3JZ0A

Linb complexed with clindamycin and ampcpp
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
266
structure length
266
Chain Sequence
LKQKELIANVKNLTESDERITACMMYGSFTKGEGDQYSDIEFYIFLKHSITSNFDSSNWLFDVAPYLMLYKNEYGTEVVIFDNLIRGEFHFLSEKDMNIIPSFKDSGYIPDTKAMLIYDETGQLENYLSEISGARPNRLTEENANFLLCNFSNLWLMGINVLKRGEYARSLELLSQLQKNTLQLIRMAEKNADNWLNMSKNLEKEISLENYKKFAKTTARLDKVELFEAYKNSLLLVMDLQSHLIEQYNLKVTHDILERLLNYISE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and mechanism of the lincosamide antibiotic adenylyltransferase LinB.
pubmed doi rcsb
source organism Enterococcus faecium
molecule tags Transferase/antibiotic
molecule keywords Lincosamide nucleotidyltransferase
total genus 106
structure length 266
sequence length 266
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.330 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Nucleotidyltransferases domain 2 3jz0A02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 3jz0A01
4I2DA 3HJ4A 7ICKA 1HUZA 5IIMA 2M2VA 3PMNA 5J2JA 5J0WA 4RT3A 9ICKA 4TURA 3B71A 3UXOA 4NQFA 4IG8A 4X4OA 4X0BA 4M9HA 4KLQA 4P2HA 2LK4A 4X4UA 2BCQA 9ICCA 2NRKA 4AT8B 5CHGA 4F5NA 5IIKA 4M9LA 7ICQA 5IINA 5J0RA 3AU2A 3NYBA 2DR8A 4X4SA 2ZHAA 2ZH5A 1ZQJA 3ISBA 1ZQDA 1K04A 2ISOA 4YD2A 2BCSA 4RQ6A 1ZQVA 3H39A 7ICPA 4K4GA 4NKUA 7ICUA 7ICOA 4UD4A 4UB4A 1ZZPA 4FH3A 1ZQZA 8ICTA 4S3NA 1MQ2A 4QZDA 2BCRA 4MFFA 9ICEA 4RQ5A 1BPYA 8ICXA 4M04A 4K4HA 5DB6A 4X0AA 9ICMA 4R66A 2ID1A 4X4NA 4F5OA 4WC1A 5J2IA 4NLZA 1BPEA 4RQ3A 2ZH4A 5HRGA 5J2HA 4F5QA 2FMSA 4KLUA 3UXNA 4Z6EA 8ICAA 9ICQA 5HRDA 3H37A 2HHPA 9ICOA 1ZQNA 1KEJA 2IHMA 4I2CA 4M9NA 3OVSA 5J2GA 1ZQEA 8ICNA 4EBJA 4WBZA 4KLEA 3RQFA 4X4VA 7ICFA 3AQMA 3C2MA 1NOMA 3K7DA 4RPYA 2M2TA 2PFNA 3GDXA 4WBYA 5DKWA 4IQTA 5J0SA 5CJ7A 4YMMA 4KLJA 2L6FA 4TUQA 5J0PA 5DBAA 9ICPA 4XA5A 2DR7A 3RH6A 2ISPA 4AT7B 4KLHA 1MIWA 1BPZA 2DRBA 5J2CA 1XSNA 3WFRE 2FMQA 4IQUA 1ZQPA 4QZCA 4PGYA 3RH4A 3AJMA 1ZJNA 3MBYA 7ICGA 4UAZA 2BCUA 4JWNA 1V4AA 4PHAA 5CR0A 5J0UA 4AT9B 4QZAA 3WFQE 4FO6A 4PHPA 8ICVA 3MFNA 5HRIA 9ICRA 2JPUA 3UXPA 3RQGA 9ICBA 5HRFA 3JYYA 1F5AA 4QZIA 4NM2A 5HC9A 8ICPA 4RQ2A 1ZQFA 4I2GA 4FHXA 4WC3A 2BPCA 4AT9A 5DB9A 3HX0A 4GXKA 4KLLA 1OW6A 1TVAA 5J0XA 4DOCA 3LQCB 3WFPA 4R63A 3ISCA 1MQ3A 3UPSA 4RQ1A 7ICSA 4MF8A 2BPGA 3RJEA 4GXIA 5CWRA 4E80A 3U0CA 4NM1A 1WOTA 4RQ0A 7ICLA 1PX5A 8ICQA 2M2UA 1UFBA 4LZDA 3V72A 1ZQMA 9ICSA 7ICIA 2PFOA 7ICMA 4FH5A 1VFGA 4UBCA 3JZ0A 3PMLA 4ATBA 2PFQA 1JOGA 4PH5A 4UD5A 1R8CA 4QZBA 3C2LA 9ICXA 8ICWA 4MFCA 5DDYA 4YD1A 4WCWA 1MIYA 8ICFA 9ICGA 4Z6FA 4DO9A 2RFFA 3V7JA 5DECA 1ZJMA 1R89A 7ICTA 4KLFA 3V7KA 4FHYA 4NXZA 4YCXA 5DEDA 3H38A 5J0TA 5CP2A 4FHPA 1JN3A 2ZH8A 4RWQA 5DBBA 1UEUA 3JPTA 4QZ9A 1ZQSA 1OW7A 1R8BA 4LT6A 1WWPA 4M2YA 3MDCA 9ICLA 1XSPA 4UAYA 4R32A 2ZH2A 1KDHA 2O5AA 3OUYB 2Q66A 1TV9A 4I2EA 2FMPA 3RJFA 5HR9A 2DRAA 1ZQIA 4XQ8A 3UPQA 3UQ0A 5J2AA 3RJIA 3AQNA 3C2KA 4WC2A 1QVXA 5DDMA 4RPXA 3GM3A 2ZH9A 2GWSA 9ICFA 4FHVA 4X4TA 3HIYA 1ZQYA 4AT7A 1NO5A 4M47A 5J2KA 3K75D 4YMOA 3RJGA 9ICJA 2BPFA 3C5FA 2DR9A 5EOZA 4RWNA 7ICHA 8ICIA 5J0QA 7ICVA 4RQ8A 1HUOA 4O9MA 4EP7A 5CA7A 4WC5A 4MF2A 9ICIA 8ICZA 1RZTA 4X4QA 3C8GB 3GM2A 4P4MA 5J0YA 3L9DA 3HWTA 1Q79A 5HREA 3OVBA 3C8GA 1ZQCA 9ICTA 4X5VA 4NLNA 8ICRA 1KNYA 3JPQA 8ICBA 5HHHA 5HRLA 5J2FA 1UEVA 5IIJA 2ZH1A 4XEVA 2ZH3A 3H3AA 4DOBA 3ISDA 2I9GA 1MIVA 4I2IA 4QZHA 4I2AA 3HW8A 2YWAA 7ICEA 4WC4A 4I27A 1ZQTA 4YN4A 1ZQOA 4X4RA 3RJHA 4UB1A 2ZHBA 8ICHA 5D46A 7ICJA 5IIIA 1TFWA 1ZQHA 3V7LA 3MGIA 4M0AA 3AQLA 5BOMA 4NY8A 1FA0A 4WC0A 2HSBA 8ICUA 7ICRA 4FHWA 4UAWA 3JPOA 1ZQBA 3JPNA 8ICCA 5J29A 3L8JA 4PGQA 4I2FA 4PHDA 1JMSA 3RQEA 3OUYA 4DOAA 4Z6DA 4KLSA 5HRKA 1ZQAA 4M9GA 4AT8A 5IILA 3WFOA 5HHIA 4KLMA 5D49A 7ICNA 4XEFA 1RPLA 4M5DA 5CB1A 3C5GA 4O5CA 9ICWA 4EBKA 1BPBA 3TFSA 4I2JA 4XEKA 5F28E 2PFPA 8ICMA 1PV3A 4I28A 3OGUA 2JX0A 1OU5A 1ZQXA 3JPPA 4KLOA 3TFRA 9ICUA 8ICEA 3OV7A 1BPDA 4X4PA 4YMNA 4NKTA 1ZQUA 3TULA 3C8GD 1KTMA 3U3FA 5BOLA 4M9JA 4Z6CA 4I29A 1YLQA 1WOLA 4PHEA 8ICLA 5DB7A 4JWMA 4KLTA 4XQ7A 3L8IA 3GM1A 3WFSC 2P66A 4LVSA 2VANA 4RWPA 2DVIA 3OVAA 1O3UA 3JPRA 2BE3A 4NLKA 1ZQQA 3C66A 4P4OA 3O10A 8ICJA 1JAJA 5DBCA 4QZEA 5D4BA 4KLDA 3S9OA 8ICOA 4WC7A 4IQWA 1ZQRA 1ZQKA 3HJ1A 4LZGA 2M2WA 3AU6A 2KK1A 4ATBB 5F2VO 4RQ7A 4GXJA 1BPXA 3PNCA 2PXIA 1Q78A 4QZGA 5BPCA 4KLGA 4MFAA 1OW8A 9ICHA 4UBBA 4PPXA 1WTYA 1VJ7A 3RJJA 1R8AA 4I2HA 1XSLA 5J2BA 4O5KA 1UETA 2Q00A 2L6GA 3MDAA 8ICGA 3RJKA 3B0XA 4E8FA 5HRHA 4TUPA 4I2BA 3BRJA 2W9MA 3JPSA 5J2DA 4WC6A 1ZQWA 4RT2A 2ZH7A 4RQ4A 1ZQLA 3C18A 5IIOA 2BCVA 4P4PA 4F5PA 4TUSA 9ICVA 1ZQGA 5HRBA 4QZ8A 3LK9A 2ZH6A 2PBEA 4K4IA 8ICKA 5DB8A 4RPZA 2DR5A 4PGXA 4XUSA 4R65A 4O5EA 2O1PA 4IQVA 4E7XA 3AUOA 4UB3A 4UB5A 1JQRA 4KLIA 1K40A 9ICAA 4QZFA 3UQ2A 4UB2A 5TZVA 1K05A 5J0OA 4R64A 2L6HA 4F5RA 5J2EA 1TFYA 8ICSA 8ICYA 9ICNA 4RWOA 3RH5A 4XRHA 3B0YA 3MGHA 3AQKA
