3JZ0A

Linb complexed with clindamycin and ampcpp
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
266
structure length
266
Chain Sequence
LKQKELIANVKNLTESDERITACMMYGSFTKGEGDQYSDIEFYIFLKHSITSNFDSSNWLFDVAPYLMLYKNEYGTEVVIFDNLIRGEFHFLSEKDMNIIPSFKDSGYIPDTKAMLIYDETGQLENYLSEISGARPNRLTEENANFLLCNFSNLWLMGINVLKRGEYARSLELLSQLQKNTLQLIRMAEKNADNWLNMSKNLEKEISLENYKKFAKTTARLDKVELFEAYKNSLLLVMDLQSHLIEQYNLKVTHDILERLLNYISE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lincosamide nucleotidyltransferase
publication title Structure and mechanism of the lincosamide antibiotic adenylyltransferase LinB.
pubmed doi rcsb
source organism Enterococcus faecium
molecule tags Transferase/antibiotic
total genus 106
structure length 266
sequence length 266
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 3jz0A02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 3jz0A01
4NKTA 4WBZA 4WC4A 1K40A 4RQ2A 3HX0A 4NM1A 3GDXA 4JWMA 4NY8A 1ZQHA 7ICUA 1UETA 1ZQQA 4FHWA 1ZQFA 2DRBA 4I27A 5J0YA 4KLEA 4FHPA 4WCWA 2KK1A 4EP7A 2DR9A 5J0PA 8ICHA 3GM3A 4QZFA 3C5FA 4RQ0A 3H3AA 1RPLA 2ZH3A 4F5PA 5CJ7A 5IINA 1ZQNA 8ICGA 9ICLA 5CP2A 3RH5A 1OW7A 3JPSA 4PGYA 1HUZA 4I2IA 5IIOA 5BOMA 4UAYA 2JPUA 4QZCA 3JZ0A 4KLSA 5CHGA 3L9DA 5CB1A 5J2DA 4UB2A 4QZGA 9ICRA 3AQNA 4YMNA 7ICEA 4KLQA 5J2IA 2Q00A 4PGQA 4AT9A 4YD1A 1O3UA 5DB8A 4F5QA 1UFBA 1R8BA 5J0QA 1QVXA 3L8JA 3S9OA 2BPCA 3RJEA 2FMSA 4RPZA 9ICBA 3RQFA 9ICTA 4LZDA 3OVSA 1KEJA 3UXNA 3UPSA 4X0BA 3C2KA 3PNCA 3NYBA 1XSLA 3GM1A 2BPGA 4QZ8A 9ICGA 5DECA 4P4OA 8ICXA 3U0CA 3UXPA 1ZQGA 4QZAA 4E80A 4QZBA 9ICSA 5J2FA 1KTMA 4I2GA 4FHVA 3C66A 8ICUA 4LT6A 4X4QA 4XEFA 3AJMA 9ICUA 4S3NA 3AU2A 9ICVA 9ICOA 1R89A 4NM2A 3JPRA 5DBAA 3HWTA 2HSBA 4F5NA 9ICKA 5J0OA 4FHXA 1R8AA 8ICPA 4UD5A 3UPQA 4YMOA 4KLIA 4F5RA 3RH4A 3WFSC 4RQ4A 5J0RA 5BPCA 1JAJA 7ICSA 3JYYA 2ZHAA 3V7JA 3LQCB 2NRKA 4P4MA 2O1PA 1F5AA 3MFNA 4XEKA 3RJGA 2L6FA 3AU6A 5DB7A 7ICHA 9ICCA 9ICXA 5D46A 3V72A 4IG8A 1ZQJA 4XA5A 4YN4A 4RT2A 1MQ3A 1PV3A 2M2WA 3MGHA 2ZH8A 1R8CA 3PMNA 4MF2A 4UAZA 1ZQDA 5TZVA 1OW6A 9ICPA 4WC0A 1MQ2A 4XQ8A 4I28A 4MFFA 1RZTA 4TUQA 4WC5A 1VFGA 3C8GA 4NLKA 9ICQA 7ICJA 4TURA 4KLGA 2BCRA 4UB4A 2ISOA 5F2VO 5IIJA 4GXIA 4AT7A 5DDMA 4X4SA 5J0WA 2M2TA 5J29A 7ICGA 3K7DA 4X4RA 4LZGA 7ICMA 5IIMA 4I29A 7ICFA 4K4GA 2BCQA 2BE3A 7ICIA 2W9MA 4RQ5A 1ZJMA 1HUOA 2BPFA 1YLQA 3ISCA 1ZQAA 9ICEA 4F5OA 8ICMA 2FMQA 1UEVA 4Z6DA 3MDAA 1ZQZA 2ID1A 8ICIA 2DVIA 8ICTA 4KLOA 1ZQRA 4O5EA 4M2YA 3RH6A 3ISDA 4UB1A 1ZQYA 5HR9A 4I2AA 5D49A 4KLJA 3OV7A 4XUSA 4I2BA 4P2HA 1ZQTA 4RQ3A 2ZH1A 1BPZA 1ZQMA 9ICIA 8ICVA 3K75D 1V4AA 2DR8A 7ICNA 2PXIA 3OVAA 4KLDA 5HRHA 4KLTA 2VANA 5J0SA 5J2BA 3TFRA 3V7LA 4O5KA 3RJHA 4IQVA 4X4OA 4AT9B 1ZQBA 3H37A 1ZQKA 8ICJA 2BCVA 1BPEA 3MDCA 4I2JA 3C8GD 5J0TA 4X4NA 3RJKA 3MGIA 4K4HA 4IQTA 1UEUA 1K05A 4RQ6A 1BPBA 1OW8A 4XQ7A 4FH3A 1OU5A 2RFFA 5HRGA 2DR7A 4PH5A 4EBKA 3GM2A 1ZQCA 4DOBA 2M2VA 5HREA 3AUOA 3HJ4A 4O9MA 2PFOA 4KLUA 3BRJA 2ZH6A 1MIWA 1KDHA 1ZQWA 1MIYA 4RPXA 1ZQIA 4QZHA 3OUYA 3RJIA 2PFPA 4O5CA 1BPXA 5HRLA 3RQEA 4WC2A 1NO5A 4AT8A 2LK4A 4Z6CA 4ATBB 8ICKA 4RQ7A 4KLFA 4GXKA 4RQ1A 4FHYA 4GXJA 1ZQEA 7ICLA 7ICVA 1WTYA 4R66A 1Q79A 2YWAA 2FMPA 4KLLA 4FO6A 2P66A 5DB6A 5DB9A 4RWQA 4MFAA 4M47A 3UQ2A 1TFWA 3C2MA 4R64A 4DOAA 3V7KA 5IILA 4WC3A 8ICZA 1TV9A 2I9GA 9ICNA 2HHPA 4M04A 5EOZA 4QZEA 4M9LA 5J2JA 5HRDA 3C18A 1KNYA 2ZH5A 3RQGA 4QZ9A 9ICMA 4DO9A 2ZH4A 5DEDA 1ZQVA 4WC7A 4X4UA 8ICAA 9ICFA 3B71A 4NLZA 4M9HA 3C8GB 4RWOA 1ZJNA 4X4PA 5J0UA 2BCSA 1VJ7A 4WC1A 5J0XA 2ISPA 3MBYA 5IIKA 2PFNA 1ZZPA 1WWPA 4I2HA 5CA7A 1ZQPA 5J2KA 4Z6FA 4RWPA 4MF8A 5HHHA 7ICPA 8ICLA 4M9NA 7ICOA 8ICEA 4PPXA 8ICQA 4I2EA 1XSNA 3B0XA 2M2UA 2JX0A 5J2GA 4IQUA 1WOTA 2Q66A 3HIYA 4WBYA 3O10A 4M5DA 3TFSA 3HJ1A 9ICAA 1ZQSA 4KLMA 4UB5A 1TFYA 1NOMA 3UXOA 4RPYA 1ZQLA 5BOLA 4UBBA 4M9JA 7ICRA 4PHAA 2O5AA 3HW8A 2PBEA 4WC6A 5J2CA 3H38A 4LVSA 4YMMA 5DKWA 1ZQUA 4X0AA 3PMLA 5HRFA 9ICHA 1JQRA 8ICWA 1JN3A 4XRHA 2DR5A 4I2DA 4UB3A 4KLHA 8ICRA 4I2CA 3WFRE 8ICSA 1WOLA 4X4TA 2GWSA 7ICKA 4K4IA 1ZQOA 5HRBA 3L8IA 5F28E 9ICWA 4M9GA 3H39A 1K04A 4UBCA 5CR0A 3C2LA 4PGXA 4UAWA 2IHMA 4R32A 1PX5A 3WFPA 4NLNA 9ICJA 2ZH7A 4TUPA 4X4VA 1TVAA 5HC9A 4PHDA 4M0AA 3JPTA 2ZHBA 4X5VA 8ICCA 3LK9A 3AQMA 3OUYB 2DRAA 4EBJA 1MIVA 4RQ8A 8ICOA 3UQ0A 4NQFA 4UD4A 5DBCA 5J2HA 1BPYA 3U3FA 3AQLA 4FH5A 4AT8B 4Z6EA 4XEVA 5HRKA 4YD2A 3AQKA 5J2EA 4E8FA 4QZDA 3OGUA 5IIIA 7ICTA 4ATBA 5HHIA 4YCXA 1BPDA 5D4BA 4PHEA 3JPQA 5DBBA 4DOCA 4RT3A 2BCUA 4R63A 8ICBA 4NKUA 5HRIA 3JPNA 4P4PA 4E7XA 4TUSA 3WFQE 8ICFA 1ZQXA 1Q78A 4NXZA 3TULA 4QZIA 4PHPA 4RWNA 3WFOA 3JPOA 3B0YA 2ZH9A 2ZH2A 4MFCA 2PFQA 1XSPA 8ICNA 3RJJA 2L6HA 4JWNA 8ICYA 2L6GA 1FA0A 1JOGA 7ICQA 5J2AA 4I2FA 4R65A 3OVBA 3C5GA 4IQWA 5CWRA 5DDYA 3RJFA 4AT7B 3JPPA 3ISBA 1JMSA
chains in the Genus database with same CATH superfamily
5A6BA 2OJQA 1HW2A 4WBZA 1E85A 3TJ6A 5B1AC 2G3VA 4CBEA 5B3QA 4I1OB 4CS9C 2YRFA 7ICUA 1ORJA 2Q3TA 2GWWA 2HV7A 3B0UX 4I27A 4FHPA 3VRCA 1OXKA 5DS6A 4J7YA 2KK1A 4WCWA 4EP7A 3ECSA 2A68F 8ICHA 2VC9A 3C5FA 3UR3C 5CI9A 1RPLA 3DXJF 2ZH3A 2UUHA 8ICGA 2HMQA 1HUZA 2P6VA 1AVOB 3NKUA 1I5NA 2XLVA 1NU7D 3JZ0A 3G4XA 5JP7A 1VK5A 2GFHA 4J32B 4WQLA 5CB1A 4MS2A 2XLMA 9ICRA 2R25A 4YMNA 5J2IA 3LJBA 2Q00A 2CGEA 3V5XA 4CS9A 5F5FA 1UFBA 1YJGA 3T9OA 2R05A 4Q5SF 3S9OA 3S28A 4MVMA 4E18A 9ICBA 4LZDA 3OVSA 3EFOA 4JJGA 5AC4A 3UPSA 3NYBA 3ZWIA 2BPGA 3K33A 4P4OA 8ICXA 3AG4C 1ZQGA 3RVYA 4QZBA 1LS4A 5KYXB 1FTSA 2J7PA 3MLGA 4U5EE 2ZXWC 3HNIA 2B0JA 2EINC 4LT6A 3VAYA 5A69A 3U9JA 3PMRA 4XEFA 2HMZA 1YZCA 2J8WA 3HWTA 2NSGA 3WAQA 4MTOA 2XM4A 4FHXA 3U2MA 2CW0F 3HNJA 4YT2A 4UD5A 4YMOA 5BPCA 3IQTA 4MTGA 2W9YA 3N2ZB 1F5AA 2ICWG 4XEKA 2Z15A 1CGNA 3RJGA 9ICXA 5D46A 3V72A 1Z5ZA 2VASA 4JIOA 4CX9A 4RT2A 2R02A 1Q0DA 5E3CA 2J45A 3PMNA 4MF2A 1ZQDA 4I44A 2ZXRA 4XQ8A 2KJGA 4MFFA 4TUQA 3N0TA 1KU2A 1WN0A 1E83A 4NLKA 9ICQA 7ICJA 4KLGA 3HNLA 3T6BA 2ISOA 5IIJA 4GXIA 5DDMA 3S0XA 5J0WA 2F22A 4X4SA 2J7PD 4M63A 4MVOA 3K7DA 4O7GA 4X4RA 1ZU5A 4BPMA 4JCHA 1ZJMA 1T6IA 2XM0A 2BPFA 2OCCC 8ICMA 2NUPB 3O6XA 4JEBA 1EQ1A 3MDAA 2ID1A 