NOM A;  4PHP A;  4M47 A;  7ICG A;  3TFS A;  1BPZ A;  2BPG A;  3MGI A;  3HWT A;  4IG8 A;  8ICW A;  3RJE A;  5J0X A;  2ZH7 A;  3RH5 A;  2ISP A;  9ICF A;  4FHW A;  8ICV A;  8ICK A;  1MQ3 A;  4GXI A;  3RJH A;  4EBK A;  4TUP A;  1VJ7 A;  9ICL A;  4P4P A;  1ZQG A;  1KDH A;  4WC2 A;  5IIJ A;  8ICL A;  4WC1 A;  4I28 A;  3K7D A;  5J2E A;  3OGU A;  4JWM A;  3C2K A;  4NM2 A;  3C8G B;  1ZQV A;  5J2G A;  1ZQS A;  4RWO A;  3C5G A;  4WC5 A;  2ZH9 A;  2ZH5 A;  9ICU A;  4KLM A;  3JYY A;  3C8G A;  1KEJ A;  1TFW A;  4DOB A;  4QZA A;  5HHH A;  8ICG A;  9ICH A;  3RQG A;  5DB9 A;  2L6F A;  5HRH A;  1ZQH A;  3UXP A;  1JOG A;  3AJM A;  1ZJM A;  4MFA A;  1BPX A;  4X4R A;  1OW6 A;  4K4H A;  4IQU A;  5BOL A;  1OU5 A;  5CR0 A;  1UEU A;  4NLK A;  1K05 A;  1ZQP A;  2PFP A;  3RJF A;  1ZQZ A;  2ZH1 A;  1PX5 A;  4UB1 A;  4Z6F A;  4RQ8 A;  3UPS A;  8ICP A;  3UXO A;  4RQ0 A;  4PGQ A;  3L8J A;  4RWP A;  1BPY A;  1ZQI A;  4P4O A;  4R65 A;  3B0Y A;  4Z6C A;  5HHI A;  4M04 A;  4MF2 A;  4AT7 A;  4KLH A;  4UD4 A;  3MGH A;  1Q79 A;  9ICX A;  4F5O A;  7ICU A;  5J0S A;  2Q66 A;  7ICM A;  4WC6 A;  8ICU A;  1TV9 A;  5J0Q A;  4I2B A;  9ICE A;  5EOZ A;  4M5D A;  4FO6 A;  8ICX A;  3BRJ A;  4PPX A;  1ZQT A;  5J0U A;  3U0C A;  1ZQJ A;  1ZQF A;  3RH4 A;  4QZF A;  5HRB A;  1ZQY A;  2BCQ A;  1XSL A;  5D49 A;  3OVS A;  5J2J A;  2PFQ A;  5J0O A;  4R66 A;  7ICO A;  4NY8 A;  4UAY A;  4YMO A;  2BCR A;  1O3U A;  5IIL A;  2FMP A;  4RQ2 A;  9ICW A;  4FHY A;  3O10 A;  5DB8 A;  4RPX A;  4QZH A;  4PGX A;  3AQL A;  4YD1 A;  5III A;  4PH5 A;  5HR9 A;  3JPT A;  1MQ2 A;  4MFF A;  4WC4 A;  1NO5 A;  7ICQ A;  8ICM A;  4KLD A;  4X4U A;  4ATB B;  3K75 D;  8ICC A;  8ICY A;  5F2V O;  1BPD A;  1XSN A;  4PHA A;  4YMN A;  9ICO A;  3H37 A;  4M9J A;  7ICV A;  4GXJ A;  4M0A A;  4WC7 A;  4XRH A;  4F5Q A;  9ICS A;  3LK9 A;  5DKW A;  4KLF A;  4Z6D A;  4LVS A;  1WWP A;  4KLI A;  1UFB A;  2I9G A;  7ICF A;  3C2M A;  1ZQM A;  4UB2 A;  2ID1 A;  4XEF A;  4RQ1 A;  4GXK A;  4NQF A;  4UBC A;  1JN3 A;  5J2C A;  4UAW A;  5J0T