chains in the Genus database with same CATH superfamily
4NXVA 4K99A 4K0DA 5AC5A 3NMJA 2EIKC 3W2WA 5J0WA 3B71A 3UXOA 2WZGA 3EGDB 3EZHA 4OINF 4O68A 3FVYA 2EPKX 4KLQA 4AE4B 4Q4ZF 2EPNA 2BC5A 2YVKA 2BCQA 9ICCA 4FWVA 3UGPA 3NKDA 3QW0A 7ICQA 4MTFA 3CK6A 3ZQVA 5KYYB 3NYBA 2ZH5A 2G3KA 4IAOA 2I8BA 5KYXB 2B56A 1CGME 4RQ6A 2W9YA 2EPOA 2X0CA 1RKEB 3LAYA 1ZZPA 1ZW2A 4OIQF 2XLDA 4MVOA 8ICXA 3EGXB 1JR8A 3U2MA 1M56C 2G3VA 4F5OA 3QW1A 4NLZA 2Q9AA 3K6BA 3ZTMA 8ICAA 3VF0A 1T01A 2WVNA 4JKVA 5J2GA 2Y39A 4KLEA 2HN2A 2GAQA 3CQZA 4C3BA 1H9TA 4X4VA 4CX9A 1LS4A 1NOMA 5JT4A 4WBYA 4G0HA 5KYXA 4IQTA 5CI8A 5DKWA 1OR2A 3ECSA 4YMMA 2A69F 2L6FA 3TQOA 1A7DA 3GODA 4KLHA 1MIWA 1NSGB 3VRCA 5FCLA 2R7WA 3FAPB 1U89A 1ZQPA 4PGYA 4CDYA 3IQ6A 4JWNA 2A1DD 1LS1A 1V4AA 5CR0A 4QZAA 1LIHA 4FO6A 3EG9A 3RKOF 3MFNA 1KU2A 4IARA 4Q7CA 4U5GA 5EK0A 3UXPA 1BR1A 5HRFA 4O6AA 3U9MA 4C7OA 4RQ2A 1ZQFA 4FHXA 2BPCA 4YN0B 1TVAA 2KNHA 5B3IA 1VYIA 3WFPA 4MF8A 5HV9A 4GXIA 4E80A 3H65A 1L3PA 3TJ5A 1WOTA 1UFBA 3V72A 1VFGA 3IEEA 4CS7A 3PMLA 1JOGA 4PH5A 2XXAA 4UD5A 2XXAB 4MVQA 3DAGA 2NUTA 4DBQA 8ICWA 4MFCA 1MIYA 8ICFA 4Z6FA 4DO9A 3V7JA 2GDCA 2R7QA 3U3BA 7ICTA 3QZCA 1MMAA 4FHYA 5E33A 2GA0A 2R7VA 5DEDA 3H38A 4NTBA 4FHPA 1ZW3A 4QDLA 2P7VA 5DBBA 1FTSA 3ZSUA 4ONSA 1FR0A 2OJED 1JMWA 1WWPA 2UUHA 4M2YA 4CS8C 1MQVA 4CSAA 4I1OB 1BZ4A 3SEOA 4R32A 3GEHA 3S29A 2ZH2A 3FAJA 3W4YA 5L0GA 3ZC4A 2V26A 1ZQIA 2XS1A 2HZ8A 4XQ8A 3UQ0A 3RJIA 3RF3A 3AQNA 1M2VA 1QQ3A 4FHVA 3UNGC 4X4TA 4OAFA 4PFPA 2J9BA 2ZXRA 1D1BA 3SYNA 2P0NA 3JT1A 3CSKA 1Z63A 4OIOF 3HNKA 2DR9A 5L3QA 4P9FA 5J0QA 9ICIA 3IHUA 4JRZA 3L9DA 3HWTA 9ICTA 4X5VA 3T6GB 2VCAA 1KNYA 2PX0A 1IW7F 3I5QA 5JP7A 4JVSA 5HHHA 5J2FA 4H54A 2ZH3A 3H3AA 3HW8A 2HV7A 4E7SA 4K9BA 3JCUQ 3NYJA 5D46A 3ABMC 2LSEA 3KH2A 3NWIA 3MGIA 2GAFD 4RD9A 3AQLA 3RVYA 3NMKA 1G4US 4FAPB 1FA0A 2HSBA 7ICRA 3VM6A 4UAWA 3JPOA 2IBFA 1JMSA 3RQEA 4CS8A 4DOAA 1Q0DA 1E86A 5HRKA 1C02A 1ZU5A 1BR4A 4KLMA 7ICNA 3B0UX 4EBKA 1BPBA 4A4AA 4I44A 2X51A 3AOUA 5CHEA 4EV6A 3OGUA 2JX0A 1OU5A 4KLOA 4GYTA 1YYXA 9ICUA 4J7TA 4HE8D 4YT5A 3OV7A 4PR9A 3AGTA 4O6NA 4O6MA 1XZPA 4MW8A 3SXZA 4I29A 4PHEA 8ICLA 3FMSA 4BJ5A 4KLTA 4XQ7A 4LVSA 2PFDA 3A9CA 4XJEA 2ZD9A 2KSFA 5KYUB 1O3UA 4N7RA 4LACB 3C66A 4QZEA 3S9OA 2NUTB 1ZQKA 4LZGA 5DLJA 3RVZA 4U5HA 5F2VO 1BPXA 2WZFA 4WH5A 4KLGA 4E0IA 1VMAA 2OOCA 1RJ9A 4UBBA 4PPXA 3VYWA 1CGOA 3ASNC 3NKEA 4I2HA 2AWYA 3AGUA 5J2BA 2L6GA 8ICGA 3RJKA 3B0XA 4TUPA 4DVYP 3W8IA 3ABLC 3T6JA 2RD9A 1OQCA 1ORJA 3UMKA 3JPSA 4WC6A 4RT2A 2ZH7A 4BJ6A 3EGXA 3SNHA 1M57C 2V3CC 4E18A 4P4PA 4F5PA 5HRBA 2OCCC 3DWWA 1I4YA 4RPZA 4U5FE 2IHOA 2DR5A 4XUSA 4R65A 1OKKA 3MX3A 4O5EA 4YT8A 1V54C 2YRFA 4QZFA 2BL2A 4KNWA 4MVRA 4IWBA 4R64A 5J2EA 5COFA 2P6VA 8ICYA 2OG2A 1FFTC 3HJ4A 1HUZA 5FZTA 5IIMA 2M2VA 2Q4FA 5J2JA 3KPHA 9ICKA 4U5BE 4TURA 5B1BC 3MLGA 4JZAA 4PJLA 1NG1A 2GFHA 4M9HA 4LLEA 4X4UA 3GEIA 4IB4A 2KW3C 4CS9C 2MWQA 3MCRA 4AT8B 5CHGA 2ZXPA 3DE8A 4CIPA 3H2UA 4F4BA 4X4SA 3ISBA 1ZQDA 1K04A 2ISOA 3IQTA 3SXKA 4X0RA 1ZQVA 3PCVA 1ZHTA 3F46A 4FX5A 4MNDA 2XSEA 1GGQA 4U5EE 2CDQA 4RQ5A 4M04A 3I4UA 9ICMA 2HMQA 4LDRA 3US6A 2BBJA 2LCHA 2PP4A 4P6IC 1D1CA 4XPWA 1V74B 4WC1A 1BPEA 4RQ3A 5J2HA 4F5QA 2FMSA 4KLUA 4NY3A 1EQ1A 4YK5A 9ICQA 2IUBA 1KEJA 4I2CA 2DYSC 1C17M 8ICNA 4EBJA 2A68F 1CPRA 3C2MA 1JRAA 3K7DA 2M2TA 4WQLA 2PFNA 2LP4A 2UUIA 5J0SA 1VOMA 2AWCA 4TUQA 3L1MA 5T1DB 9ICPA 4XA5A 2DR7A 4MVMA 3RH6A 1VYKA 4AT7B 4E17A 1XSNA 2OEXA 3WFRE 2YLIA 3JSEO 1ZVZA 4QZCA 3AJMA 4G7OF 1D1AA 3JYHA 7ICGA 4UAZA 3ER9B 2BCUA 4JCZA 3WFQE 4MVSA 1NFNA 1SZIA 4XQ1A 2YKZA 1FMWA 1F5AA 1H7IA 4LDQA 1GS9A 8ICPA 1HE1A 3SZRA 4CSAC 1HE9A 3ATPA 5J0XA 4DOCA 4JEBA 3ISCA 3RJEA 1QLEC 1O87A 2CNWD 3EFOA 4RQ0A 9ICSA 3LESA 7ICIA 2XLHA 2PFOA 2PNOA 3JZ0A 2IXMA 3N0TA 4MKPA 2WVOA 1OXBA 1T5OA 1R8CA 3C2LA 3DMDA 5A6AA 1WN0A 9ICGA 2WVQA 3R7CA 1ZHWA 2XLEA 5DECA 1TQGA 1TWHA 4CDVA 3V7KA 2Q9CA 4NXZA 5J0TA 2H8AA 1YJGA 3AQBA 1YDIA 2EILC 1I5NA 5CIVA 2J7PA 2BBHA 1G5ZA 4N06A 1HY5A 1KDHA 3G4XA 2RSEB 3FHDA 1GPJA 4PJNA 2NUPA 2FMPA 2DB4A 3EJNA 2DRAA 4IGGA 1AEPA 2B51A 4FO1A 4DBRA 1W2WA 4WC2A 5KYUA 4RPXA 3GM3A 9ICFA 3MYFA 3HIYA 1ZQYA 1M6TA 4AT7A 2J0XA 1NO5A 4M47A 4O6YA 3K75D 4YMOA 3JTLO 3RJGA 9ICJA 2JD3A 2YLGA 4NTAA 2B0HA 4MVZA 5A6BA 3C5FA 8ICIA 5IY5C 3LJBA 4RQ8A 4O9MA 4EP7A 4WC5A 4JURI 4BG0A 256BA 4J30B 2NUPB 3GM2A 4P4MA 5J0YA 2FGYA 3DJNB 5A69A 1YLMA 1LI5A 2Q3TA 2B0JA 3C63A 4PJMA 1LVKA 5HRLA 2ZH1A 4XEVA 3DAFA 4CBEA 2I9GA 4AE4A 1YA9A 4I2AA 7ICEA 1FMVA 2LQGA 8ICHA 3EF2A 3X2QC 2ASRA 2LFFA 3U8PA 1YAUO 2HS5A 5D91A 5DS6A 3PMRA 1RKCA 8ICCA 1SF8A 3L8JA 2CNWA 3U5SA 3V5YA 2R03A 1NBBA 3OUYA 2KGOA 3G50A 4KLSA 1AVOB 3WFOA 2P1AA 5D49A 