2Y3DA 4YN0B 2HJMA 2OEVA 4JW1A 2ZXPA 3PCVA 3DD7A 1ZQRA 4I2AA 1ZQYA 5HR9A 4I2BA 5FZTA 4WABA 2R7QA 1ZQMA 1D0XA 4JKVA 5CHEA 2P61A 4JURI 5J2BA 3V7LA 4K98A 2WB7A 4MVUA 4X4OA 4AT9B 2VCCA 1ZQBA 1BZ4A 4W8PA 4YT8A 4G7HF 3NMJA 3T6JA 2DYSC 4QI0A 4X4NA 3MGIA 2BE5F 2HFIA 3AQCA 4D4XA 1BPBA 1OCRC 3B0VC 3DM5A 1OW8A 4FH3A 2LCHA 2RFFA 4WJ0A 4Z9JA 1APCA 5CI8A 4PACA 4DOBA 2M2VA 4I0UA 2XL8A 1KDHA 5KYNA 1MIYA 2G3KA 1ZHWA 4AE4B 1YLMA 2J9VA 4ULWA 1LS1A 4RDAA 4RQ7A 4KLFA 4LLEA 4HX0A 1WTYA 4R66A 1NZEA 2TMVP 4FO6A 5DB6A 1PD1A 4CSAC 2WVQA 4RWQA 4M47A 3DWWA 1TFWA 1YAUO 2XLDA 2KW3C 2I9GA 9ICNA 4O68A 3Q7GA 3UMIA 3KYJA 1KNYA 4QZ9A 1OXBA 4BJ6A 2FAPB 3IQ6A 1GPJA 4IRUA 3C8GB 4MQ9F 3K1IA 1A7EA 3KMIA 5IIKA 2PFNA 3EGDB 1ZZPA 1WWPA 4FESA 5J2KA 4C7OB 3JCFA 5HHHA 1SF8A 4DJ9A 1AEPA 4JTDB 7ICOA 4I2EA 3B0XA 1PD0A 5JSLA 3MCRA 1NG1A 3JRTA 4M5DA 3LLKA 1RMVA 2H7OA 1TFYA 4RPYA 3UXOA 2YZSA 7ICRA 4ONSA 4OIPF 2YHSA 2PFDA 3CAXA 5J2CA 3CZ6A 3U8PA 4K8VA 4XLPF 4YMMA 1QZXA 5TJ5E 2XLEA 5HRFA 4XRHA 5D91A 4KLHA 1WOLA 7ICKA 3PHZA 1ZQOA 1U89A 3SXZA 1NBBA 2EPNA 3L8IA 4HE8D 1A7VA 4H54A 2A6EF 2W4MA 5CR0A 1H9TA 4R32A 5KYXA 3WFPA 4N4WA 1ORYA 5DS4A 1Z7Qc 4X4VA 1HY5A 2YL3A 5KYUA 4PJJA 1RJ9A 4M0AA 1LKXA 4LLCA 2ZHBA 3AQMA 2DRAA 4EBJA 1GM5A 2V3CC 3UQ0A 1OKKD 4K97A 3AQLA 3JCUQ 4AT8B 4Z6EA 4E8FA 4QZDA 4ATBA 1OQCA 1Q0FA 2FGYA 5D4BA 4NC3A 5L0CA 4XPWA 5DBBA 3B0PA 3JPNA 4P4PA 3JTLO 4D4NA 4E7XA 1ZQXA 4AK9A 2R7SA 4UDVA 4MW8A 3AGUA 1YDIA 4U5DE 5FCLA 4OD4A 2QTVA 3B0YA 2ZH2A 4JZAA 4U9EA 2PFQA 1JPJA 1RKCA 8ICNA 5L3QA 4AL0A 3WG7C 1TWHA 2KC3A 4I2FA 1C17M 1D1CA 3JPPA 3ASNC 1JMSA 3B9QA 5DQTA 1K40A 4P9FA 4NM1A 4JWMA 4NY8A 3R2PA 4U9DA 1UETA 4FHWA 1ZQFA 2DRBA 4AX2A 4K0DA 1LVKA 2NUPA 2FFHA 1WASA 2YLIA 3E70C 1IZMA 2LIGA 5KYWB 5CIVA 5JLIA 5CJ7A 3NWIA 3UMKA 1ZQNA 2EPKX 4G0HA 1OW7A 3JPSA 3ZC4A 4KNVA 2JPUA 1VTMP 1V54C 4O67A 5J2DA 4UB2A 1SZIA 3EPVA 5JT4A 3S84A 4YT5A 2R9RB 7ICEA 4KLQA 5AGFA 3L34A 3FMSA 4PGQA 4AT9A 4YD1A 4F5QA 5DB8A 1QLEC 5T3WA 3UGOA 5E2QA 5J0QA 3RJEA 2LFDA 3AG2C 4JLXA 3A9CA 1D1AA 3RQFA 9ICTA 3KYIA 4HEAJ 3C2KA 3PNCA 9ICGA 3Q6MA 4U5FE 1V55C 1Y6DA 2XLWA 1KTMA 4BJ5C 2A69F 3C8ZA 4OAHA 2V26A 3SXKA 3NDBB 3GWLA 3AJMA 4AE4A 4MVZA 1R89A 3EGXB 5DBAA 3JPRA 3ERCC 1JMWA 3VYWA 2IM8A 1R8AA 2XLOA 8ICPA 1HMOA 3ABLC 4KLIA 1M2VA 4RQ4A 5J0RA 3U5SA 1S05A 2MWQA 3I5QA 2HUJA 3V7JA 3LQCB 2NRKA 4JRZA 4X0RA 1W2WA 4LERA 2L6FA 3AU6A 2QNLA 4N6HA 3B29A 1O87A 1ZQJA 2YL0A 5IY5C 4XA5A 1PV3A 2XS8A 2GDCA 3CQZA 4UAZA 2AP3A 2Y3BA 3IHUA 4I3MA 4WC0A 1MQ2A 3HNKA 3RYLA 3IQCA 3LS1A 5HSWA 5D62A 4WC5A 3S29A 3ZQVA 3C8GA 3UMHA 4TURA 4NTAA 4JC7A 5F2VO 3EGDA 3DAFA 2W4BA 2M2TA 1HMDA 4C7OA 2M64A 4LZGA 4I29A 2R7OA 2NUTA 2BE3A 4RQ5A 1YLQA 2A0UA 1ZQAA 2FMQA 3TOLA 1UEVA 4RBNA 5BUOA 4O6NA 4Z6DA 1LPEA 1ZQZA 8ICIA 2Q9AA 1D0YA 2EIMC 1MMDA 8ICTA 4KLOA 4O5EA 1EA8A 4M2YA 4KLJA 5B1BC 4XUSA 3OV7A 5EK0A 4PJNA 1ZQTA 5EHHA 3F47A 4YL0A 1YZAA 3SP1A 2J46A 1ZHXA 2XLHA 2L81A 2GA9D 4KLDA 2HV6A 2IBFA 4O6YA 1GS9A 5J0SA 3EHMA 3ZIBA 4IQVA 3I5PA 4EEBA 3H37A 5COGA 4EGWA 1C03A 4A4AA 2KQ9A 5A6BD 2VCAA 3C8GD 5D63A 3RJKA 1IW7F 4IQTA 1UEUA 4RQ6A 2YVKA 4XQ7A 1YA7O 1VYIA 2DR7A 4B6IA 4XLNF 2QUPA 5KYUB 4JTCB 4LACB 1ZQCA 1RJ9B 3C62A 3QZCA 3HJ4A 4O9MA 4WGYA 4KLUA 1CPQA 3BRJA 1BBHA 4RPXA 1ZQIA 3GANA 3K66A 3RJIA 4O5CA 5DVWA 4WC2A 2P1AA 5L0DA 4AT8A 4G7OF 3JYHA 4NXUA 5BQGA 4Z6CA 3U3BA 4ATBB 1L3PA 4FHYA 2PNOA 4OAIZ 4Q7CA 2IXOA 5D92A 2P0NA 4PK4A 1G4US 4EEDA 3V5YA 5DB9A 1CGME 4MFAA 2Q9BA 2H7VC 2IXPA 4R64A 1WATA 4DOAA 4JCZA 3U8VA 3EF2A 4WC3A 2I15A 3GEHA 5EOZA 5COMA 2NSFA 1NLXA 2ZH5A 1GGQA 2W45A 2PF4E 2EIKC 3ASOC 4U5BE 9ICMA 4DO9A 2ZH4A 5E33A 5DEDA 2O9XA 1ZQVA 3LAYA 1NSGB 3GWNA 4WOYA 3B71A 4NLZA 4M9HA 4WGZA 4BJTA 2J9BA 2B4VA 4EHPA 3EQLF 5J0UA 4X4PA 5F5HA 3FHDA 4G78A 5J0XA 3M79A 1MMNA 3SZRA 1E86A 1VLSA 5A6KA 2WL8A 4RWPA 1T5OA 3VF0A 3X1OA 4OINF 2DI3A 3ZTZA 4MVQA 4M9NA 3GEEA 2M2UA 4IQUA 1WOTA 2MHRA 1FMWA 5L0FA 3O10A 1V74B 5KYWA 4JLZA 4YL1A 4KLMA 4LDRA 1NOMA 1MMGA 4UBBA 4M9JA 2JD3A 4N06A 4XTKA 3HW8A 2KYHA 3AOUA 3ATPA 3H38A 4LVSA 3T4RA 1RKEB 1ZQUA 4X0AA 4IAQA 3PMLA 3TK0A 4NTFA 1JN3A 3DZAA 4I2DA 4UB3A 3WFRE 8ICSA 4X4TA 5B3IA 1ZW3A 3MBGA 1PCXA 4E7SA 2OEXA 1TFOB 1Y4CA 4GQHA 4MVRA 3C2LA 3AG1C 4PJLA 3Q7LA 2IHMA 4KBLA 2EILC 1BDJB 4JE9A 4DVZA 5HC9A 2PP4A 3NMIA 2CYDA 4PHDA 3EGXA 3JPTA 2OU6A 3FAJA 3OUYB 1VB5A 4DXWA 5DBCA 1BPYA 3U3FA 1I4YA 1M2VB 4XEVA 4N6CA 3OGUA 7ICTA 1BPDA 2ZPAA 2QE9A 4K7BA 4RT3A 4LEYA 4OD5A 3O55A 5T3TA 3ZG1A 4NXZA 3OWTA 4QZIA 2Y69C 5CFSA 4WH5A 2ZH9A 5E3AA 5L3VA 3OWGA 1G8XA 1XSPA 2L6GA 1GQAA 1JOGA 3C7JA 4LEWA 3OVBA 3C5GA 2KNHA 2R7WA 3H2UA 3POVA 3ISBA 4CSAA 3LNRA 1OCCC 1LE2A 4NKTA 3M1CB 4O6MA 1ORSC 2NUTB 4OIQF 4ZLDA 1VYKA 4O69A 4H4KC 4K99A 3DMDA 5J0PA 3W4YA 2WZFA 3GM3A 4QZFA 2L7AA 3K6BA 1T6UA 4F5PA 2R03A 3UNGC 2R7UA 3HJCA 5CP2A 3HTKC 4PGYA 4JJFA 5IIOA 2DB4A 4UAYA 1HW1A 2HJ3A 3DAGA 3L9DA 4QZGA 1H6GA 5K0IA 3AQNA 2DYRC 1FNTc 1Z23A 3ER9B 4CJOA 2HN2A 4IJJA 2IXNA 1R8BA 1VMAA 4J7TA 1QVXA 2BPCA 2X51A 2FMSA 2L9JA 1KEJA 3UXNA 1XSLA 3GM1A 2XS1A 1ZVZA 4QZ8A 5DECA 3ZTMA 3QW0A 3SEOA 3U0CA 3UXPA 2H7BA 4QDLA 3WODF 4DOZA 2YL7A 1Z6AA 4YK5A 9ICSA 4C3DA 5GPGB 1CGOA 4F4BA 3E9VA 4FHVA 2GAFD 3C66A 4MTFA 1YVIA 2GAQA 5T1DB 9ICUA 4BEMJ 9ICVA 3QW1A 9ICOA 1FAPB 1CPRA 2Y3GA 5J0OA 1NFNA 3M4BA 4F5RA 3RH4A 1JAJA 7ICSA 1U6HA 4OAFA 3FOPA 5B3SC 3JSEO 1ZHZA 4P4MA 3Q6NA 2O1PA 2YL1A 9ICCA 3AGTA 4IG8A 3LESA 2PX3A 4IGGA 1MQ3A 2D4UA 2M2WA 2ZH8A 1QPUA 1R8CA 1MNDA 4MKPA 2LSEA 4PFOA 5TZVA 2XSEA 3IEEA 4I28A 1RZTA 3TD7A 3NYLA 5BQIA 4YT4A 1VFGA 2VB6A 2CNWA 4Z9HA 3NVOA 4UB4A 2E87A 1OCOC 4AT7A 3HKKA 4ZLCA 1C02A 4CIPA 7ICMA 5IIMA 7ICFA 3BEHA 7ICIA 2BBHA 3TJ5A 3ISCA 9ICEA 4F5OA 5A6AA 5L0JA 3X2QC 4YL3A 2J0WA 4XPXA 3RH6A 4UB1A 4DBRA 2J9UA 4P2HA 4RQ3A 4E17A 1RKEA 2ZH1A 3LNMB 9ICIA 3SXMA 7ICNA 1LIHA 2VANA 4AL1A 3NKEA 3AG3C 4O5KA 3RJHA 2RSEB 1DOWA 3O39A 3FVYA 2LD6A 1A7DA 1RXQA 5CFUA 3W8HA 8ICJA 2BCVA 3GEIA 1BPEA 3MDCA 4I2JA 3ITFA 4DRIB 4NCQA 5CFTA 2EPLX 2ZD9A 4PR9A 3DM9B 1OU5A 5HRGA 3ZVRA 1SMYF 1ZHYA 4PH5A 5DQZA 1TWGA 1HE9A 1G5ZA 1N1CA 4QZHA 3OUYA 2PFPA 1BPXA 4KI2A 4FWVA 1BR4A 3RF3A 1NO5A 3FAPB 