A;  4X4S A;  2BCS A;  4KLT A;  4X0B A;  3PMN A;  3AU2 A;  5HRG A;  2DR5 A;  4FH5 A;  1Q78 A;  4QZI A;  1ZQW A;  2BCV A;  8ICB A;  7ICH A;  4QZD A;  4NKT A;  4AT8 B;  3OUY A;  8ICZ A;  4IQV A;  2YWA A;  1ZQD A;  5J29 A;  9ICB A;  1RPL A;  5DDY A;  5J2A A;  1TFY A;  2PFN A;  4YCX A;  1XSP A;  7ICN A;  3RQE A;  2ZH6 A;  4DO9 A;  4I2D A;  4I2C A;  9ICJ A;  4I2I A;  4FHP A;  5DED A;  5J2K A;  9ICT A;  1HUO A;  1ZQL A;  8ICO A;  5DBA A;  3NYB A;  5BPC A;  4KLU A;  9ICR A;  2PBE A;  5HC9 A;  1ZQX A;  2FMQ A;  4YMM A;  3V7L A;  7ICI A;  4X4N A;  4WBZ A;  3UQ2 A;  9ICI A;  3UPQ A;  5J2D A;  4K4I A;  3OUY B;  9ICN A;  2DVI A;  4R32 A;  5J2I A;  3RJJ A;  3C18 A;  3WFQ E;  3WFO A;  1KNY A;  4UBB A;  5D4B A;  4WC3 A;  3JPN A;  4I2H A;  3MDA A;  9ICA A;  1WTY A;  1ZJN A;  4I27 A;  4XEK A;  2GWS A;  4KLQ A;  4TUQ A;  2LK4 A;  5J2H A;  1KTM A;  5J0R A;  4X4P A;  8ICJ A;  3WFR E;  1YLQ A;  4DOA A;  3H3A A;  4TUS A;  3OV7 A;  1ZQU A;  2DR9 A;  4R63 A;  4LT6 A;  4F5N A;  3ISD A;  1JQR A;  4O5K A;  5HRE A;  8ICF A;  5J2B A;  3JPO A;  3RQF A;  3C66 A;  1ZQR A;  3PML A;  5DEC A;  3JPR A;  1UET A;  3UQ0 A;  2ZH8 A;  4ATB A;  4AT9 B;  7ICP A;  4RPY A;  3UXN A;  3U3F A;  2M2T A;  4M9H A;  3JZ0 A;  4RQ7 A;  5CWR A;  2O1P A;  2VAN A;  5CP2 A;  1WOL A;  5J0Y A;  4UAZ A;  1R8C A;  4RQ6 A;  4E80 A;  1K04 A;  4X4O A;  5IIM A;  2DR7 A;  4M9L A;  4FHV A;  3AQN A;  9ICP A;  1WOT A;  8ICH A;  8ICR A;  4KLE A;  1ZQO A;  3WFS C;  3L8I A;  4FH3 A;  1ZQB A;  1RZT A;  3WFP A;  1BPB A;  4UD5 A;  7ICJ A;  2PFO A;  1OW8 A;  4JWN A;  3JPP A;  2DRA A;  2P66 A;  4XQ7 A;  5BOM A;  1MIW A;  4I29 A;  1FA0 A;  2BCU A;  4M9G A;  3S9O A;  4E7X A;  4S3N A;  4RWN A;  4EP7 A;  2JPU A;  4O5C A;  5HRD A;  1VFG A;  4QZ9 A;  4PHE A;  5DDM A;  4RT2 A;  3GM2 A;  5J0P A;  3AUO A;  1R8A A;  5D46 A;  1JMS A;  4KLS A;  4TUR A;  4M9N A;  5HRF A;  3B0X A;  3ISC A;  2FMS A;  4K4G A;  5DB6 A;  2O5A A;  4P4M A;  3RJI A;  3TFR A;  3JPS A;  8ICN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...