1MNDA 5CB1A 9ICWA 1NLXA 3TFSA 3EH2A 3O6XA 3I5PA 3S84A 3DZAA 2PFPA 2QLAA 2LIGA 3WHNA 3LLIA 4I28A 2Q9BA 4X4PA 3A11A 2KYHA 1MMGA 4NKTA 4YJWA 3M1CB 2OU6A 3EH1A 3U3FA 1JPNA 5BOLA 1NU9C 3UGOA 4CIHA 3RIPA 1YA7O 3G4ZA 2YL3A 4JWMA 1ZHZA 3L8IA 1EA8A 2C04A 3GM1A 2VANA 3ZDLA 4RWPA 2TMVP 2DVIA 3OVAA 1PD0A 1LI7A 3Q7LA 3JPRA 2BE3A 1ZQQA 1JAJA 5DBCA 4PFOA 3CEXA 2HUJA 4I0UA 4IQWA 4LDKA 2XL4A 2W45A 2A0UA 2M2WA 1J8MF 4C7OB 3POVA 2P61A 3PNCA 2PXIA 1Q78A 4L6RA 4QZGA 4JLXA 1OCCC 9ICHA 2HFIA 2VCCA 1VJ7A 4YT2A 3HTKC 3Q7GA 3RJJA 3CZ6A 4LEZA 4WJ0A 1XZQA 5D61A 5TJ5E 2ICWG 2Q00A 3TJ6A 2J0WA 3OWTA 1LKXA 4E8FA 1RJ9B 4FESA 4I2BA 1Y6DA 2A6EF 3K1IC 4N6HA 4DRHB 3HJCA 1ZQLA 3AG4C 1A0BA 1ZQGA 2ZH6A 2PBEA 3B0VC 2F22A 1HW1A 2LFDA 2J7PD 5DB8A 2HN1A 4PGXA 2O1PA 4E7XA 3KKBA 3N2ZB 3AUOA 4UB5A 4Q5SF 1K40A 3GANA 3QTHA 2L81A 2ZPAA 5J0OA 1TFYA 8ICSA 4MVUA 9ICNA 2C03A 3RH5A 1E85A 4M63A 2R7OA 3AQKA 2R9RB 4C3EA 4I2DA 2NSGA 4DJ9A 7ICKA 4PACA 4B6IA 1BR2A 2D4UA 1SYQA 2XM4A 2W4MA 3NKUA 4RT3A 4OD4A 4K97A 4NQFA 4BJTA 4IG8A 4EHPA 4X4OA 3Q6MA 4U5CE 3IQCA 5DS4A 3K1IA 4JW1A 2IXPA 3K33A 4P2HA 4ULWA 3AG2C 3GWLA 3JRMO 4UDVA 4Z9JA 1OKKD 3S0XA 4F5NA 3RW0A 5IIKA 2YL1A 5IINA 5J0RA 1LE4A 4G78A 4RDAA 2ZHAA 1WASA 1ZQJA 3BEHA 2VB6A 1Q0GA 1VLTA 1J8YF 1LM3B 4DRJB 5E2QA 4NKUA 3JCFA 4UD4A 2XL8A 1Z6AA 4FH3A 3AG3C 2XS8A 1ZQZA 4JEAA 8ICTA 3AQCA 1MQ2A 2BCRA 4QZDA 4MFFA 1QSPA 9ICEA 1BPYA 1HMOA 2EINC 4U9DA 3DM9B 2Y69C 3J06A 3ZG1A 4X4NA 5J2IA 5JS5A 5JTGA 2ZH4A 4JTCB 3UXNA 4Z6EA 4MS2A 3EZIA 3FXHA 3H37A 9ICOA 1MMDA 4M9NA 4MTGA 4YWQA 5BUOA 4Z9HA 1RKEA 2YEVA 3AQMA 3V7OA 2OKUA 4RPYA 3SXYA 5HSWA 1IZMA 2G62A 2HJMA 3GDXA 5F5HA 4O69A 5CJ7A 3LLKA 3NYMA 5J0PA 3NDBB 5DBAA 1G4WR 4AK9A 4AL0A 3LNMB 4CJOA 4DOZA 1BPZA 2XLOA 4Z9IA 2CGEA 4EUKB 1SR2A 4K7BA 3MBYA 1ST6A 3WODF 1OR3A 2XL6A 2QUPA 3KL4A 4AT9B 5J0UA 4EBBA 3ZQYA 1T9KA 5B3PA 2JPUA 4AL1A 3EHMA 1Z7Qc 9ICBA 3JYYA 5HC9A 4MTOA 4EGWA 2YL0A 4N6CA 4KI2A 5BQHA 1CPQA 2WB7A 3QVYA 4AT9A 3HX0A 4GXKA 4KLLA 3LQCB 4R63A 3LUTB 7ICSA 2BPGA 5CWRA 3EFOB 4H4KC 3O55A 4NM1A 1SMYF 4WOYA 7ICLA 1PX5A 2YLDA 2M2UA 1ZQMA 4ZLCA 3HLZA 7ICMA 2NSFA 4FH5A 1QKRA 4UBCA 2ETSA 3V5XA 4ATBA 4YT4A 2HV6A 3E9VA 3FOOA 1A41A 5T3TA 4IJJA 4WABA 2IXNA 2Y3GA 4WCWA 2RFFA 1T6IA 1ZJMA 3ER8C 1TR2A 1Y4CA 4XTKA 1JN3A 2ZH8A 4RWQA 1UEUA 5JRAA 3OEOA 1OW7A 1R8BA 2XLMA 4NXUA 4D4NA 5JSLA 4BJ1A 3Q6NA 4UAYA 4W8PA 3VAYA 2O5AA 3OUYB 1VB5A 4XLPF 3IPMO 4KC9A 5HR9A 5E3AA 5J2AA 2YZSA 4U9EA 3C2KA 3AG1C 1H9GA 4MW3A 1ORYA 3DJUB 4KNVA 2BE5F 3NMIA 3FDQA 4P9TA 5T3WA 5L0CA 4OIPF 4K9AA 3M4BA 5CA7A 2XRHA 2EPMX 4HFKB 5HREA 3OVBA 3C8GA 1ZQCA 1EI7A 8ICRA 3JRTA 3DXJF 1S7ZA 8ICBA 5KYWB 4G7HF 2CCYA 5L0DA 3N24A 5CFSA 1MIVA 3MYIA 4J7YA 3PDMP 1YARO 4I2IA 4QZHA 2YWAA 1S05A 1PCXA 4YN4A 1U0BB 3IQ5A 2R7RA 4X4RA 4WGZA 5IIIA 1Z3IX 1TFWA 2AVKA 3RFYA 4EKWA 4M0AA 4NY8A 2J9UA 4WC0A 3LEVA 1ZQBA 3JPNA 4ZLDA 2WL8A 5J29A 4I2FA 3GEEA 5JLIA 4Z6DA 1JAFA 3EHNA 4K1OA 5L0JA 1ZQAA 1O5HA 1I4ZA 2OEVA 5IILA 5B3QA 3SXMA 3QMKA 4XEFA 3V5ZA 4M5DA 3C5GA 1EKYA 2Y3DA 4I2JA 1TKNA 2ZXWC 2YQYA 1ZU4A 4J32B 2KC3A 5F28E 3JPPA 3TK0A 4QI2A 3TFRA 3C7JA 1AUEA 3TOLA 2J46A 8ICEA 1DOVA 3HNJA 2CYDA 4NXXA 1ZQUA 3ZTZA 4LEWA 1T6QA 3EG9B 2M4EA 4U5DE 1H6GA 1WOLA 4QI0A 5DB7A 2O9XA 4O67A 3SP1A 1PD1A 2P66A 3KYJA 3WG7C 4CS9A 3S28A 2Y3HA 2VASA 5CFTA 2D5RB 3O10A 3ZWIA 8ICJA 4WGYA 5DQZA 5D4BA 2I15A 4KLDA 8ICOA 4HFFB 3W8HA 4LEVA 1D0YA 3ERCC 4ATBB 4RQ7A 5BPCA 2EIMC 1QPUA 1HMDA 4MFAA 5KYNA 3PHZA 2R7SA 1R8AA 3PHF2 1XSLA 1MNEA 1BDJB 4O5KA 2L9JA 3MDAA 3U2LA 3RYLA 3BRJA 1R5ID 2W9MA 1ORSC 5JVEA 1ZQWA 3JSZA 1GQAA 5IIOA 2BCVA 5A6JA 3LS1A 3LK9A 2LD6A 4K4IA 2J8WA 4DVZA 2QTVA 4IQVA 1LE2A 4E7ZA 1FFHA 3C62A 4UB3A 2R05A 4KLIA 9ICAA 4PJJA 4KBLA 3UQ2A 3FOPA 5D63A 5TZVA 1K05A 5KYYA 4JIOA 2IM8A 3T9OA 2DI3A 3GWNA 5BQIA 4JTAB 1B68A 3MBGA 3B0YA 3MGHA 4OD5A 2NG1A 4JJFA 1WATA 5D92A 4CJGA 1UG7A 3EQLF 2EIJC 3PMNA 5E3CA 4DRIB 4EEDA 4LERA 4AX2A 1D0XA 1C03A 4X0BA 4PK4A 2PX3A 1Q0FA 2LK4A 5K0IA 2DYRC 5DQTA 2NRKA 4BJ5C 4GEHA 4M9LA 5L0IA 2XM0A 3AU2A 2DR8A 3GORA 4O79A 4YD2A 2BCSA 2HMZA 2XLVA 3H39A 7ICPA 4K4GA 7ICUA 7ICOA 1YZCA 4UB4A 1TWCA 4S3NA 3ITFA 2R02A 3NYLA 2E87A 4IRUA 4K4HA 2A0BA 5DB6A 4X0AA 5EHHA 4R66A 2ID1A 1HW2A 1M2OA 1E83A 3K66A 1CGNA 2YL7A 5DS5A 5HRGA 1FNTc 4EEBA 4NTFA 3DKAA 2H7OA 5HRDA 2OQMA 2VC9A 2HHPA 4IAQA 1ZQNA 2IHMA 3OVSA 1ZQEA 3NRHA 4O7GA 4WBZA 3RQFA 7ICFA 2Z15A 4BEMJ 1VK5A 2GWWA 2A6HF 4HEAJ 1YYJA 3UMIA 3U9JA 1G8XA 4KLJA 2IXOA 1NFOA 2ISPA 1A7VA 2DRBA 1YZAA 5J2CA 2GA9D 4JTDB 2FMQA 2B4VA 2L7AA 4IQUA 2YHSA 1OXKA 3RH4A 3DI5A 3KYIA 1ZJNA 4WQKA 4PHAA 5F5FA 3S27A 3UMHA 4BJ6C 2R7XA 4G7ZF 2OJQA 1YVIA 4KM5A 4PHPA 1OCOC 8ICVA 4XLNF 5HRIA 1Z23A 3E70C 3ZVRA 9ICRA 4YL1A 3B0PA 3UR3C 3RQGA 4QZIA 4NM2A 5JUAA 1DOWA 4I2GA 5L0HA 1QZXA 1T6UA 4WC3A 5DB9A 