1JR8A 4GXJA 1YA9A 1ZQEA 4YJWA 7ICLA 3UGPA 1Q79A 2AWCA 2YWAA 4KLLA 1EKYA 4MVSA 1YYXA 2HZ8A 4BJ5A 2HN1A 4HFKB 5IILA 8ICZA 1LM3B 2HHPA 4M04A 1ZHTA 4QZEA 4M9LA 3EG9B 5J2JA 5JS5A 5HRDA 2P7VA 3RQGA 1O5HA 2XL4A 1VOMA 4XWJA 3KH2A 4QI2A 4W8KA 2BL2A 4RD9A 3CSKA 1ZU4A 5A6JA 2G62A 3JSZA 3AQBA 1J8YF 4X4UA 8ICAA 2XXAB 1Z63A 2NPUA 2Q4FA 3EHNA 1D1BA 4RWOA 3W2VA 4OIOF 1VJ7A 3V5ZA 4WC1A 4NXWA 2ISPA 3MBYA 5BQHA 3RKOF 3EZHA 3SYNA 4OAGA 2B51A 1E2XA 2AVKA 4DVYP 3KL4A 4Z6FA 1XZPA 2YQYA 7ICPA 4E0IA 8ICLA 3ZSUA 8ICEA 8ICQA 4EKWA 3HLZA 4ER9A 4FAPB 1XSNA 2JX0A 3HIYA 9ICAA 256BA 1ZQSA 4UB5A 2WVOA 5BOLA 1NFOA 2O5AA 5JTGA 2IYLD 1MNEA 2PBEA 4WC6A 1I4ZA 4IWBA 4CDYA 9ICHA 1JQRA 5DLJA 2X0CA 2DR5A 4I2CA 1ZW2A 4HFFB 5D61A 1J8MF 3L1MA 5F28E 3W2WA 2B56A 3H39A 2C03A 4UBCA 5COFA 3U9MA 3JT1A 4PGXA 4P6IC 4UAWA 3H65A 1PX5A 2XRHA 5KYYA 1YARO 3RFYA 2J0XA 4TUPA 1TVAA 1JRAA 2OG2A 3EZIA 4J30B 8ICCA 4E0HA 1MIVA 3QVZA 1T6QA 8ICOA 2ASRA 2EPOA 4UD4A 5J2HA 1R5ID 1QSPA 4N7RA 3T6GB 5IIIA 5HHIA 3EH2A 4PHEA 3JPQA 4R63A 4NKUA 2WZGA 5HRIA 4EUKB 4TUSA 8ICFA 3FDQA 2R7XA 4NXTA 3KPHA 3TULA 4IB4A 4PHPA 4RWNA 3WFOA 4MFCA 4JTAB 5HV9A 2VH3A 4JWNA 8ICYA 1FA0A 1NU9C 7ICQA 5J2AA 4BJ1A 4R65A 3IQ5A 4O79A 1MQVA 3NMKA 5CWRA 3RJFA 3ABMC 4AT7B 4K96A 4G7ZF 4WC4A 4RQ2A 3HX0A 3GDXA 3QTHA 1ZQHA 1ZQQA 5JRAA 1LI7A 5J0YA 4KLEA 1A0BA 2DR9A 1OR2A 3RVZA 3G50A 4NY3A 2R7TA 1Q0KA 4RQ0A 3H3AA 2MYSA 4BG0A 2DGJA 4FX5A 5IINA 5JUAA 2Y3HA 9ICLA 3RH5A 2EIJC 3C63A 4EIYA 3VM6A 1FFHA 4I2IA 5BOMA 4IAOA 2IUBA 2ZXOA 4QZCA 3TOMA 4KLSA 5CHGA 4LEVA 4CIHA 1M2OA 2QY9A 4A2NB 4Q4ZF 3PDMP 2OJED 4DBQA 1R4TA 2Y39A 1O3UA 4CS8C 1TFKB 3L8JA 1B68A 3R7CA 1H9GA 3DKAA 4RPZA 1UG7A 4X0BA 5L0GA 3V7OA 1T01A 1BR1A 4KNWA 4K9AA 4QZAA 1Z3IX 4E80A 4YWQA 2M4EA 4DRHB 2H8AA 5J2FA 1U0BB 4I2GA 3RIPA 1M6TA 4E7ZA 1LI5A 8ICUA 4O6AA 4X4QA 1TWAA 4S3NA 3AU2A 2VCBA 4NM2A 3M4CA 2HSBA 3ABKC 4F5NA 9ICKA 4EV6A 3NG1A 4KB6A 1XZQA 1T9KA 1JAFA 3NYJA 4BJ6C 2I8BA 3UPQA 3WFSC 4CS8A 4CDAA 3JYYA 3CK6A 4DRJB 2ZHAA 3QMKA 3K1IC 4LEZA 3MFNA 5DS5A 3DI5A 5DB7A 7ICHA 3CEXA 4NXXA 4EWCA 3KKBA 1SR2A 3EG9A 2J9WA 2IHOA 4YN4A 3MGHA 2HSQA 1G4WR 1OW6A 9ICPA 1F1MA 2XXAA 4FO1A 4U5GA 2BCRA 5J29A 4GYTA 1DOVA 7ICGA 3N24A 2D5RB 4K4GA 2BCQA 2YKZA 2W9MA 1HUOA 1S7ZA 1TKNA 2KSFA 1FMVA 3SNHA 2EPMX 2DVIA 4ANJA 4K9BA 2RD9A 1VLTA 3DJNB 4XQ1A 2IXMA 1OKKA 3ISDA 5D49A 1A41A 2WVNA 2A6HF 2NG1A 1BPZA 8ICVA 3K75D 1V4AA 2DR8A 2PXIA 2Q7RA 3OVAA 5HRHA 4KLTA 4CDVA 3TFRA 2LFFA 1ZQKA 1RCPA 1TWCA 5J0TA 1AUEA 4K4HA 3EFOB 5KYYB 1K05A 4CJGA 3H2VA 1BR2A 3LS0A 3F46A 4EBKA 3GM2A 2B0HA 5HREA 3AUOA 2PFOA 2ZH6A 1MIWA 4C3EA 3RH3A 1ZQWA 2EWRA 5HRLA 3RQEA 2LP4A 4IARA 1ZYRF 2LK4A 1FFTC 8ICKA 2A1DD 4GXKA 4RQ1A 4NTBA 7ICVA 3K1HA 2FMPA 2P66A 2GA0A 3DE9A 2PX0A 3UQ2A 3C2MA 1Q0MA 3V7KA 5JVEA 2A0BA 2YLGA 3ZDLA 1TV9A 3OEOA 1YYJA 4JVSA 3C18A 1TQGA 4XJEA 3EJNA 2XL6A 1M57C 3WHNA 2OKUA 4WC7A 3MYIA 1M56C 1OCZC 4WQKA 9ICFA 4XPYA 4NXVA 3IPMO 1ZJNA 2BCSA 4GEHA 4L6RA 4I2HA 5CA7A 1ZQPA 3JRMO 4PJMA 2UUIA 3DJUB 3LUTB 3M15A 4MF8A 3TQOA 4C3BA 4KC9A 1MMAA 2OQMA 3I4UA 4PPXA 5J2GA 1H7IA 2HKVA 2Q66A 4WBYA 3FOOA 4I1MA 4MNDA 2BC5A 3TFSA 3HJ1A 3EH1A 3W8IA 1WGWA 1ZQLA 4OIRF 4PHAA 3LEOA 4BEJA 1TR2A 3RW0A 3J06A 5DKWA 2FCLA 2YLDA 4ULVA 8ICWA 3GODA 4CS7A 5EGYA 1XWJA 4EBBA 2CDQA 1JPNA 4LDQA 3S27A 8ICRA 2HS5A 2GWSA 4P9TA 4K4IA 1HE1A 5L0IA 3DE8A 5B3PA 2CNWD 3NRHA 5HRBA 9ICWA 4M9GA 1FR0A 1K04A 3PHF2 3NKDA 3L0IA 4PFPA 3US6A 4NLNA 1L7CA 9ICJA 2AU5A 2C04A 2BBJA 3GORA 2ZH7A 1QQ3A 4U5HA 2YEVA 4KM5A 3NYMA 4X5VA 4Z9IA 3LK9A 1ST6A 3FXHA 2ETSA 4RQ8A 4NQFA 2QLAA 3A11A 4FH5A 1QKRA 3S90A 5HRKA 4YD2A 3AQKA 5J2EA 1D0ZA 2WZLA 4YCXA 2AWYA 4U5CE 2R7RA 2CCYA 4DOCA 1SYQA 1Q0GA 2BCUA 8ICBA 3WFQE 4LDKA 1Q78A 2OOCA 3QVYA 1OR3A 3U2LA 5L0HA 4JEAA 3LEVA 5AC5A 3SXYA 3JPOA 2R7VA 2Q9CA 3LLIA 3RJJA 2L6HA 2IOQA 4K1OA 3MX3A 1EI7A 3MYFA 4MW3A 3OA1A 3ZQYA 1E84A 3G4ZA 2LQGA 4IQWA 5DDYA 2KGOA 1LE4A 3ER8C
chains in the Genus database with same CATH topology
4NKTA 4WBZA 4WC4A 1K40A 4RQ2A 3HX0A 4NM1A 3GDXA 4JWMA 4NY8A 1ZQHA 7ICUA 1UETA 1ZQQA 4FHWA 1ZQFA 2DRBA 4I27A 5J0YA 4KLEA 4FHPA 4WCWA 2KK1A 4EP7A 2DR9A 5J0PA 8ICHA 3GM3A 4QZFA 3C5FA 4RQ0A 3H3AA 1RPLA 2ZH3A 4F5PA 5CJ7A 5IINA 1ZQNA 8ICGA 9ICLA 5CP2A 3RH5A 1OW7A 3JPSA 4PGYA 1HUZA 4I2IA 5IIOA 5BOMA 4UAYA 2JPUA 4QZCA 3JZ0A 4KLSA 5CHGA 3L9DA 5CB1A 5J2DA 4UB2A 4QZGA 9ICRA 3AQNA 4YMNA 7ICEA 4KLQA 5J2IA 2Q00A 4PGQA 4AT9A 4YD1A 1O3UA 5DB8A 4F5QA 1UFBA 1R8BA 5J0QA 1QVXA 3L8JA 3S9OA 2BPCA 3RJEA 2FMSA 4RPZA 9ICBA 3RQFA 9ICTA 4LZDA 3OVSA 1KEJA 3UXNA 3UPSA 4X0BA 3C2KA 3PNCA 3NYBA 1XSLA 3GM1A 2BPGA 4QZ8A 9ICGA 5DECA 4P4OA 8ICXA 3U0CA 3UXPA 1ZQGA 4QZAA 4E80A 4QZBA 9ICSA 5J2FA 1KTMA 4I2GA 4FHVA 3C66A 8ICUA 4LT6A 4X4QA 4XEFA 3AJMA 9ICUA 4S3NA 3AU2A 9ICVA 9ICOA 1R89A 4NM2A 3JPRA 5DBAA 3HWTA 2HSBA 4F5NA 9ICKA 5J0OA 4FHXA 1R8AA 8ICPA 4UD5A 3UPQA 4YMOA 4KLIA 4F5RA 3RH4A 3WFSC 4RQ4A 5J0RA 5BPCA 1JAJA 7ICSA 3JYYA 2ZHAA 3V7JA 3LQCB 2NRKA 4P4MA 2O1PA 1F5AA 3MFNA 4XEKA 3RJGA 2L6FA 3AU6A 5DB7A 7ICHA 9ICCA 9ICXA 5D46A 3V72A 4IG8A 1ZQJA 4XA5A 4YN4A 4RT2A 1MQ3A 1PV3A 2M2WA 3MGHA 2ZH8A 1R8CA 3PMNA 4MF2A 4UAZA 1ZQDA 5TZVA 1OW6A 9ICPA 4WC0A 1MQ2A 4XQ8A 4I28A 4MFFA 1RZTA 4TUQA 4WC5A 1VFGA 3C8GA 4NLKA 9ICQA 7ICJA 4TURA 4KLGA 2BCRA 4UB4A 2ISOA 5F2VO 5IIJA 4GXIA 4AT7A 5DDMA 4X4SA 5J0WA 2M2TA 5J29A 7ICGA 3K7DA 4X4RA 4LZGA 7ICMA 5IIMA 4I29A 7ICFA 4K4GA 2BCQA 2BE3A 7ICIA 2W9MA 4RQ5A 1ZJMA 1HUOA 2BPFA 1YLQA 3ISCA 1ZQAA 9ICEA 4F5OA 8ICMA 2FMQA 1UEVA 4Z6DA 3MDAA 1ZQZA 2ID1A 8ICIA 2DVIA 8ICTA 4KLOA 1ZQRA 4O5EA 4M2YA 3RH6A 3ISDA 4UB1A 1ZQYA 5HR9A 4I2AA 5D49A 4KLJA 3OV7A 4XUSA 4I2BA 4P2HA 1ZQTA 4RQ3A 2ZH1A 1BPZA 1ZQMA 9ICIA 8ICVA 3K75D 1V4AA 2DR8A 7ICNA 2PXIA 3OVAA 4KLDA 5HRHA 4KLTA 2VANA 5J0SA 5J2BA 3TFRA 3V7LA 4O5KA 3RJHA 4IQVA 4X4OA 4AT9B 1ZQBA 3H37A 1ZQKA 8ICJA 2BCVA 1BPEA 3MDCA 4I2JA 3C8GD 5J0TA 4X4NA 3RJKA 3MGIA 4K4HA 4IQTA 1UEUA 1K05A 4RQ6A 1BPBA 1OW8A 4XQ7A 4FH3A 1OU5A 2RFFA 5HRGA 2DR7A 4PH5A 4EBKA 3GM2A 1ZQCA 4DOBA 2M2VA 5HREA 3AUOA 3HJ4A 4O9MA 2PFOA 4KLUA 3BRJA 2ZH6A 1MIWA 1KDHA 1ZQWA 1MIYA 4RPXA 1ZQIA 4QZHA 3OUYA 3RJIA 2PFPA 