1OW6A 3HNLA 1MQ3A 3UPSA 4RQ1A 1APCA 1E2XA 3U0CA 2PF4E 1FAPB 5COGA 8ICQA 4LZDA 2IOQA 1D0ZA 1Z5ZA 2PFQA 2J9VA 4CDAA 4QZBA 9ICXA 2NPUA 5DVWA 4K8VA 5DDYA 4YD1A 3T6BA 3HKKA 1R89A 4C3DA 4KLFA 3LS0A 4YCXA 1ZHXA 5CP2A 2VCBA 5AC4A 3JPTA 1GM5A 4QZ9A 1ZQSA 3DD7A 1A7EA 4LT6A 3X1OA 4RBNA 1WGWA 3ZIBA 3MDCA 2AU5A 9ICLA 1XSPA 2R25A 4MQ9F 2J9WA 1VLSA 4XPXA 2Q66A 2EWRA 4I3MA 1V55C 4N4WA 5CFUA 5L3VA 1TV9A 4BPMA 4I2EA 4XWJA 3RJFA 1VTMP 2ZXOA 2KQ9A 3QVZA 3UPQA 5CI9A 3NG1A 2FAPB 1QVXA 5DDMA 5GPGB 2ZH9A 2GWSA 4JLZA 3W2VA 3R2PA 2H7VC 2HKVA 4NXTA 5COMA 5A6KA 1TFOB 5J2KA 2BPFA 5A6BD 5EOZA 4RWNA 7ICHA 1R4TA 7ICVA 2Q7RA 5KYWA 1HUOA 1NU7D 4MF2A 3LNRA 4JCHA 4EWCA 8ICZA 1RZTA 4JC7A 4X4QA 4W8KA 2QE9A 2EPLX 3C8GB 2R7UA 1Q79A 5BQGA 3F47A 2M64A 4NLNA 1F1MA 3JPQA 1UEVA 5IIJA 4LEYA 3U8VA 1RXQA 4DOBA 3ISDA 4NCQA 4GQHA 4OAHA 5B1AC 1NZEA 2HJ3A 3LEOA 2IYLD 3S90A 3EPVA 1N1CA 4ULVA 4WC4A 4I27A 3H2VA 3OA1A 1ZQTA 1ZQOA 4JE9A 3RJHA 1M2VB 4UB1A 4ER9A 2ZHBA 3HNIA 1MMNA 7ICJA 1L7CA 1ZQHA 3V7LA 4BEJA 3NVOA 3EGDA 5BOMA 4NXWA 1U6HA 1JPJA 8ICUA 4FHWA 4E0HA 4PGQA 4PHDA 3ASOC 2Y3BA 4M9GA 4AT8A 4XPYA 1ZYRF 5HHIA 1RPLA 5D62A 4O5CA 3B29A 4XEKA 3T4RA 3ABKC 3C8ZA 2XLWA 2FCLA 8ICMA 3TOMA 1PV3A 2R7TA 5B3SC 3DM5A 1ZQXA 3M79A 3O39A 3CAXA 2DGJA 1BPDA 2CW0F 4YMNA 4K98A 3TULA 2QY9A 3M4CA 3C8GD 1KTMA 1LPEA 4M9JA 4Z6CA 1YLQA 3K1HA 3TD7A 2HSQA 2J45A 1Q0MA 1XWJA 4YL3A 3WFSC 2MHRA 4OAGA 1TFKB 4YL0A 2WZLA 4NLKA 4P4OA 4NC3A 1OCRC 3RH3A 4WC7A 2W4BA 1ZQRA 1E84A 1RMVA 3HJ1A 1TWGA 4DXWA 3AU6A 4OIRF 2H7BA 2KK1A 4GXJA 3M15A 1RCPA 1OW8A 4EIYA 5EGYA 1WTYA 4ANJA 4HX0A 3L34A 4KB6A 1UETA 5AGFA 1TWAA 2KJGA 1BBHA 4JJGA 5HRHA 3L0IA 3DE9A 5J2DA 4RQ4A 3C18A 4TUSA 1OCZC 4OAIZ 2AP3A 2VH3A 9ICVA 4QZ8A 4I1MA 8ICKA 4D4XA 2QNLA 1JQRA 4LLCA 4A2NB 3OWGA 4K96A 5L0FA 4UB2A 3KMIA 1Q0KA 2FFHA 2L6HA 4F5RA 2MYSA 3WAQA 3B9QA 4RWOA 1ZHYA 4XRHA
chains in the Genus database with same CATH topology
4I2DA 3HJ4A 7ICKA 1HUZA 5IIMA 2M2VA 3PMNA 5J2JA 5J0WA 4RT3A 9ICKA 4TURA 3B71A 3UXOA 4NQFA 4IG8A 4X4OA 4X0BA 4M9HA 4KLQA 4P2HA 2LK4A 4X4UA 2BCQA 9ICCA 2NRKA 4AT8B 5CHGA 4F5NA 5IIKA 4M9LA 7ICQA 5IINA 5J0RA 3AU2A 3NYBA 2DR8A 4X4SA 2ZHAA 2ZH5A 1ZQJA 3ISBA 1ZQDA 1K04A 2ISOA 4YD2A 2BCSA 4RQ6A 1ZQVA 3H39A 7ICPA 4K4GA 4NKUA 7ICUA 7ICOA 4UD4A 4UB4A 1ZZPA 4FH3A 1ZQZA 8ICTA 4S3NA 1MQ2A 4QZDA 2BCRA 4MFFA 9ICEA 4RQ5A 1BPYA 8ICXA 4M04A 4K4HA 5DB6A 4X0AA 9ICMA 4R66A 2ID1A 4X4NA 4F5OA 4WC1A 5J2IA 4NLZA 1BPEA 4RQ3A 2ZH4A 5HRGA 5J2HA 4F5QA 2FMSA 4KLUA 3UXNA 4Z6EA 8ICAA 9ICQA 5HRDA 3H37A 2HHPA 9ICOA 1ZQNA 1KEJA 2IHMA 4I2CA 4M9NA 3OVSA 5J2GA 1ZQEA 8ICNA 4EBJA 4WBZA 4KLEA 3RQFA 4X4VA 7ICFA 3AQMA 3C2MA 1NOMA 3K7DA 4RPYA 2M2TA 2PFNA 3GDXA 4WBYA 5DKWA 4IQTA 5J0SA 5CJ7A 4YMMA 4KLJA 2L6FA 4TUQA 5J0PA 5DBAA 9ICPA 4XA5A 2DR7A 3RH6A 2ISPA 4AT7B 4KLHA 1MIWA 1BPZA 2DRBA 5J2CA 1XSNA 3WFRE 2FMQA 4IQUA 1ZQPA 4QZCA 4PGYA 3RH4A 3AJMA 1ZJNA 3MBYA 7ICGA 4UAZA 2BCUA 4JWNA 1V4AA 4PHAA 5CR0A 5J0UA 4AT9B 4QZAA 3WFQE 4FO6A 4PHPA 8ICVA 3MFNA 5HRIA 9ICRA 2JPUA 3UXPA 3RQGA 9ICBA 5HRFA 3JYYA 1F5AA 4QZIA 4NM2A 5HC9A 8ICPA 4RQ2A 1ZQFA 4I2GA 4FHXA 4WC3A 2BPCA 4AT9A 5DB9A 3HX0A 4GXKA 4KLLA 1OW6A 1TVAA 5J0XA 4DOCA 3LQCB 3WFPA 4R63A 3ISCA 1MQ3A 3UPSA 4RQ1A 7ICSA 4MF8A 2BPGA 3RJEA 4GXIA 5CWRA 4E80A 3U0CA 4NM1A 1WOTA 4RQ0A 7ICLA 1PX5A 8ICQA 2M2UA 1UFBA 4LZDA 3V72A 1ZQMA 9ICSA 7ICIA 2PFOA 7ICMA 4FH5A 1VFGA 4UBCA 3JZ0A 3PMLA 4ATBA 2PFQA 1JOGA 4PH5A 4UD5A 1R8CA 4QZBA 3C2LA 9ICXA 8ICWA 4MFCA 5DDYA 4YD1A 4WCWA 1MIYA 8ICFA 9ICGA 4Z6FA 4DO9A 2RFFA 3V7JA 5DECA 1ZJMA 1R89A 7ICTA 4KLFA 3V7KA 4FHYA 4NXZA 4YCXA 5DEDA 3H38A 5J0TA 5CP2A 4FHPA 1JN3A 2ZH8A 4RWQA 5DBBA 1UEUA 3JPTA 4QZ9A 1ZQSA 1OW7A 1R8BA 4LT6A 1WWPA 4M2YA 3MDCA 9ICLA 1XSPA 4UAYA 4R32A 2ZH2A 1KDHA 2O5AA 3OUYB 2Q66A 1TV9A 4I2EA 2FMPA 3RJFA 5HR9A 2DRAA 1ZQIA 4XQ8A 3UPQA 3UQ0A 5J2AA 3RJIA 3AQNA 3C2KA 4WC2A 1QVXA 5DDMA 4RPXA 3GM3A 2ZH9A 2GWSA 9ICFA 4FHVA 4X4TA 3HIYA 1ZQYA 4AT7A 1NO5A 4M47A 5J2KA 3K75D 4YMOA 3RJGA 9ICJA 2BPFA 3C5FA 2DR9A 5EOZA 4RWNA 7ICHA 8ICIA 5J0QA 7ICVA 4RQ8A 1HUOA 4O9MA 4EP7A 5CA7A 4WC5A 4MF2A 9ICIA 8ICZA 1RZTA 4X4QA 3C8GB 3GM2A 4P4MA 5J0YA 3L9DA 3HWTA 1Q79A 5HREA 3OVBA 3C8GA 1ZQCA 9ICTA 4X5VA 4NLNA 8ICRA 1KNYA 3JPQA 8ICBA 5HHHA 5HRLA 5J2FA 1UEVA 5IIJA 2ZH1A 4XEVA 2ZH3A 3H3AA 4DOBA 3ISDA 2I9GA 1MIVA 4I2IA 4QZHA 4I2AA 3HW8A 2YWAA 7ICEA 4WC4A 4I27A 1ZQTA 4YN4A 1ZQOA 4X4RA 3RJHA 4UB1A 2ZHBA 8ICHA 5D46A 7ICJA 5IIIA 1TFWA 1ZQHA 3V7LA 3MGIA 4M0AA 3AQLA 5BOMA 4NY8A 1FA0A 4WC0A 2HSBA 8ICUA 7ICRA 4FHWA 4UAWA 3JPOA 1ZQBA 3JPNA 8ICCA 5J29A 3L8JA 4PGQA 4I2FA 4PHDA 1JMSA 3RQEA 3OUYA 4DOAA 4Z6DA 4KLSA 5HRKA 1ZQAA 4M9GA 4AT8A 5IILA 3WFOA 5HHIA 4KLMA 5D49A 7ICNA 4XEFA 1RPLA 4M5DA 5CB1A 3C5GA 4O5CA 9ICWA 4EBKA 1BPBA 3TFSA 4I2JA 4XEKA 5F28E 2PFPA 8ICMA 1PV3A 4I28A 3OGUA 2JX0A 1OU5A 1ZQXA 3JPPA 4KLOA 3TFRA 9ICUA 8ICEA 3OV7A 1BPDA 4X4PA 4YMNA 4NKTA 1ZQUA 3TULA 3C8GD 1KTMA 3U3FA 5BOLA 4M9JA 4Z6CA 4I29A 1YLQA 1WOLA 4PHEA 8ICLA 5DB7A 4JWMA 4KLTA 4XQ7A 3L8IA 3GM1A 3WFSC 2P66A 4LVSA 2VANA 4RWPA 2DVIA 3OVAA 1O3UA 3JPRA 2BE3A 4NLKA 1ZQQA 3C66A 4P4OA 3O10A 8ICJA 1JAJA 5DBCA 4QZEA 5D4BA 4KLDA 3S9OA 8ICOA 4WC7A 4IQWA 1ZQRA 1ZQKA 3HJ1A 4LZGA 2M2WA 3AU6A 2KK1A 4ATBB 5F2VO 4RQ7A 4GXJA 1BPXA 3PNCA 2PXIA 1Q78A 4QZGA 5BPCA 4KLGA 4MFAA 1OW8A 9ICHA 4UBBA 4PPXA 1WTYA 1VJ7A 3RJJA 1R8AA 4I2HA 1XSLA 5J2BA 4O5KA 1UETA 2Q00A 2L6GA 3MDAA 8ICGA 3RJKA 3B0XA 4E8FA 5HRHA 4TUPA 4I2BA 3BRJA 2W9MA 3JPSA 5J2DA 4WC6A 1ZQWA 4RT2A 2ZH7A 4RQ4A 1ZQLA 3C18A 5IIOA 2BCVA 4P4PA 4F5PA 4TUSA 9ICVA 1ZQGA 5HRBA 4QZ8A 3LK9A 2ZH6A 2PBEA 4K4IA 8ICKA 5DB8A 4RPZA 2DR5A 4PGXA 4XUSA 4R65A 4O5EA 2O1PA 4IQVA 4E7XA 3AUOA 4UB3A 4UB5A 1JQRA 4KLIA 1K40A 9ICAA 4QZFA 3UQ2A 4UB2A 5TZVA 1K05A 5J0OA 4R64A 2L6HA 4F5RA 5J2EA 1TFYA 8ICSA 8ICYA 9ICNA 4RWOA 3RH5A 4XRHA 3B0YA 3MGHA 3AQKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I2D A;  3HJ4 A;  7ICK A;  1HUZ A;  5IIM A;  2M2V A;  3PMN A;  5J2J A;  5J0W A;  4RT3 A;  9ICK A;  4TUR A;  3B71 A;  3UXO A;  4NQF A;  4IG8 A;  4X4O A;  4X0B A;  4M9H A;  4KLQ A;  4P2H A;  2LK4 A;  4X4U A;  2BCQ A;  9ICC A;  2NRK A;  4AT8 B;  5CHG A;  4F5N A;  5IIK A;  4M9L A;  7ICQ A;  5IIN A;  5J0R A;  3AU2 A;  3NYB A;  2DR8 A;  4X4S A;  2ZHA A;  2ZH5 A;  1ZQJ A;  3ISB A;  1ZQD A;  1K04 A;  2ISO A;  4YD2 A;  2BCS A;  4RQ6 A;  1ZQV A;  3H39 A;  7ICP A;  4K4G A;  4NKU A;  7ICU A;  7ICO A;  4UD4 A;  4UB4 A;  1ZZP A;  4FH3 A;  1ZQZ A;  8ICT A;  4S3N A;  1MQ2 A;  4QZD A;  2BCR A;  4MFF A;  9ICE A;  4RQ5 A;  1BPY A;  8ICX A;  4M04 A;  4K4H A;  5DB6 A;  4X0A A;  9ICM A;  4R66 A;  2ID1 A;  4X4N A;  4F5O A;  4WC1 A;  5J2I A;  4NLZ A;  1BPE A;  4RQ3 A;  2ZH4 A;  5HRG A;  5J2H A;  4F5Q A;  2FMS A;  4KLU A;  3UXN A;  4Z6E A;  8ICA A;  9ICQ A;  5HRD A;  3H37 A;  2HHP A;  9ICO A;  1ZQN A;  1KEJ A;  2IHM A;  4I2C A;  4M9N A;  3OVS A;  5J2G A;  1ZQE A;  8ICN A;  4EBJ A;  4WBZ A;  4KLE A;  3RQF A;  4X4V A;  7ICF A;  3AQM A;  3C2M A;  1NOM A;  3K7D A;  4RPY A;  2M2T A;  2PFN A;  3GDX A;  4WBY A;  5DKW A;  4IQT A;  5J0S A;  5CJ7 A;  4YMM A;  4KLJ A;  2L6F A;  4TUQ A;  5J0P A;  5DBA A;  9ICP A;  4XA5 A;  2DR7 A;  3RH6 A;  2ISP A;  4AT7 B;  4KLH A;  1MIW A;  1BPZ A;  2DRB A;  5J2C A;  1XSN A;  3WFR E;  2FMQ A;  4IQU A;  1ZQP A;  4QZC A;  4PGY A;  3RH4 A;  3AJM A;  1ZJN A;  3MBY A;  7ICG A;  4UAZ A;  2BCU A;  4JWN A;  1V4A A;  4PHA A;  5CR0 A;  5J0U A;  4AT9 B;  4QZA A;  3WFQ E;  4FO6 A;  4PHP A;  8ICV A;  3MFN A;  5HRI A;  9ICR A;  2JPU A;  3UXP A;  3RQG A;  9ICB A;  5HRF A;  3JYY A;  1F5A A;  4QZI A;  4NM2 A;  5HC9 A;  8ICP A;  4RQ2 A;  1ZQF A;  4I2G A;  4FHX A;  4WC3 A;  2BPC A;  4AT9 A;  5DB9 A;  3HX0 A;  4GXK A;  4KLL A;  1OW6 A;  1TVA A;  5J0X A;  4DOC A;  3LQC B;  3WFP A;  4R63 A;  3ISC A;  1MQ3 A;  3UPS A;  4RQ1 A;  7ICS A;  4MF8 A;  2BPG A;  3RJE A;  4GXI A;  5CWR A;  4E80 A;  3U0C A;  4NM1 A;  1WOT A;  4RQ0 A;  7ICL A;  1PX5 A;  8ICQ A;  2M2U A;  1UFB A;  4LZD A;  3V72 A;  1ZQM A;  9ICS A;  7ICI A;  2PFO A;  7ICM A;  4FH5 A;  1VFG A;  4UBC A;  3JZ0 A;  3PML A;  4ATB A;  2PFQ A;  1JOG A;  4PH5 A;  4UD5 A;  1R8C A;  4QZB A;  3C2L A;  9ICX A;  8ICW A;  4MFC A;  5DDY A;  4YD1 A;  4WCW A;  1MIY A;  8ICF A;  9ICG A;  4Z6F A;  4DO9 A;  2RFF A;  3V7J A;  5DEC A;  1ZJM A;  1R89 A;  7ICT A;  4KLF A;  3V7K A;  4FHY A;  4NXZ A;  4YCX A;  5DED A;  3H38 A;  5J0T A;  5CP2 A;  4FHP A;  1JN3 A;  2ZH8 A;  4RWQ A;  5DBB A;  1UEU A;  3JPT A;  4QZ9 A;  1ZQS A;  1OW7 A;  1R8B A;  4LT6 A;  1WWP A;  4M2Y A;  3MDC A;  9ICL A;  1XSP A;  4UAY A;  4R32 A;  2ZH2 A;  1KDH A;  2O5A A;  3OUY B;  2Q66 A;  1TV9 A;  4I2E A;  2FMP A;  3RJF A;  5HR9 A;  2DRA A;  1ZQI A;  4XQ8 A;  3UPQ A;  3UQ0 A;  5J2A A;  3RJI A;  3AQN A;  3C2K A;  4WC2 A;  1QVX A;  5DDM A;  4RPX A;  3GM3 A;  2ZH9 A;  2GWS A;  9ICF A;  4FHV A;  4X4T A;  3HIY A;  1ZQY A;  4AT7 A;  1NO5 A;  4M47 A;  5J2K A;  3K75 D;  4YMO A;  3RJG A;  9ICJ A;  2BPF A;  3C5F A;  2DR9 A;  5EOZ A;  4RWN A;  7ICH A;  8ICI A;  5J0Q A;  7ICV A;  4RQ8 A;  1HUO A;  4O9M A;  4EP7 A;  5CA7 A;  4WC5 A;  4MF2 A;  9ICI A;  8ICZ A;  1RZT A;  4X4Q A;  3C8G B;  3GM2 A;  4P4M A;  5J0Y A;  3L9D A;  3HWT A;  1Q79 A;  5HRE A;  3OVB A;  3C8G A;  1ZQC A;  9ICT A;  4X5V A;  4NLN A;  8ICR A;  1KNY A;  3JPQ A;  8ICB A;  5HHH A;  5HRL A;  5J2F A;  1UEV A;  5IIJ A;  2ZH1 A;  4XEV A;  2ZH3 A;  3H3A A;  4DOB A;  3ISD A;  2I9G A;  1MIV A;  4I2I A;  4QZH A;  4I2A A;  3HW8 A;  2YWA A;  7ICE A;  4WC4 A;  4I27 A;  1ZQT A;  4YN4 A;  1ZQO A;  4X4R A;  3RJH