4O5CA 1BPXA 5HRLA 3RQEA 4WC2A 1NO5A 4AT8A 2LK4A 4Z6CA 4ATBB 8ICKA 4RQ7A 4KLFA 4GXKA 4RQ1A 4FHYA 4GXJA 1ZQEA 7ICLA 7ICVA 1WTYA 4R66A 1Q79A 2YWAA 2FMPA 4KLLA 4FO6A 2P66A 5DB6A 5DB9A 4RWQA 4MFAA 4M47A 3UQ2A 1TFWA 3C2MA 4R64A 4DOAA 3V7KA 5IILA 4WC3A 8ICZA 1TV9A 2I9GA 9ICNA 2HHPA 4M04A 5EOZA 4QZEA 4M9LA 5J2JA 5HRDA 3C18A 1KNYA 2ZH5A 3RQGA 4QZ9A 9ICMA 4DO9A 2ZH4A 5DEDA 1ZQVA 4WC7A 4X4UA 8ICAA 9ICFA 3B71A 4NLZA 4M9HA 3C8GB 4RWOA 1ZJNA 4X4PA 5J0UA 2BCSA 1VJ7A 4WC1A 5J0XA 2ISPA 3MBYA 5IIKA 2PFNA 1ZZPA 1WWPA 4I2HA 5CA7A 1ZQPA 5J2KA 4Z6FA 4RWPA 4MF8A 5HHHA 7ICPA 8ICLA 4M9NA 7ICOA 8ICEA 4PPXA 8ICQA 4I2EA 1XSNA 3B0XA 2M2UA 2JX0A 5J2GA 4IQUA 1WOTA 2Q66A 3HIYA 4WBYA 3O10A 4M5DA 3TFSA 3HJ1A 9ICAA 1ZQSA 4KLMA 4UB5A 1TFYA 1NOMA 3UXOA 4RPYA 1ZQLA 5BOLA 4UBBA 4M9JA 7ICRA 4PHAA 2O5AA 3HW8A 2PBEA 4WC6A 5J2CA 3H38A 4LVSA 4YMMA 5DKWA 1ZQUA 4X0AA 3PMLA 5HRFA 9ICHA 1JQRA 8ICWA 1JN3A 4XRHA 2DR5A 4I2DA 4UB3A 4KLHA 8ICRA 4I2CA 3WFRE 8ICSA 1WOLA 4X4TA 2GWSA 7ICKA 4K4IA 1ZQOA 5HRBA 3L8IA 5F28E 9ICWA 4M9GA 3H39A 1K04A 4UBCA 5CR0A 3C2LA 4PGXA 4UAWA 2IHMA 4R32A 1PX5A 3WFPA 4NLNA 9ICJA 2ZH7A 4TUPA 4X4VA 1TVAA 5HC9A 4PHDA 4M0AA 3JPTA 2ZHBA 4X5VA 8ICCA 3LK9A 3AQMA 3OUYB 2DRAA 4EBJA 1MIVA 4RQ8A 8ICOA 3UQ0A 4NQFA 4UD4A 5DBCA 5J2HA 1BPYA 3U3FA 3AQLA 4FH5A 4AT8B 4Z6EA 4XEVA 5HRKA 4YD2A 3AQKA 5J2EA 4E8FA 4QZDA 3OGUA 5IIIA 7ICTA 4ATBA 5HHIA 4YCXA 1BPDA 5D4BA 4PHEA 3JPQA 5DBBA 4DOCA 4RT3A 2BCUA 4R63A 8ICBA 4NKUA 5HRIA 3JPNA 4P4PA 4E7XA 4TUSA 3WFQE 8ICFA 1ZQXA 1Q78A 4NXZA 3TULA 4QZIA 4PHPA 4RWNA 3WFOA 3JPOA 3B0YA 2ZH9A 2ZH2A 4MFCA 2PFQA 1XSPA 8ICNA 3RJJA 2L6HA 4JWNA 8ICYA 2L6GA 1FA0A 1JOGA 7ICQA 5J2AA 4I2FA 4R65A 3OVBA 3C5GA 4IQWA 5CWRA 5DDYA 3RJFA 4AT7B 3JPPA 3ISBA 1JMSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NKT A;  4WBZ A;  4WC4 A;  1K40 A;  4RQ2 A;  3HX0 A;  4NM1 A;  3GDX A;  4JWM A;  4NY8 A;  1ZQH A;  7ICU A;  1UET A;  1ZQQ A;  4FHW A;  1ZQF A;  2DRB A;  4I27 A;  5J0Y A;  4KLE A;  4FHP A;  4WCW A;  2KK1 A;  4EP7 A;  2DR9 A;  5J0P A;  8ICH A;  3GM3 A;  4QZF A;  3C5F A;  4RQ0 A;  3H3A A;  1RPL A;  2ZH3 A;  4F5P A;  5CJ7 A;  5IIN A;  1ZQN A;  8ICG A;  9ICL A;  5CP2 A;  3RH5 A;  1OW7 A;  3JPS A;  4PGY A;  1HUZ A;  4I2I A;  5IIO A;  5BOM A;  4UAY A;  2JPU A;  4QZC A;  3JZ0 A;  4KLS A;  5CHG A;  3L9D A;  5CB1 A;  5J2D A;  4UB2 A;  4QZG A;  9ICR A;  3AQN A;  4YMN A;  7ICE A;  4KLQ A;  5J2I A;  2Q00 A;  4PGQ A;  4AT9 A;  4YD1 A;  1O3U A;  5DB8 A;  4F5Q A;  1UFB A;  1R8B A;  5J0Q A;  1QVX A;  3L8J A;  3S9O A;  2BPC A;  3RJE A;  2FMS A;  4RPZ A;  9ICB A;  3RQF A;  9ICT A;  4LZD A;  3OVS A;  1KEJ A;  3UXN A;  3UPS A;  4X0B A;  3C2K A;  3PNC A;  3NYB A;  1XSL A;  3GM1 A;  2BPG A;  4QZ8 A;  9ICG A;  5DEC A;  4P4O A;  8ICX A;  3U0C A;  3UXP A;  1ZQG A;  4QZA A;  4E80 A;  4QZB A;  9ICS A;  5J2F A;  1KTM A;  4I2G A;  4FHV A;  3C66 A;  8ICU A;  4LT6 A;  4X4Q A;  4XEF A;  3AJM A;  9ICU A;  4S3N A;  3AU2 A;  9ICV A;  9ICO A;  1R89 A;  4NM2 A;  3JPR A;  5DBA A;  3HWT A;  2HSB A;  4F5N A;  9ICK A;  5J0O A;  4FHX A;  1R8A A;  8ICP A;  4UD5 A;  3UPQ A;  4YMO A;  4KLI A;  4F5R A;  3RH4 A;  3WFS C;  4RQ4 A;  5J0R A;  5BPC A;  1JAJ A;  7ICS A;  3JYY A;  2ZHA A;  3V7J A;  3LQC B;  2NRK A;  4P4M A;  2O1P A;  1F5A A;  3MFN A;  4XEK A;  3RJG A;  2L6F A;  3AU6 A;  5DB7 A;  7ICH A;  9ICC A;  9ICX A;  5D46 A;  3V72 A;  4IG8 A;  1ZQJ A;  4XA5 A;  4YN4 A;  4RT2 A;  1MQ3 A;  1PV3 A;  2M2W A;  3MGH A;  2ZH8 A;  1R8C A;  3PMN A;  4MF2 A;  4UAZ A;  1ZQD A;  5TZV A;  1OW6 A;  9ICP A;  4WC0 A;  1MQ2 A;  4XQ8 A;  4I28 A;  4MFF A;  1RZT A;  4TUQ A;  4WC5 A;  1VFG A;  3C8G A;  4NLK A;  9ICQ A;  7ICJ A;  4TUR A;  4KLG A;  2BCR A;  4UB4 A;  2ISO A;  5F2V O;  5IIJ A;  4GXI A;  4AT7 A;  5DDM A;  4X4S A;  5J0W A;  2M2T A;  5J29 A;  7ICG A;  3K7D A;  4X4R A;  4LZG A;  7ICM A;  5IIM A;  4I29 A;  7ICF A;  4K4G A;  2BCQ A;  2BE3 A;  7ICI A;  2W9M A;  4RQ5 A;  1ZJM A;  1HUO A;  2BPF A;  1YLQ A;  3ISC A;  1ZQA A;  9ICE A;  4F5O A;  8ICM A;  2FMQ A;  1UEV A;  4Z6D A;  3MDA A;  1ZQZ A;  2ID1 A;  8ICI A;  2DVI A;  8ICT A;  4KLO A;  1ZQR A;  4O5E A;  4M2Y A;  3RH6 A;  3ISD A;  4UB1 A;  1ZQY A;  5HR9 A;  4I2A A;  5D49 A;  4KLJ A;  3OV7 A;  4XUS A;  4I2B A;  4P2H A;  1ZQT A;  4RQ3 A;  2ZH1 A;  1BPZ A;  1ZQM A;  9ICI A;  8ICV A;  3K75 D;  1V4A A;  2DR8 A;  7ICN A;  2PXI A;  3OVA A;  4KLD A;  5HRH A;  4KLT A;  2VAN A;  5J0S A;  5J2B A;  3TFR A;  3V7L A;  4O5K A;  3RJH A;  4IQV A;  4X4O A;  4AT9 B;  1ZQB A;  3H37 A;  1ZQK A;  8ICJ A;  2BCV A;  1BPE A;  3MDC A;  4I2J A;  3C8G D;  5J0T A;  4X4N A;  3RJK A;  3MGI A;  4K4H A;  4IQT A;  1UEU A;  1K05 A;  4RQ6 A;  1BPB A;  1OW8 A;  4XQ7 A;  4FH3 A;  1OU5 A;  2RFF A;  5HRG A;  2DR7 A;  4PH5 A;  4EBK A;  3GM2 A;  1ZQC A;  4DOB A;  2M2V A;  5HRE A;  3AUO A;  3HJ4 A;  4O9M A;  2PFO A;  4KLU A;  3BRJ A;  2ZH6 A;  1MIW A;  1KDH A;  1ZQW A;  1MIY A;  4RPX A;  1ZQI A;  4QZH A;  3OUY A;  3RJI A;  2PFP A;  4O5C A;  1BPX A;  5HRL A;  3RQE A;  4WC2 A;  1NO5 A;  4AT8 A;  2LK4 A;  4Z6C A;  4ATB B;  8ICK A;  4RQ7 A;  4KLF A;  4GXK A;  4RQ1 A;  4FHY A;  4GXJ A;  1ZQE A;  7ICL A;  7ICV A;  1WTY A;  4R66 A;  1Q79 A;  2YWA A;  2FMP A;  4KLL A;  4FO6 A;  2P66 A;  5DB6 A;  5DB9 A;  4RWQ A;  4MFA A;  4M47 A;  3UQ2 A;  1TFW A;  3C2M A;  4R64 A;  4DOA A;  3V7K A;  5IIL A;  4WC3 A;  8ICZ A;  1TV9 A;  2I9G A;  9ICN A;  2HHP A;  4M04 A;  5EOZ A;  4QZE A;  4M9L A;  5J2J A;  5HRD A;  3C18 A;  1KNY A;  2ZH5 A;  3RQG A;  4QZ9 A;  9ICM A;  4DO9 A;  2ZH4 A;  5DED A;  1ZQV A;  4WC7 A;  4X4U A;  8ICA A;  9ICF A;  3B71 A;  4NLZ A;  4M9H A;  3C8G B;  4RWO A;  1ZJN A;  4X4P A;  5J0U A;  2BCS A;  1VJ7 A;  4WC1 A;  5J0X A;  2ISP A;  3MBY A;  5IIK A;  2PFN A;  1ZZP A;  1WWP A;  4I2H A;  5CA7 A;  1ZQP A;  5J2K A;  4Z6F A;  4RWP A;  4MF8 A;  5HHH A;  7ICP A;  8ICL A;  4M9N A;  7ICO A;  8ICE A;  4PPX A;  8ICQ A;  4I2E A;  1XSN A;  3B0X A;  2M2U A;  2JX0 A;  5J2G A;  4IQU A;  1WOT A;  2Q66 A;  3HIY A;  4WBY A;  3O10 A;  4M5D A;  3TFS A;  3HJ1 A;  9ICA A;  