A;  4UB1 A;  2ZHB A;  8ICH A;  5D46 A;  7ICJ A;  5III A;  1TFW A;  1ZQH A;  3V7L A;  3MGI A;  4M0A A;  3AQL A;  5BOM A;  4NY8 A;  1FA0 A;  4WC0 A;  2HSB A;  8ICU A;  7ICR A;  4FHW A;  4UAW A;  3JPO A;  1ZQB A;  3JPN A;  8ICC A;  5J29 A;  3L8J A;  4PGQ A;  4I2F A;  4PHD A;  1JMS A;  3RQE A;  3OUY A;  4DOA A;  4Z6D A;  4KLS A;  5HRK A;  1ZQA A;  4M9G A;  4AT8 A;  5IIL A;  3WFO A;  5HHI A;  4KLM A;  5D49 A;  7ICN A;  4XEF A;  1RPL A;  4M5D A;  5CB1 A;  3C5G A;  4O5C A;  9ICW A;  4EBK A;  1BPB A;  3TFS A;  4I2J A;  4XEK A;  5F28 E;  2PFP A;  8ICM A;  1PV3 A;  4I28 A;  3OGU A;  2JX0 A;  1OU5 A;  1ZQX A;  3JPP A;  4KLO A;  3TFR A;  9ICU A;  8ICE A;  3OV7 A;  1BPD A;  4X4P A;  4YMN A;  4NKT A;  1ZQU A;  3TUL A;  3C8G D;  1KTM A;  3U3F A;  5BOL A;  4M9J A;  4Z6C A;  4I29 A;  1YLQ A;  1WOL A;  4PHE A;  8ICL A;  5DB7 A;  4JWM A;  4KLT A;  4XQ7 A;  3L8I A;  3GM1 A;  3WFS C;  2P66 A;  4LVS A;  2VAN A;  4RWP A;  2DVI A;  3OVA A;  1O3U A;  3JPR A;  2BE3 A;  4NLK A;  1ZQQ A;  3C66 A;  4P4O A;  3O10 A;  8ICJ A;  1JAJ A;  5DBC A;  4QZE A;  5D4B A;  4KLD A;  3S9O A;  8ICO A;  4WC7 A;  4IQW A;  1ZQR A;  1ZQK A;  3HJ1 A;  4LZG A;  2M2W A;  3AU6 A;  2KK1 A;  4ATB B;  5F2V O;  4RQ7 A;  4GXJ A;  1BPX A;  3PNC A;  2PXI A;  1Q78 A;  4QZG A;  5BPC A;  4KLG A;  4MFA A;  1OW8 A;  9ICH A;  4UBB A;  4PPX A;  1WTY A;  1VJ7 A;  3RJJ A;  1R8A A;  4I2H A;  1XSL A;  5J2B A;  4O5K A;  1UET A;  2Q00 A;  2L6G A;  3MDA A;  8ICG A;  3RJK A;  3B0X A;  4E8F A;  5HRH A;  4TUP A;  4I2B A;  3BRJ A;  2W9M A;  3JPS A;  5J2D A;  4WC6 A;  1ZQW A;  4RT2 A;  2ZH7 A;  4RQ4 A;  1ZQL A;  3C18 A;  5IIO A;  2BCV A;  4P4P A;  4F5P A;  4TUS A;  9ICV A;  1ZQG A;  5HRB A;  4QZ8 A;  3LK9 A;  2ZH6 A;  2PBE A;  4K4I A;  8ICK A;  5DB8 A;  4RPZ A;  2DR5 A;  4PGX A;  4XUS A;  4R65 A;  4O5E A;  2O1P A;  4IQV A;  4E7X A;  3AUO A;  4UB3 A;  4UB5 A;  1JQR A;  4KLI A;  1K40 A;  9ICA A;  4QZF A;  3UQ2 A;  4UB2 A;  5TZV A;  1K05 A;  5J0O A;  4R64 A;  2L6H A;  4F5R A;  5J2E A;  1TFY A;  8ICS A;  8ICY A;  9ICN A;  4RWO A;  3RH5 A;  4XRH A;  3B0Y A;  3MGH A;  3AQK A; 
#chains in the Genus database with same CATH topology
 4NXV A;  4K99 A;  4K0D A;  5AC5 A;  3NMJ A;  2EIK C;  3W2W A;  5J0W A;  3B71 A;  3UXO A;  2WZG A;  3EGD B;  3EZH A;  4OIN F;  4O68 A;  3FVY A;  2EPK X;  4KLQ A;  4AE4 B;  4Q4Z F;  2EPN A;  2BC5 A;  2YVK A;  2BCQ A;  9ICC A;  4FWV A;  3UGP A;  3NKD A;  3QW0 A;  7ICQ A;  4MTF A;  3CK6 A;  3ZQV A;  5KYY B;  3NYB A;  2ZH5 A;  2G3K A;  4IAO A;  2I8B A;  5KYX B;  2B56 A;  1CGM E;  4RQ6 A;  2W9Y A;  2EPO A;  2X0C A;  1RKE B;  3LAY A;  1ZZP A;  1ZW2 A;  4OIQ F;  2XLD A;  4MVO A;  8ICX A;  3EGX B;  1JR8 A;  3U2M A;  1M56 C;  2G3V A;  4F5O A;  3QW1 A;  4NLZ A;  2Q9A A;  3K6B A;  3ZTM A;  8ICA A;  3VF0 A;  1T01 A;  2WVN A;  4JKV A;  5J2G A;  2Y39 A;  4KLE A;  2HN2 A;  2GAQ A;  3CQZ A;  4C3B A;  1H9T A;  4X4V A;  4CX9 A;  1LS4 A;  1NOM A;  5JT4 A;  4WBY A;  4G0H A;  5KYX A;  4IQT A;  5CI8 A;  5DKW A;  1OR2 A;  3ECS A;  4YMM A;  2A69 F;  2L6F A;  3TQO A;  1A7D A;  3GOD A;  4KLH A;  1MIW A;  1NSG B;  3VRC A;  5FCL A;  2R7W A;  3FAP B;  1U89 A;  1ZQP A;  4PGY A;  4CDY A;  3IQ6 A;  4JWN A;  2A1D D;  1LS1 A;  1V4A A;  5CR0 A;  4QZA A;  1LIH A;  4FO6 A;  3EG9 A;  3RKO F;  3MFN A;  1KU2 A;  4IAR A;  4Q7C A;  4U5G A;  5EK0 A;  3UXP A;  1BR1 A;  5HRF A;  4O6A A;  3U9M A;  4C7O A;  4RQ2 A;  1ZQF A;  4FHX A;  2BPC A;  4YN0 B;  1TVA A;  2KNH A;  5B3I A;  1VYI A;  3WFP A;  4MF8 A;  5HV9 A;  4GXI A;  4E80 A;  3H65 A;  1L3P A;  3TJ5 A;  1WOT A;  1UFB A;  3V72 A;  1VFG A;  3IEE A;  4CS7 A;  3PML A;  1JOG A;  4PH5 A;  2XXA A;  4UD5 A;  2XXA B;  4MVQ A;  3DAG A;  2NUT A;  4DBQ A;  8ICW A;  4MFC A;  1MIY A;  8ICF A;  4Z6F A;  4DO9 A;  3V7J A;  2GDC A;  2R7Q A;  3U3B A;  7ICT A;  3QZC A;  1MMA A;  4FHY A;  5E33 A;  2GA0 A;  2R7V A;  5DED A;  3H38 A;  4NTB A;  4FHP A;  1ZW3 A;  4QDL A;  2P7V A;  5DBB A;  1FTS A;  3ZSU A;  4ONS A;  1FR0 A;  2OJE D;  1JMW A;  1WWP A;  2UUH A;  4M2Y A;  4CS8 C;  1MQV A;  4CSA A;  4I1O B;  1BZ4 A;  3SEO A;  4R32 A;  3GEH A;  3S29 A;  2ZH2 A;  3FAJ A;  3W4Y A;  5L0G A;  3ZC4 A;  2V26 A;  1ZQI A;  2XS1 A;  2HZ8 A;  4XQ8 A;  3UQ0 A;  3RJI A;  3RF3 A;  3AQN A;  1M2V A;  1QQ3 A;  4FHV A;  3UNG C;  4X4T A;  4OAF A;  4PFP A;  2J9B A;  2ZXR A;  1D1B A;  3SYN A;  2P0N A;  3JT1 A;  3CSK A;  1Z63 A;  4OIO F;  3HNK A;  2DR9 A;  5L3Q A;  4P9F A;  5J0Q A;  9ICI A;  3IHU A;  4JRZ A;  3L9D A;  3HWT A;  9ICT A;  4X5V A;  3T6G B;  2VCA A;  1KNY A;  2PX0 A;  1IW7 F;  3I5Q A;  5JP7 A;  4JVS A;  5HHH A;  5J2F A;  4H54 A;  2ZH3 A;  3H3A A;  3HW8 A;  2HV7 A;  4E7S A;  4K9B A;  3JCU Q;  3NYJ A;  5D46 A;  3ABM C;  2LSE