1ZQS A;  4KLM A;  4UB5 A;  1TFY A;  1NOM A;  3UXO A;  4RPY A;  1ZQL A;  5BOL A;  4UBB A;  4M9J A;  7ICR A;  4PHA A;  2O5A A;  3HW8 A;  2PBE A;  4WC6 A;  5J2C A;  3H38 A;  4LVS A;  4YMM A;  5DKW A;  1ZQU A;  4X0A A;  3PML A;  5HRF A;  9ICH A;  1JQR A;  8ICW A;  1JN3 A;  4XRH A;  2DR5 A;  4I2D A;  4UB3 A;  4KLH A;  8ICR A;  4I2C A;  3WFR E;  8ICS A;  1WOL A;  4X4T A;  2GWS A;  7ICK A;  4K4I A;  1ZQO A;  5HRB A;  3L8I A;  5F28 E;  9ICW A;  4M9G A;  3H39 A;  1K04 A;  4UBC A;  5CR0 A;  3C2L A;  4PGX A;  4UAW A;  2IHM A;  4R32 A;  1PX5 A;  3WFP A;  4NLN A;  9ICJ A;  2ZH7 A;  4TUP A;  4X4V A;  1TVA A;  5HC9 A;  4PHD A;  4M0A A;  3JPT A;  2ZHB A;  4X5V A;  8ICC A;  3LK9 A;  3AQM A;  3OUY B;  2DRA A;  4EBJ A;  1MIV A;  4RQ8 A;  8ICO A;  3UQ0 A;  4NQF A;  4UD4 A;  5DBC A;  5J2H A;  1BPY A;  3U3F A;  3AQL A;  4FH5 A;  4AT8 B;  4Z6E A;  4XEV A;  5HRK A;  4YD2 A;  3AQK A;  5J2E A;  4E8F A;  4QZD A;  3OGU A;  5III A;  7ICT A;  4ATB A;  5HHI A;  4YCX A;  1BPD A;  5D4B A;  4PHE A;  3JPQ A;  5DBB A;  4DOC A;  4RT3 A;  2BCU A;  4R63 A;  8ICB A;  4NKU A;  5HRI A;  3JPN A;  4P4P A;  4E7X A;  4TUS A;  3WFQ E;  8ICF A;  1ZQX A;  1Q78 A;  4NXZ A;  3TUL A;  4QZI A;  4PHP A;  4RWN A;  3WFO A;  3JPO A;  3B0Y A;  2ZH9 A;  2ZH2 A;  4MFC A;  2PFQ A;  1XSP A;  8ICN A;  3RJJ A;  2L6H A;  4JWN A;  8ICY A;  2L6G A;  1FA0 A;  1JOG A;  7ICQ A;  5J2A A;  4I2F A;  4R65 A;  3OVB A;  3C5G A;  4IQW A;  5CWR A;  5DDY A;  3RJF A;  4AT7 B;  3JPP A;  3ISB A;  1JMS A; 
#chains in the Genus database with same CATH topology
 5A6B A;  2OJQ A;  1HW2 A;  4WBZ A;  1E85 A;  3TJ6 A;  5B1A C;  2G3V A;  4CBE A;  5B3Q A;  4I1O B;  4CS9 C;  2YRF A;  7ICU A;  1ORJ A;  2Q3T A;  2GWW A;  2HV7 A;  3B0U X;  4I27 A;  4FHP A;  3VRC A;  1OXK A;  5DS6 A;  4J7Y A;  2KK1 A;  4WCW A;  4EP7 A;  3ECS A;  2A68 F;  8ICH A;  2VC9 A;  3C5F A;  3UR3 C;  5CI9 A;  1RPL A;  3DXJ F;  2ZH3 A;  2UUH A;  8ICG A;  2HMQ A;  1HUZ A;  2P6V A;  1AVO B;  3NKU A;  1I5N A;  2XLV A;  1NU7 D;  3JZ0 A;  3G4X A;  5JP7 A;  1VK5 A;  2GFH A;  4J32 B;  4WQL A;  5CB1 A;  4MS2 A;  2XLM A;  9ICR A;  2R25 A;  4YMN A;  5J2I A;  3LJB A;  2Q00 A;  2CGE A;  3V5X A;  4CS9 A;  5F5F A;  1UFB A;  1YJG A;  3T9O A;  2R05 A;  4Q5S F;  3S9O A;  3S28 A;  4MVM A;  4E18 A;  9ICB A;  4LZD A;  3OVS A;  3EFO A;  4JJG A;  5AC4 A;  3UPS A;  3NYB A;  3ZWI A;  2BPG A;  3K33 A;  4P4O A;  8ICX A;  3AG4 C;  1ZQG A;  3RVY A;  4QZB A;  1LS4 A;  5KYX B;  1FTS A;  2J7P A;  3MLG A;  4U5E E;  2ZXW C;  3HNI A;  2B0J A;  2EIN C;  4LT6 A;  3VAY A;  5A69 A;  3U9J A;  3PMR A;  4XEF A;  2HMZ A;  1YZC A;  2J8W A;  3HWT A;  2NSG A;  3WAQ A;  4MTO A;  2XM4 A;  4FHX A;  3U2M A;  2CW0 F;  3HNJ A;  4YT2 A;  4UD5 A;  4YMO A;  5BPC A;  3IQT A;  4MTG A;  2W9Y A;  3N2Z B;  1F5A A;  2ICW G;  4XEK A;  2Z15 A;  1CGN A;  3RJG A;  9ICX A;  5D46 A;  3V72 A;  1Z5Z A;  2VAS A;  4JIO A;  4CX9 A;  4RT2 A;  2R02 A;  1Q0D A;  5E3C A;  2J45 A;  3PMN A;  4MF2 A;  1ZQD A;  4I44 A;  2ZXR A;  4XQ8 A;  2KJG A;  4MFF A;  4TUQ A;  3N0T A;  1KU2 A;  1WN0 A;  1E83 A;  4NLK A;  9ICQ A;  7ICJ A;  4KLG A;  3HNL A;  3T6B A;  2ISO A;  5IIJ A;  4GXI A;  5DDM A;  3S0X A;  5J0W A;  2F22 A;  4X4S A;  2J7P D;  4M63 A;  4MVO A;  3K7D A;  4O7G A;  4X4R A;  1ZU5 A;  4BPM A;  4JCH A;  1ZJM A;  1T6I A;  2XM0 A;  2BPF A;  2OCC C;  8ICM A;  2NUP B;  3O6X A;  4JEB A;  1EQ1 A;  3MDA A;  2ID1 A;  2Y3D A;  4YN0 B;  2HJM A;  2OEV A;  4JW1 A;  2ZXP A;  3PCV A;  3DD7 A;  1ZQR A;  4I2A A;  1ZQY A;  5HR9 A;  4I2B A;  5FZT A;  4WAB A;  2R7Q A;  1ZQM A;  1D0X A;  4JKV A;  5CHE A;  2P61 A;  4JUR I;  5J2B A;  3V7L A;  4K98 A;  2WB7 A;  4MVU A;  4X4O A;  4AT9 B;  2VCC A;  1ZQB A;  1BZ4 A;  4W8P A;  4YT8 A;  4G7H F;  3NMJ A;  3T6J A;  2DYS C;  4QI0 A;  4X4N A;  3MGI A;  2BE5 F;  2HFI A;  3AQC A;  4D4X A;  1BPB A;  1OCR C;  3B0V C;  3DM5 A;  1OW8 A;  4FH3 A;  2LCH A;  2RFF A;  4WJ0 A;  4Z9J A;  1APC A;  5CI8 A;  4PAC A;  4DOB A;  2M2V A;  4I0U A;  2XL8 A;  1KDH A;  5KYN A;  1MIY A;  2G3K A;  1ZHW A;  4AE4 B;  1YLM A;  2J9V A;  4ULW A;  1LS1 A;  4RDA A;  4RQ7 A;  4KLF A;  4LLE A;  4HX0 A;  1WTY A;  4R66 A;  1NZE A;  2TMV P;  4FO6 A;  5DB6 A;  1PD1 A;  4CSA C;  2WVQ A;  4RWQ A;  4M47 A;  3DWW A;  1TFW A;  1YAU O;  2XLD A;  2KW3 C;  2I9G A;  9ICN A;  4O68 A;  3Q7G A;  3UMI A;  3KYJ A;  1KNY A;  4QZ9 A;  1OXB A;  4BJ6 A;  2FAP B;  3IQ6 A;  1GPJ A;  4IRU A;  3C8G B;  4MQ9 F;  3K1I A;  1A7E A;  3KMI A;  5IIK A;  2PFN A;  3EGD B;  1ZZP A;  1WWP A;  4FES A;  5J2K A;  4C7O B;  3JCF A;  5HHH A;  1SF8 A;  4DJ9 A;  1AEP A;  4JTD B;  7ICO A;  4I2E A;  3B0X A;  1PD0 A;  5JSL A;  3MCR A;  1NG1 A;  3JRT A;  4M5D A;  3LLK A;  1RMV A;  2H7O A;  1TFY A;  4RPY A;  3UXO A;  2YZS A;  7ICR A;  4ONS A;  4OIP F;  2YHS A;  2PFD A;  3CAX A;  5J2C A;  3CZ6 A;  3U8P A;  4K8V A;  4XLP F;  4YMM A;  1QZX A;  5TJ5 E;  2XLE A;  5HRF A;  4XRH A;  5D91 A;  4KLH A;  1WOL A;  7ICK A;  3PHZ A;  1ZQO A;  1U89 A;  3SXZ A;  1NBB A;  2EPN A;  3L8I A;  4HE8 D;  1A7V A;  4H54 A;  2A6E F;  2W4M A;  5CR0 A;  1H9T A;  4R32 A;  5KYX A;  3WFP A;  4N4W A;  1ORY A;  5DS4 A;  1Z7Q c;  4X4V A;  1HY5 A;  2YL3 A;  5KYU A;  4PJJ A;  1RJ9 A;  4M0A A;  1LKX A;  4LLC A;  2ZHB A;  3AQM A;  2DRA A;  4EBJ A;  1GM5 A;  2V3C C;  3UQ0 A;  1OKK D;  4K97 A;  3AQL A;  3JCU Q;  4AT8 B;  4Z6E A;  4E8F A;  4QZD A;  4ATB A;  1OQC A;  1Q0F A;  2FGY A;  5D4B A;  4NC3 A;  5L0C A;  4XPW A;  5DBB A;  3B0P A;  3JPN A;  4P4P A;  3JTL O;  4D4N A;  4E7X A;  1ZQX A;  4AK9 A;  2R7S A;  4UDV A;  4MW8 A;  3AGU A;  1YDI A;  4U5D E;  5FCL A;  4OD4 A;  2QTV A;  3B0Y A;  2ZH2 A;  4JZA A;  4U9E A;  2PFQ A;  1JPJ A;  1RKC A;  8ICN A;  5L3Q A;  4AL0 A;  3WG7 C;  1TWH A;  2KC3 A;  4I2F A;  1C17 M;  1D1C A;  3JPP A;  3ASN C;  1JMS A;  3B9Q A;  5DQT A;  1K40 A;  4P9F A;  4NM1 A;  4JWM A;  4NY8 A;  3R2P A;  4U9D A;  1UET A;  4FHW A;  1ZQF A;  2DRB A;  4AX2 A;  4K0D A;  1LVK A;  2NUP A;  2FFH A;  1WAS A;  2YLI A;  3E70 C;  1IZM A;  2LIG A;  5KYW B;  5CIV A;  5JLI