A;  3KH2 A;  3NWI A;  3MGI A;  2GAF D;  4RD9 A;  3AQL A;  3RVY A;  3NMK A;  1G4U S;  4FAP B;  1FA0 A;  2HSB A;  7ICR A;  3VM6 A;  4UAW A;  3JPO A;  2IBF A;  1JMS A;  3RQE A;  4CS8 A;  4DOA A;  1Q0D A;  1E86 A;  5HRK A;  1C02 A;  1ZU5 A;  1BR4 A;  4KLM A;  7ICN A;  3B0U X;  4EBK A;  1BPB A;  4A4A A;  4I44 A;  2X51 A;  3AOU A;  5CHE A;  4EV6 A;  3OGU A;  2JX0 A;  1OU5 A;  4KLO A;  4GYT A;  1YYX A;  9ICU A;  4J7T A;  4HE8 D;  4YT5 A;  3OV7 A;  4PR9 A;  3AGT A;  4O6N A;  4O6M A;  1XZP A;  4MW8 A;  3SXZ A;  4I29 A;  4PHE A;  8ICL A;  3FMS A;  4BJ5 A;  4KLT A;  4XQ7 A;  4LVS A;  2PFD A;  3A9C A;  4XJE A;  2ZD9 A;  2KSF A;  5KYU B;  1O3U A;  4N7R A;  4LAC B;  3C66 A;  4QZE A;  3S9O A;  2NUT B;  1ZQK A;  4LZG A;  5DLJ A;  3RVZ A;  4U5H A;  5F2V O;  1BPX A;  2WZF A;  4WH5 A;  4KLG A;  4E0I A;  1VMA A;  2OOC A;  1RJ9 A;  4UBB A;  4PPX A;  3VYW A;  1CGO A;  3ASN C;  3NKE A;  4I2H A;  2AWY A;  3AGU A;  5J2B A;  2L6G A;  8ICG A;  3RJK A;  3B0X A;  4TUP A;  4DVY P;  3W8I A;  3ABL C;  3T6J A;  2RD9 A;  1OQC A;  1ORJ A;  3UMK A;  3JPS A;  4WC6 A;  4RT2 A;  2ZH7 A;  4BJ6 A;  3EGX A;  3SNH A;  1M57 C;  2V3C C;  4E18 A;  4P4P A;  4F5P A;  5HRB A;  2OCC C;  3DWW A;  1I4Y A;  4RPZ A;  4U5F E;  2IHO A;  2DR5 A;  4XUS A;  4R65 A;  1OKK A;  3MX3 A;  4O5E A;  4YT8 A;  1V54 C;  2YRF A;  4QZF A;  2BL2 A;  4KNW A;  4MVR A;  4IWB A;  4R64 A;  5J2E A;  5COF A;  2P6V A;  8ICY A;  2OG2 A;  1FFT C;  3HJ4 A;  1HUZ A;  5FZT A;  5IIM A;  2M2V A;  2Q4F A;  5J2J A;  3KPH A;  9ICK A;  4U5B E;  4TUR A;  5B1B C;  3MLG A;  4JZA A;  4PJL A;  1NG1 A;  2GFH A;  4M9H A;  4LLE A;  4X4U A;  3GEI A;  4IB4 A;  2KW3 C;  4CS9 C;  2MWQ A;  3MCR A;  4AT8 B;  5CHG A;  2ZXP A;  3DE8 A;  4CIP A;  3H2U A;  4F4B A;  4X4S A;  3ISB A;  1ZQD A;  1K04 A;  2ISO A;  3IQT A;  3SXK A;  4X0R A;  1ZQV A;  3PCV A;  1ZHT A;  3F46 A;  4FX5 A;  4MND A;  2XSE A;  1GGQ A;  4U5E E;  2CDQ A;  4RQ5 A;  4M04 A;  3I4U A;  9ICM A;  2HMQ A;  4LDR A;  3US6 A;  2BBJ A;  2LCH A;  2PP4 A;  4P6I C;  1D1C A;  4XPW A;  1V74 B;  4WC1 A;  1BPE A;  4RQ3 A;  5J2H A;  4F5Q A;  2FMS A;  4KLU A;  4NY3 A;  1EQ1 A;  4YK5 A;  9ICQ A;  2IUB A;  1KEJ A;  4I2C A;  2DYS C;  1C17 M;  8ICN A;  4EBJ A;  2A68 F;  1CPR A;  3C2M A;  1JRA A;  3K7D A;  2M2T A;  4WQL A;  2PFN A;  2LP4 A;  2UUI A;  5J0S A;  1VOM A;  2AWC A;  4TUQ A;  3L1M A;  5T1D B;  9ICP A;  4XA5 A;  2DR7 A;  4MVM A;  3RH6 A;  1VYK A;  4AT7 B;  4E17 A;  1XSN A;  2OEX A;  3WFR E;  2YLI A;  3JSE O;  1ZVZ A;  4QZC A;  3AJM A;  4G7O F;  1D1A A;  3JYH A;  7ICG A;  4UAZ A;  3ER9 B;  2BCU A;  4JCZ A;  3WFQ E;  4MVS A;  1NFN A;  1SZI A;  4XQ1 A;  2YKZ A;  1FMW A;  1F5A A;  1H7I A;  4LDQ A;  1GS9 A;  8ICP A;  1HE1 A;  3SZR A;  4CSA C;  1HE9 A;  3ATP A;  5J0X A;  4DOC A;  4JEB A;  3ISC A;  3RJE A;  1QLE C;  1O87 A;  2CNW D;  3EFO A;  4RQ0 A;  9ICS A;  3LES A;  7ICI A;  2XLH A;  2PFO A;  2PNO A;  3JZ0 A;  2IXM A;  3N0T A;  4MKP A;  2WVO A;  1OXB A;  1T5O A;  1R8C A;  3C2L A;  3DMD A;  5A6A A;  1WN0 A;  9ICG A;  2WVQ A;  3R7C A;  1ZHW A;  2XLE A;  5DEC A;  1TQG A;  1TWH A;  4CDV A;  3V7K A;  2Q9C A;  4NXZ A;  5J0T A;  2H8A A;  1YJG A;  3AQB A;  1YDI A;  2EIL C;  1I5N A;  5CIV A;  2J7P A;  2BBH A;  1G5Z A;  4N06 A;  1HY5 A;  1KDH A;  3G4X A;  2RSE B;  3FHD A;  1GPJ A;  4PJN A;  2NUP A;  2FMP A;  2DB4 A;  3EJN A;  2DRA A;  4IGG A;  1AEP A;  2B51 A;  4FO1 A;  4DBR A;  1W2W A;  4WC2 A;  5KYU A;  4RPX A;  3GM3 A;  9ICF A;  3MYF A;  3HIY A;  1ZQY A;  1M6T A;  4AT7 A;  2J0X A;  1NO5 A;  4M47 A;  4O6Y A;  3K75 D;  4YMO A;  3JTL O;  3RJG A;  9ICJ A;  2JD3 A;  2YLG A;  4NTA A;  2B0H A;  4MVZ A;  5A6B A;  3C5F A;  8ICI A;  5IY5 C;  3LJB A;  4RQ8 A;  4O9M A;  4EP7 A;  4WC5 A;  4JUR I;  4BG0 A;  256B A;  4J30 B;  2NUP B;  3GM2 A;  4P4M A;  5J0Y A;  2FGY A;  3DJN B;  5A69 A;  1YLM A;  1LI5 A;  2Q3T A;  2B0J A;  3C63 A;  4PJM A;  1LVK A;  5HRL A;  2ZH1 A;  4XEV A;  3DAF A;  4CBE A;  2I9G A;  4AE4 A;  1YA9 A;  4I2A A;  7ICE A;  1FMV A;  2LQG A;  8ICH A;  3EF2 A;  3X2Q C;  2ASR A;  2LFF A;  3U8P A;  1YAU O;  2HS5 A;  5D91 A;  5DS6 A;  3PMR A;  1RKC A;  8ICC A;  1SF8 A;  3L8J A;  2CNW A;  3U5S A;  3V5Y A;  2R03 A;  1NBB A;  3OUY A;  2KGO A;  3G50 A;  4KLS A;  1AVO B;  3WFO A;  2P1A A;  5D49 A;  1MND A;  5CB1 A;  9ICW A;  1NLX A;  3TFS A;  3EH2 A;  3O6X A;  3I5P A;  3S84 A;  3DZA A;  2PFP A;  2QLA A;  2LIG A;  3WHN A;  3LLI A;  4I28 A;  2Q9B A;  4X4P A;  3A11 A;  2KYH A;  1MMG A;  4NKT A;  4YJW A;  3M1C B;  2OU6 A;  3EH1 A;  3U3F A;  1JPN A;  5BOL A;  1NU9 C;  3UGO A;  4CIH A;  3RIP A;  1YA7 O;  3G4Z A;  2YL3 A;  4JWM A;  1ZHZ A;  3L8I A;  1EA8 A;  2C04 A;  3GM1 A;  2VAN A;  3ZDL A;  4RWP A;  2TMV P;  2DVI