A;  5CJ7 A;  3NWI A;  3UMK A;  1ZQN A;  2EPK X;  4G0H A;  1OW7 A;  3JPS A;  3ZC4 A;  4KNV A;  2JPU A;  1VTM P;  1V54 C;  4O67 A;  5J2D A;  4UB2 A;  1SZI A;  3EPV A;  5JT4 A;  3S84 A;  4YT5 A;  2R9R B;  7ICE A;  4KLQ A;  5AGF A;  3L34 A;  3FMS A;  4PGQ A;  4AT9 A;  4YD1 A;  4F5Q A;  5DB8 A;  1QLE C;  5T3W A;  3UGO A;  5E2Q A;  5J0Q A;  3RJE A;  2LFD A;  3AG2 C;  4JLX A;  3A9C A;  1D1A A;  3RQF A;  9ICT A;  3KYI A;  4HEA J;  3C2K A;  3PNC A;  9ICG A;  3Q6M A;  4U5F E;  1V55 C;  1Y6D A;  2XLW A;  1KTM A;  4BJ5 C;  2A69 F;  3C8Z A;  4OAH A;  2V26 A;  3SXK A;  3NDB B;  3GWL A;  3AJM A;  4AE4 A;  4MVZ A;  1R89 A;  3EGX B;  5DBA A;  3JPR A;  3ERC C;  1JMW A;  3VYW A;  2IM8 A;  1R8A A;  2XLO A;  8ICP A;  1HMO A;  3ABL C;  4KLI A;  1M2V A;  4RQ4 A;  5J0R A;  3U5S A;  1S05 A;  2MWQ A;  3I5Q A;  2HUJ A;  3V7J A;  3LQC B;  2NRK A;  4JRZ A;  4X0R A;  1W2W A;  4LER A;  2L6F A;  3AU6 A;  2QNL A;  4N6H A;  3B29 A;  1O87 A;  1ZQJ A;  2YL0 A;  5IY5 C;  4XA5 A;  1PV3 A;  2XS8 A;  2GDC A;  3CQZ A;  4UAZ A;  2AP3 A;  2Y3B A;  3IHU A;  4I3M A;  4WC0 A;  1MQ2 A;  3HNK A;  3RYL A;  3IQC A;  3LS1 A;  5HSW A;  5D62 A;  4WC5 A;  3S29 A;  3ZQV A;  3C8G A;  3UMH A;  4TUR A;  4NTA A;  4JC7 A;  5F2V O;  3EGD A;  3DAF A;  2W4B A;  2M2T A;  1HMD A;  4C7O A;  2M64 A;  4LZG A;  4I29 A;  2R7O A;  2NUT A;  2BE3 A;  4RQ5 A;  1YLQ A;  2A0U A;  1ZQA A;  2FMQ A;  3TOL A;  1UEV A;  4RBN A;  5BUO A;  4O6N A;  4Z6D A;  1LPE A;  1ZQZ A;  8ICI A;  2Q9A A;  1D0Y A;  2EIM C;  1MMD A;  8ICT A;  4KLO A;  4O5E A;  1EA8 A;  4M2Y A;  4KLJ A;  5B1B C;  4XUS A;  3OV7 A;  5EK0 A;  4PJN A;  1ZQT A;  5EHH A;  3F47 A;  4YL0 A;  1YZA A;  3SP1 A;  2J46 A;  1ZHX A;  2XLH A;  2L81 A;  2GA9 D;  4KLD A;  2HV6 A;  2IBF A;  4O6Y A;  1GS9 A;  5J0S A;  3EHM A;  3ZIB A;  4IQV A;  3I5P A;  4EEB A;  3H37 A;  5COG A;  4EGW A;  1C03 A;  4A4A A;  2KQ9 A;  5A6B D;  2VCA A;  3C8G D;  5D63 A;  3RJK A;  1IW7 F;  4IQT A;  1UEU A;  4RQ6 A;  2YVK A;  4XQ7 A;  1YA7 O;  1VYI A;  2DR7 A;  4B6I A;  4XLN F;  2QUP A;  5KYU B;  4JTC B;  4LAC B;  1ZQC A;  1RJ9 B;  3C62 A;  3QZC A;  3HJ4 A;  4O9M A;  4WGY A;  4KLU A;  1CPQ A;  3BRJ A;  1BBH A;  4RPX A;  1ZQI A;  3GAN A;  3K66 A;  3RJI A;  4O5C A;  5DVW A;  4WC2 A;  2P1A A;  5L0D A;  4AT8 A;  4G7O F;  3JYH A;  4NXU A;  5BQG A;  4Z6C A;  3U3B A;  4ATB B;  1L3P A;  4FHY A;  2PNO A;  4OAI Z;  4Q7C A;  2IXO A;  5D92 A;  2P0N A;  4PK4 A;  1G4U S;  4EED A;  3V5Y A;  5DB9 A;  1CGM E;  4MFA A;  2Q9B A;  2H7V C;  2IXP A;  4R64 A;  1WAT A;  4DOA A;  4JCZ A;  3U8V A;  3EF2 A;  4WC3 A;  2I15 A;  3GEH A;  5EOZ A;  5COM A;  2NSF A;  1NLX A;  2ZH5 A;  1GGQ A;  2W45 A;  2PF4 E;  2EIK C;  3ASO C;  4U5B E;  9ICM A;  4DO9 A;  2ZH4 A;  5E33 A;  5DED A;  2O9X A;  1ZQV A;  3LAY A;  1NSG B;  3GWN A;  4WOY A;  3B71 A;  4NLZ A;  4M9H A;  4WGZ A;  4BJT A;  2J9B A;  2B4V A;  4EHP A;  3EQL F;  5J0U A;  4X4P A;  5F5H A;  3FHD A;  4G78 A;  5J0X A;  3M79 A;  1MMN A;  3SZR A;  1E86 A;  1VLS A;  5A6K A;  2WL8 A;  4RWP A;  1T5O A;  3VF0 A;  3X1O A;  4OIN F;  2DI3 A;  3ZTZ A;  4MVQ A;  4M9N A;  3GEE A;  2M2U A;  4IQU A;  1WOT A;  2MHR A;  1FMW A;  5L0F A;  3O10 A;  1V74 B;  5KYW A;  4JLZ A;  4YL1 A;  4KLM A;  4LDR A;  1NOM A;  1MMG A;  4UBB A;  4M9J A;  2JD3 A;  4N06 A;  4XTK A;  3HW8 A;  2KYH A;  3AOU A;  3ATP A;  3H38 A;  4LVS A;  3T4R A;  1RKE B;  1ZQU A;  4X0A A;  4IAQ A;  3PML A;  3TK0 A;  4NTF A;  1JN3 A;  3DZA A;  4I2D A;  4UB3 A;  3WFR E;  8ICS A;  4X4T A;  5B3I A;  1ZW3 A;  3MBG A;  1PCX A;  4E7S A;  2OEX A;  1TFO B;  1Y4C A;  4GQH A;  4MVR A;  3C2L A;  3AG1 C;  4PJL A;  3Q7L A;  2IHM A;  4KBL A;  2EIL C;  1BDJ B;  4JE9 A;  4DVZ A;  5HC9 A;  2PP4 A;  3NMI A;  2CYD A;  4PHD A;  3EGX A;  3JPT A;  2OU6 A;  3FAJ A;  3OUY B;  1VB5 A;  4DXW A;  5DBC A;  1BPY A;  3U3F A;  1I4Y A;  1M2V B;  4XEV A;  4N6C A;  3OGU A;  7ICT A;  1BPD A;  2ZPA A;  2QE9 A;  4K7B A;  4RT3 A;  4LEY A;  4OD5 A;  3O55 A;  5T3T A;  3ZG1 A;  4NXZ A;  3OWT A;  4QZI A;  2Y69 C;  5CFS A;  4WH5 A;  2ZH9 A;  5E3A A;  5L3V A;  3OWG A;  1G8X A;  1XSP A;  2L6G A;  1GQA A;  1JOG A;  3C7J A;  4LEW A;  3OVB A;  3C5G A;  2KNH A;  2R7W A;  3H2U A;  3POV A;  3ISB A;  4CSA A;  3LNR A;  1OCC C;  1LE2 A;  4NKT A;  3M1C B;  4O6M A;  1ORS C;  2NUT B;  4OIQ F;  4ZLD A;  1VYK A;  4O69 A;  4H4K C;  4K99 A;  3DMD A;  5J0P A;  3W4Y A;  2WZF A;  3GM3 A;  4QZF A;  2L7A A;  3K6B A;  1T6U A;  4F5P A;  2R03 A;  3UNG C;  2R7U A;  3HJC A;  5CP2 A;  3HTK C;  4PGY A;  4JJF A;  5IIO A;  2DB4 A;  4UAY A;  1HW1 A;  2HJ3 A;  3DAG A;  3L9D A;  4QZG A;  1H6G A;  5K0I A;  3AQN A;  2DYR C;  1FNT c;  1Z23 A;  3ER9 B;  4CJO A;  2HN2 A;  4IJJ A;  2IXN A;  1R8B A;  1VMA A;  4J7T A;  1QVX A;  2BPC A;  2X51 A;  2FMS A;  2L9J A;  1KEJ A;  3UXN A;  1XSL A;  3GM1 A;  2XS1 A;  1ZVZ A;  4QZ8 A;  5DEC A;  3ZTM A;  3QW0 A;  3SEO A;  3U0C A;  3UXP A;  2H7B A;  4QDL A;  3WOD F;  4DOZ A;  2YL7 A;  1Z6A A;  4YK5 A;  9ICS A;  4C3D A;  5GPG B;  1CGO A;  4F4B A;  3E9V A;  4FHV A;  2GAF D;  3C66 A;  4MTF A;  1YVI A;  2GAQ A;  5T1D B;  9ICU A;  4BEM J;  9ICV A;  3QW1 A;  9ICO A;  1FAP B;  1CPR A;  2Y3G A;  5J0O A;  1NFN A;  3M4B A;  4F5R A;  3RH4 A;  1JAJ A;  7ICS A;  1U6H A;  4OAF A;  3FOP A;  5B3S C;  3JSE O;  1ZHZ A;  4P4M A;  3Q6N A;  2O1P A;  2YL1 A;  9ICC A;  3AGT A;  4IG8 A;  3LES A;  2PX3 A;  4IGG A;  1MQ3 A;  2D4U A;  2M2W A;  2ZH8 A;  1QPU A;  1R8C A;  1MND A;  4MKP A;  2LSE A;  4PFO A;  5TZV A;  2XSE A;  3IEE A;  4I28 A;  1RZT A;  3TD7 A;  3NYL A;  5BQI A;  4YT4 A;  1VFG A;  2VB6 A;  2CNW A;  4Z9H A;  3NVO A;  4UB4 A;  2E87 A;  1OCO C;  4AT7 A;  3HKK A;  4ZLC A;  1C02 A;  4CIP A;  7ICM A;  5IIM A;  7ICF A;  3BEH A;  7ICI A;  2BBH A;  3TJ5 A;  3ISC A;  9ICE A;  4F5O A;  5A6A A;  5L0J A;  3X2Q C;  4YL3 A;  2J0W A;  4XPX A;  3RH6 A;  4UB1 A;  4DBR A;  2J9U A;  4P2H A;  4RQ3 A;  4E17 A;  1RKE A;  2ZH1 A;  3LNM B;  9ICI A;  3SXM A;  7ICN A;  1LIH A;  2VAN A;  4AL1 A;  3NKE A;  3AG3 C;  4O5K A;  3RJH A;  2RSE B;  1DOW A;  3O39 A;  3FVY A;  2LD6 A;  1A7D A;  1RXQ A;  5CFU A;  3W8H A;  8ICJ A;  2BCV A;  3GEI A;  1BPE A;  3MDC A;  4I2J A;  3ITF A;  4DRI B;  4NCQ A;  5CFT A;  2EPL X;  2ZD9 A;  4PR9 A;  3DM9 B;  1OU5 A;  5HRG A;  3ZVR A;  1SMY F;  1ZHY A;  4PH5 A;  5DQZ A;  1TWG A;  1HE9 A;  1G5Z A;  1N1C A;  4QZH A;  3OUY A;  2PFP A;  1BPX A;  4KI2 A;  4FWV A;  1BR4 A;  3RF3 A;  1NO5 A;  3FAP B;  1JR8 A;  4GXJ A;  1YA9 A;  1ZQE A;  4YJW A;  7ICL A;  3UGP A;  1Q79 A;  2AWC A;  2YWA A;  4KLL A;  1EKY A;  4MVS A;  1YYX A;  2HZ8 A;  4BJ5 A;  2HN1 A;  4HFK B;  5IIL A;  8ICZ A;  1LM3 B;  2HHP A;  4M04 A;  1ZHT A;  4QZE A;  4M9L A;  3EG9 B;  5J2J A;  5JS5 A;  5HRD A;  2P7V A;  3RQG A;  1O5H A;  2XL4 A;  1VOM A;  4XWJ A;  3KH2 A;  4QI2 A;  4W8K A;  2BL2 A;  4RD9 A;  3CSK A;  1ZU4 A;  5A6J A;  2G62 A;  3JSZ A;  3AQB A;  1J8Y F;  4X4U A;  8ICA A;  2XXA B;  1Z63 A;  2NPU A;  2Q4F A;  3EHN A;  1D1B A;  4RWO A;  3W2V A;  4OIO F;  1VJ7 A;  3V5Z A;  4WC1 A;  4NXW A;  2ISP A;  3MBY A;  5BQH A;  3RKO F;  3EZH A;  3SYN A;  4OAG A;  2B51 A;  1E2X A;  2AVK A;  4DVY P;  3KL4 A;  4Z6F A;  1XZP A;  2YQY A;  7ICP A;  4E0I A;  8ICL A;  3ZSU A;  8ICE A;  8ICQ A;  4EKW A;  3HLZ A;  4ER9 A;  4FAP B;  1XSN A;  2JX0 A;  3HIY A;  9ICA A;  256B A;  1ZQS A;  4UB5 A;  2WVO A;  5BOL A;  1NFO A;  2O5A A;  5JTG A;  2IYL D;  1MNE A;  2PBE A;  4WC6 A;  1I4Z A;  4IWB A;  4CDY A;  9ICH A;  1JQR A;  5DLJ A;  2X0C A;  2DR5 A;  4I2C A;  1ZW2 A;  4HFF B;  5D61 A;  1J8M F;  3L1M A;  5F28 E;  3W2W A;  2B56 A;  3H39 A;  2C03 A;  4UBC A;  5COF A;  3U9M A;  3JT1 A;  4PGX A;  4P6I C;  4UAW A;  3H65 A;  1PX5 A;  2XRH A;  5KYY A;  1YAR O;  3RFY A;  2J0X A;  4TUP A;  1TVA A;  1JRA A;  2OG2 A;  3EZI A;  4J30 B;  8ICC A;  4E0H A;  1MIV A;  3QVZ A;  1T6Q A;  8ICO A;  2ASR A;  2EPO A;  4UD4 A;  5J2H A;  1R5I D;  1QSP A;  4N7R A;  3T6G B;  5III A;  5HHI A;  3EH2 A;  4PHE A;  3JPQ A;  4R63 A;  4NKU A;  2WZG A;  5HRI A;  4EUK B;  4TUS A;  8ICF A;  3FDQ A;  2R7X A;  4NXT A;  3KPH A;  3TUL A;  4IB4 A;  4PHP A;  4RWN A;  3WFO A;  4MFC A;  4JTA B;  5HV9 A;  2VH3 A;  4JWN A;  8ICY A;  1FA0 A;  1NU9 C;  7ICQ A;  5J2A A;  4BJ1 A;  4R65 A;  3IQ5 A;  4O79 A;  1MQV A;  3NMK A;  5CWR A;  3RJF A;  3ABM C;  4AT7 B;  4K96 A;  4G7Z F;  4WC4 A;  4RQ2 A;  3HX0 A;  3GDX A;  3QTH A;  1ZQH A;  1ZQQ A;  5JRA A;  1LI7 A;  5J0Y A;  4KLE A;  1A0B A;  2DR9 A;  1OR2 A;  3RVZ A;  3G50 A;  4NY3 A;  2R7T A;  1Q0K A;  4RQ0 A;  3H3A A;  2MYS A;  4BG0 A;  2DGJ A;  4FX5 A;  5IIN A;  5JUA A;  2Y3H A;  9ICL A;  3RH5 A;  2EIJ C;  3C63 A;  4EIY A;  3VM6 A;  1FFH A;  4I2I A;  5BOM A;  4IAO A;  2IUB A;  2ZXO A;  4QZC A;  3TOM A;  4KLS A;  5CHG A;  4LEV A;  4CIH A;  1M2O A;  2QY9 A;  4A2N B;  4Q4Z F;  3PDM P;  2OJE D;  4DBQ A;  1R4T A;  2Y39 A;  1O3U A;  4CS8 C;  1TFK B;  3L8J A;  1B68 A;  3R7C A;  1H9G A;  3DKA A;  4RPZ A;  1UG7 A;  4X0B A;  5L0G A;  3V7O A;  1T01 A;  1BR1 A;  4KNW A;  4K9A A;  4QZA A;  1Z3I X;  4E80 A;  4YWQ A;  2M4E A;  4DRH B;  2H8A A;  5J2F A;  1U0B B;  4I2G A;  3RIP A;  1M6T A;  4E7Z A;  1LI5 A;  8ICU A;  4O6A A;  4X4Q A;  1TWA A;  4S3N A;  3AU2 A;  2VCB A;  4NM2 A;  3M4C A;  2HSB A;  3ABK C;  4F5N A;  9ICK A;  4EV6 A;  3NG1 A;  4KB6 A;  1XZQ A;  1T9K A;  1JAF A;  3NYJ A;  4BJ6 C;  2I8B A;  3UPQ A;  3WFS C;  4CS8 A;  4CDA A;  3JYY A;  3CK6 A;  4DRJ B;  2ZHA A;  3QMK A;  3K1I C;  4LEZ A;  3MFN A;  5DS5 A;  3DI5 A;  5DB7 A;  7ICH A;  3CEX A;  4NXX A;  4EWC A;  3KKB A;  1SR2 A;  3EG9 A;  2J9W A;  2IHO A;  4YN4 A;  3MGH A;  2HSQ A;  1G4W R;  1OW6 A;  9ICP A;  1F1M A;  2XXA A;  4FO1 A;  4U5G A;  2BCR A;  5J29 A;  4GYT A;  1DOV A;  7ICG A;  3N24 A;  2D5R B;  4K4G A;  2BCQ A;  2YKZ A;  2W9M A;  1HUO A;  1S7Z A;  1TKN A;  2KSF A;  1FMV A;  3SNH A;  2EPM X;  2DVI A;  4ANJ A;  4K9B A;  2RD9 A;  1VLT A;  3DJN B;  4XQ1 A;  2IXM A;  1OKK A;  3ISD A;  5D49 A;  1A41 A;  2WVN A;  2A6H F;  2NG1 A;  1BPZ A;  8ICV A;  3K75 D;  1V4A A;  2DR8 A;  2PXI A;  2Q7R A;  3OVA A;  5HRH A;  4KLT A;  4CDV A;  3TFR A;  2LFF A;  1ZQK A;  1RCP A;  1TWC A;  5J0T A;  1AUE A;  4K4H A;  3EFO B;  5KYY B;  1K05 A;  4CJG A;  3H2V A;  1BR2 A;  3LS0 A;  3F46 A;  4EBK A;  3GM2 A;  2B0H A;  5HRE A;  3AUO A;  2PFO A;  2ZH6 A;  1MIW A;  4C3E A;  3RH3 A;  1ZQW A;  2EWR A;  5HRL A;  3RQE A;  2LP4 A;  4IAR A;  1ZYR F;  2LK4 A;  1FFT C;  8ICK A;  2A1D D;  4GXK A;  4RQ1 A;  4NTB A;  7ICV A;  3K1H A;  2FMP A;  2P66 A;  2GA0 A;  3DE9 A;  2PX0 A;  3UQ2 A;  3C2M A;  1Q0M A;  3V7K A;  5JVE A;  2A0B A;  2YLG A;  3ZDL A;  1TV9 A;  3OEO A;  1YYJ A;  4JVS A;  3C18 A;  1TQG A;  4XJE A;  3EJN A;  2XL6 A;  1M57 C;  3WHN A;  2OKU A;  4WC7 A;  3MYI A;  1M56 C;  1OCZ C;  4WQK A;  9ICF A;  4XPY A;  4NXV A;  3IPM O;  1ZJN A;  2BCS A;  4GEH A;  4L6R A;  4I2H A;  5CA7 A;  1ZQP A;  3JRM O;  4PJM A;  2UUI A;  3DJU B;  3LUT B;  3M15 A;  4MF8 A;  3TQO A;  4C3B A;  4KC9 A;  1MMA A;  2OQM A;  3I4U A;  4PPX A;  5J2G A;  1H7I A;  2HKV A;  2Q66 A;  4WBY A;  3FOO A;  4I1M A;  4MND A;  2BC5 A;  3TFS A;  3HJ1 A;  3EH1 A;  3W8I A;  1WGW A;  1ZQL A;  4OIR F;  4PHA A;  3LEO A;  4BEJ A;  1TR2 A;  3RW0 A;  3J06 A;  5DKW A;  2FCL A;  2YLD A;  4ULV A;  8ICW A;  3GOD A;  4CS7 A;  5EGY A;  1XWJ A;  4EBB A;  2CDQ A;  1JPN A;  4LDQ A;  3S27 A;  8ICR A;  2HS5 A;  2GWS A;  4P9T A;  4K4I A;  1HE1 A;  5L0I A;  3DE8 A;  5B3P A;  2CNW D;  3NRH A;  5HRB A;  9ICW A;  4M9G A;  1FR0 A;  1K04 A;  3PHF 2;  3NKD A;  3L0I A;  4PFP A;  3US6 A;  4NLN A;  1L7C A;  9ICJ A;  2AU5 A;  2C04 A;  2BBJ A;  3GOR A;  2ZH7 A;  1QQ3 A;  4U5H A;  2YEV A;  4KM5 A;  3NYM A;  4X5V A;  4Z9I A;  3LK9 A;  1ST6 A;  3FXH A;  2ETS A;  4RQ8 A;  4NQF A;  2QLA A;  3A11 A;  4FH5 A;  1QKR A;  3S90 A;  5HRK A;  4YD2 A;  3AQK A;  5J2E A;  1D0Z A;  2WZL A;  4YCX A;  2AWY A;  4U5C E;  2R7R A;  2CCY A;  4DOC A;  1SYQ A;  1Q0G A;  2BCU A;  8ICB A;  3WFQ E;  4LDK A;  1Q78 A;  2OOC A;  3QVY A;  1OR3 A;  3U2L A;  5L0H A;  4JEA A;  3LEV A;  5AC5 A;  3SXY A;  3JPO A;  2R7V A;  2Q9C A;  3LLI A;  3RJJ A;  2L6H A;  2IOQ A;  4K1O A;  3MX3 A;  1EI7 A;  3MYF A;  4MW3 A;  3OA1 A;  3ZQY A;  1E84 A;  3G4Z A;  2LQG A;  4IQW A;  5DDY A;  2KGO A;  1LE4 A;  3ER8 C; 
#chains in the Genus database with same CATH homology
 4NKT A;  4WBZ A;  4WC4 A;  1K40 A;  4RQ2 A;  3HX0 A;  4NM1 A;  3GDX A;  4JWM A;  4NY8 A;  1ZQH A;  7ICU A;  1UET A;  1ZQQ A;  4FHW A;  1ZQF A;  2DRB A;  4I27 A;  5J0Y A;  4KLE A;  4FHP A;  4WCW A;  2KK1 A;  4EP7 A;  2DR9 A;  5J0P A;  8ICH A;  3GM3 A;  4QZF A;  3C5F A;  4RQ0 A;  3H3A A;  1RPL A;  2ZH3 A;  4F5P A;  5CJ7 A;  5IIN A;  1ZQN A;  8ICG A;  9ICL A;  5CP2 A;  3RH5 A;  1OW7 A;  3JPS A;  4PGY A;  1HUZ A;  4I2I A;  5IIO A;  5BOM A;  4UAY A;  2JPU A;  4QZC A;  3JZ0 A;  4KLS A;  5CHG A;  3L9D A;  5CB1 A;  5J2D A;  4UB2 A;  4QZG A;  9ICR A;  3AQN A;  4YMN A;  7ICE A;  4KLQ A;  5J2I A;  2Q00 A;  4PGQ A;  4AT9 A;  4YD1 A;  1O3U A;  5DB8 A;  4F5Q A;  1UFB A;  1R8B A;  5J0Q A;  1QVX A;  3L8J A;  3S9O A;  2BPC A;  3RJE A;  2FMS A;  4RPZ A;  9ICB A;  3RQF A;  9ICT A;  4LZD A;  3OVS A;  1KEJ A;  3UXN A;  3UPS A;  4X0B A;  3C2K A;  3PNC A;  3NYB A;  1XSL A;  3GM1 A;  2BPG A;  4QZ8 A;  9ICG A;  5DEC A;  4P4O A;  8ICX A;  3U0C A;  3UXP A;  1ZQG A;  4QZA A;  4E80 A;  4QZB A;  9ICS A;  5J2F A;  1KTM A;  4I2G A;  4FHV A;  3C66 A;  8ICU A;  4LT6 A;  4X4Q A;  4XEF A;  3AJM A;  9ICU A;  4S3N A;  3AU2 A;  9ICV A;  9ICO A;  1R89 A;  4NM2 A;  3JPR A;  5DBA A;  3HWT A;  2HSB A;  4F5N A;  9ICK A;  5J0O A;  4FHX A;  1R8A A;  8ICP A;  4UD5 A;  3UPQ A;  4YMO A;  4KLI A;  4F5R A;  3RH4 A;  3WFS C;  4RQ4 A;  5J0R A;  5BPC A;  1JAJ A;  7ICS A;  3JYY A;  2ZHA A;  3V7J A;  3LQC B;  2NRK A;  4P4M A;  2O1P A;  1F5A A;  3MFN A;  4XEK A;  3RJG A;  2L6F A;  3AU6 A;  5DB7 A;  7ICH A;  9ICC A;  9ICX A;  5D46 A;  3V72 A;  4IG8 A;  1ZQJ A;  4XA5 A;  4YN4 A;  4RT2 A;  1MQ3 A;  1PV3 A;  2M2W A;  3MGH A;  2ZH8 A;  1R8C A;  3PMN A;  4MF2 A;  4UAZ A;  1ZQD A;  5TZV A;  1OW6 A;  9ICP A;  4WC0 A;  1MQ2 A;  4XQ8 A;  4I28 A;  4MFF A;  1RZT A;  4TUQ A;  4WC5 A;  1VFG A;  3C8G A;  4NLK A;  9ICQ A;  7ICJ A;  4TUR A;  4KLG A;  2BCR A;  4UB4 A;  2ISO A;  5F2V O;  5IIJ A;  4GXI A;  4AT7 A;  5DDM A;  4X4S A;  5J0W A;  2M2T A;  5J29 A;  7ICG A;  3K7D A;  4X4R A;  4LZG A;  7ICM A;  5IIM A;  4I29 A;  7ICF A;  4K4G A;  2BCQ A;  2BE3 A;  7ICI A;  2W9M A;  4RQ5 A;  1ZJM A;  1HUO A;  2BPF A;  1YLQ A;  3ISC A;  1ZQA A;  9ICE A;  4F5O A;  8ICM A;  2FMQ A;  1UEV A;  4Z6D A;  3MDA A;  1ZQZ A;  2ID1 A;  8ICI A;  2DVI A;  8ICT A;  4KLO A;  1ZQR A;  4O5E A;  4M2Y A;  3RH6 A;  3ISD A;  4UB1 A;  1ZQY A;  5HR9 A;  4I2A A;  5D49 A;  4KLJ A;  3OV7 A;  4XUS A;  4I2B A;  4P2H A;  1ZQT A;  4RQ3 A;  2ZH1 A;  1BPZ A;  1ZQM A;  9ICI A;  8ICV A;  3K75 D;  1V4A A;  2DR8 A;  7ICN A;  2PXI A;  3OVA A;  4KLD A;  5HRH A;  4KLT A;  2VAN A;  5J0S A;  5J2B A;  3TFR A;  3V7L A;  4O5K A;  3RJH A;  4IQV A;  4X4O A;  4AT9 B;  1ZQB A;  3H37 A;  1ZQK A;  8ICJ A;  2BCV A;  1BPE A;  3MDC A;  4I2J A;  3C8G D;  5J0T A;  4X4N A;  3RJK A;  3MGI A;  4K4H A;  4IQT A;  1UEU A;  1K05 A;  4RQ6 A;  1BPB A;  1OW8 A;  4XQ7 A;  4FH3 A;  1OU5 A;  2RFF A;  5HRG A;  2DR7 A;  4PH5 A;  4EBK A;  3GM2 A;  1ZQC A;  4DOB A;  2M2V A;  5HRE A;  3AUO A;  3HJ4 A;  4O9M A;  2PFO A;  4KLU A;  3BRJ A;  2ZH6 A;  1MIW A;  1KDH A;  1ZQW A;  1MIY A;  4RPX A;  1ZQI A;  4QZH A;  3OUY A;  3RJI A;  2PFP A;  4O5C A;  1BPX A;  5HRL A;  3RQE A;  4WC2 A;  1NO5 A;  4AT8 A;  2LK4 A;  4Z6C A;  4ATB B;  8ICK A;  4RQ7 A;  4KLF A;  4GXK A;  4RQ1 A;  4FHY A;  4GXJ A;  1ZQE A;  7ICL A;  7ICV A;  1WTY A;  4R66 A;  1Q79 A;  2YWA A;  2FMP A;  4KLL A;  4FO6 A;  2P66 A;  5DB6 A;  5DB9 A;  4RWQ A;  4MFA A;  4M47 A;  3UQ2 A;  1TFW A;  3C2M A;  4R64 A;  4DOA A;  3V7K A;  5IIL A;  4WC3 A;  8ICZ A;  1TV9 A;  2I9G A;  9ICN A;  2HHP A;  4M04 A;  5EOZ A;  4QZE A;  4M9L A;  5J2J A;  5HRD A;  3C18 A;  1KNY A;  2ZH5 A;  3RQG A;  4QZ9 A;  9ICM A;  4DO9 A;  2ZH4 A;  5DED A;  1ZQV A;  4WC7 A;  4X4U A;  8ICA A;  9ICF A;  3B71 A;  4NLZ A;  4M9H A;  3C8G B;  4RWO A;  1ZJN A;  4X4P A;  5J0U A;  2BCS A;  1VJ7 A;  4WC1 A;  5J0X A;  2ISP A;  3MBY A;  5IIK A;  2PFN A;  1ZZP A;  1WWP A;  4I2H A;  5CA7 A;  1ZQP A;  5J2K A;  4Z6F A;  4RWP A;  4MF8 A;  5HHH A;  7ICP A;  8ICL A;  4M9N A;  7ICO A;  8ICE A;  4PPX A;  8ICQ A;  4I2E A;  1XSN A;  3B0X A;  2M2U A;  2JX0 A;  5J2G A;  4IQU A;  1WOT A;  2Q66 A;  3HIY A;  4WBY A;  3O10 A;  4M5D A;  3TFS A;  3HJ1 A;  9ICA A;  1ZQS A;  4KLM A;  4UB5 A;  1TFY A;  1NOM A;  3UXO A;  4RPY A;  1ZQL A;  5BOL A;  4UBB A;  4M9J A;  7ICR A;  4PHA A;  2O5A A;  3HW8 A;  2PBE A;  4WC6 A;  5J2C A;  3H38 A;  4LVS A;  4YMM A;  5DKW A;  1ZQU A;  4X0A A;  3PML A;  5HRF A;  9ICH A;  1JQR A;  8ICW A;  1JN3 A;  4XRH A;  2DR5 A;  4I2D A;  4UB3 A;  4KLH A;  8ICR A;  4I2C A;  3WFR E;  8ICS A;  1WOL A;  4X4T A;  2GWS A;  7ICK A;  4K4I A;  1ZQO A;  5HRB A;  3L8I A;  5F28 E;  9ICW A;  4M9G A;  3H39 A;  1K04 A;  4UBC A;  5CR0 A;  3C2L A;  4PGX A;  4UAW A;  2IHM A;  4R32 A;  1PX5 A;  3WFP A;  4NLN A;  9ICJ A;  2ZH7 A;  4TUP A;  4X4V A;  1TVA A;  5HC9 A;  4PHD A;  4M0A A;  3JPT A;  2ZHB A;  4X5V A;  8ICC A;  3LK9 A;  3AQM A;  3OUY B;  2DRA A;  4EBJ A;  1MIV A;  4RQ8 A;  8ICO A;  3UQ0 A;  4NQF A;  4UD4 A;  5DBC A;  5J2H A;  1BPY A;  3U3F A;  3AQL A;  4FH5 A;  4AT8 B;  4Z6E A;  4XEV A;  5HRK A;  4YD2 A;  3AQK A;  5J2E A;  4E8F A;  4QZD A;  3OGU A;  5III A;  7ICT A;  4ATB A;  5HHI A;  4YCX A;  1BPD A;  5D4B A;  4PHE A;  3JPQ A;  5DBB A;  4DOC A;  4RT3 A;  2BCU A;  4R63 A;  8ICB A;  4NKU A;  5HRI A;  3JPN A;  4P4P A;  4E7X A;  4TUS A;  3WFQ E;  8ICF A;  1ZQX A;  1Q78 A;  4NXZ A;  3TUL A;  4QZI A;  4PHP A;  4RWN A;  3WFO A;  3JPO A;  3B0Y A;  2ZH9 A;  2ZH2 A;  4MFC A;  2PFQ A;  1XSP A;  8ICN A;  3RJJ A;  2L6H A;  4JWN A;  8ICY A;  2L6G A;  1FA0 A;  1JOG A;  7ICQ A;  5J2A A;  4I2F A;  4R65 A;  3OVB A;  3C5G A;  4IQW A;  5CWR A;  5DDY A;  3RJF A;  4AT7 B;  3JPP A;  3ISB A;  1JMS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...