A;  3OVA A;  1PD0 A;  1LI7 A;  3Q7L A;  3JPR A;  2BE3 A;  1ZQQ A;  1JAJ A;  5DBC A;  4PFO A;  3CEX A;  2HUJ A;  4I0U A;  4IQW A;  4LDK A;  2XL4 A;  2W45 A;  2A0U A;  2M2W A;  1J8M F;  4C7O B;  3POV A;  2P61 A;  3PNC A;  2PXI A;  1Q78 A;  4L6R A;  4QZG A;  4JLX A;  1OCC C;  9ICH A;  2HFI A;  2VCC A;  1VJ7 A;  4YT2 A;  3HTK C;  3Q7G A;  3RJJ A;  3CZ6 A;  4LEZ A;  4WJ0 A;  1XZQ A;  5D61 A;  5TJ5 E;  2ICW G;  2Q00 A;  3TJ6 A;  2J0W A;  3OWT A;  1LKX A;  4E8F A;  1RJ9 B;  4FES A;  4I2B A;  1Y6D A;  2A6E F;  3K1I C;  4N6H A;  4DRH B;  3HJC A;  1ZQL A;  3AG4 C;  1A0B A;  1ZQG A;  2ZH6 A;  2PBE A;  3B0V C;  2F22 A;  1HW1 A;  2LFD A;  2J7P D;  5DB8 A;  2HN1 A;  4PGX A;  2O1P A;  4E7X A;  3KKB A;  3N2Z B;  3AUO A;  4UB5 A;  4Q5S F;  1K40 A;  3GAN A;  3QTH A;  2L81 A;  2ZPA A;  5J0O A;  1TFY A;  8ICS A;  4MVU A;  9ICN A;  2C03 A;  3RH5 A;  1E85 A;  4M63 A;  2R7O A;  3AQK A;  2R9R B;  4C3E A;  4I2D A;  2NSG A;  4DJ9 A;  7ICK A;  4PAC A;  4B6I A;  1BR2 A;  2D4U A;  1SYQ A;  2XM4 A;  2W4M A;  3NKU A;  4RT3 A;  4OD4 A;  4K97 A;  4NQF A;  4BJT A;  4IG8 A;  4EHP A;  4X4O A;  3Q6M A;  4U5C E;  3IQC A;  5DS4 A;  3K1I A;  4JW1 A;  2IXP A;  3K33 A;  4P2H A;  4ULW A;  3AG2 C;  3GWL A;  3JRM O;  4UDV A;  4Z9J A;  1OKK D;  3S0X A;  4F5N A;  3RW0 A;  5IIK A;  2YL1 A;  5IIN A;  5J0R A;  1LE4 A;  4G78 A;  4RDA A;  2ZHA A;  1WAS A;  1ZQJ A;  3BEH A;  2VB6 A;  1Q0G A;  1VLT A;  1J8Y F;  1LM3 B;  4DRJ B;  5E2Q A;  4NKU A;  3JCF A;  4UD4 A;  2XL8 A;  1Z6A A;  4FH3 A;  3AG3 C;  2XS8 A;  1ZQZ A;  4JEA A;  8ICT A;  3AQC A;  1MQ2 A;  2BCR A;  4QZD A;  4MFF A;  1QSP A;  9ICE A;  1BPY A;  1HMO A;  2EIN C;  4U9D A;  3DM9 B;  2Y69 C;  3J06 A;  3ZG1 A;  4X4N A;  5J2I A;  5JS5 A;  5JTG A;  2ZH4 A;  4JTC B;  3UXN A;  4Z6E A;  4MS2 A;  3EZI A;  3FXH A;  3H37 A;  9ICO A;  1MMD A;  4M9N A;  4MTG A;  4YWQ A;  5BUO A;  4Z9H A;  1RKE A;  2YEV A;  3AQM A;  3V7O A;  2OKU A;  4RPY A;  3SXY A;  5HSW A;  1IZM A;  2G62 A;  2HJM A;  3GDX A;  5F5H A;  4O69 A;  5CJ7 A;  3LLK A;  3NYM A;  5J0P A;  3NDB B;  5DBA A;  1G4W R;  4AK9 A;  4AL0 A;  3LNM B;  4CJO A;  4DOZ A;  1BPZ A;  2XLO A;  4Z9I A;  2CGE A;  4EUK B;  1SR2 A;  4K7B A;  3MBY A;  1ST6 A;  3WOD F;  1OR3 A;  2XL6 A;  2QUP A;  3KL4 A;  4AT9 B;  5J0U A;  4EBB A;  3ZQY A;  1T9K A;  5B3P A;  2JPU A;  4AL1 A;  3EHM A;  1Z7Q c;  9ICB A;  3JYY A;  5HC9 A;  4MTO A;  4EGW A;  2YL0 A;  4N6C A;  4KI2 A;  5BQH A;  1CPQ A;  2WB7 A;  3QVY A;  4AT9 A;  3HX0 A;  4GXK A;  4KLL A;  3LQC B;  4R63 A;  3LUT B;  7ICS A;  2BPG A;  5CWR A;  3EFO B;  4H4K C;  3O55 A;  4NM1 A;  1SMY F;  4WOY A;  7ICL A;  1PX5 A;  2YLD A;  2M2U A;  1ZQM A;  4ZLC A;  3HLZ A;  7ICM A;  2NSF A;  4FH5 A;  1QKR A;  4UBC A;  2ETS A;  3V5X A;  4ATB A;  4YT4 A;  2HV6 A;  3E9V A;  3FOO A;  1A41 A;  5T3T A;  4IJJ A;  4WAB A;  2IXN A;  2Y3G A;  4WCW A;  2RFF A;  1T6I A;  1ZJM A;  3ER8 C;  1TR2 A;  1Y4C A;  4XTK A;  1JN3 A;  2ZH8 A;  4RWQ A;  1UEU A;  5JRA A;  3OEO A;  1OW7 A;  1R8B A;  2XLM A;  4NXU A;  4D4N A;  5JSL A;  4BJ1 A;  3Q6N A;  4UAY A;  4W8P A;  3VAY A;  2O5A A;  3OUY B;  1VB5 A;  4XLP F;  3IPM O;  4KC9 A;  5HR9 A;  5E3A A;  5J2A A;  2YZS A;  4U9E A;  3C2K A;  3AG1 C;  1H9G A;  4MW3 A;  1ORY A;  3DJU B;  4KNV A;  2BE5 F;  3NMI A;  3FDQ A;  4P9T A;  5T3W A;  5L0C A;  4OIP F;  4K9A A;  3M4B A;  5CA7 A;  2XRH A;  2EPM X;  4HFK B;  5HRE A;  3OVB A;  3C8G A;  1ZQC A;  1EI7 A;  8ICR A;  3JRT A;  3DXJ F;  1S7Z A;  8ICB A;  5KYW B;  4G7H F;  2CCY A;  5L0D A;  3N24 A;  5CFS A;  1MIV A;  3MYI A;  4J7Y A;  3PDM P;  1YAR O;  4I2I A;  4QZH A;  2YWA A;  1S05 A;  1PCX A;  4YN4 A;  1U0B B;  3IQ5 A;  2R7R A;  4X4R A;  4WGZ A;  5III A;  1Z3I X;  1TFW A;  2AVK A;  3RFY A;  4EKW A;  4M0A A;  4NY8 A;  2J9U A;  4WC0 A;  3LEV A;  1ZQB A;  3JPN A;  4ZLD A;  2WL8 A;  5J29 A;  4I2F A;  3GEE A;  5JLI A;  4Z6D A;  1JAF A;  3EHN A;  4K1O A;  5L0J A;  1ZQA A;  1O5H A;  1I4Z A;  2OEV A;  5IIL A;  5B3Q A;  3SXM A;  3QMK A;  4XEF A;  3V5Z A;  4M5D A;  3C5G A;  1EKY A;  2Y3D A;  4I2J A;  1TKN A;  2ZXW C;  2YQY A;  1ZU4 A;  4J32 B;  2KC3 A;  5F28 E;  3JPP A;  3TK0 A;  4QI2 A;  3TFR A;  3C7J A;  1AUE A;  3TOL A;  2J46 A;  8ICE A;  1DOV A;  3HNJ A;  2CYD A;  4NXX A;  1ZQU A;  3ZTZ A;  4LEW A;  1T6Q A;  3EG9 B;  2M4E A;  4U5D E;  1H6G A;  1WOL A;  4QI0 A;  5DB7 A;  2O9X A;  4O67 A;  3SP1 A;  1PD1 A;  2P66 A;  3KYJ A;  3WG7 C;  4CS9 A;  3S28 A;  2Y3H A;  2VAS A;  5CFT A;  2D5R B;  3O10 A;  3ZWI A;  8ICJ A;  4WGY A;  5DQZ A;  5D4B A;  2I15 A;  4KLD A;  8ICO A;  4HFF B;  3W8H A;  4LEV A;  1D0Y A;  3ERC C;  4ATB B;  4RQ7 A;  5BPC A;  2EIM C;  1QPU A;  1HMD A;  4MFA A;  5KYN A;  3PHZ A;  2R7S A;  1R8A A;  3PHF 2;  1XSL A;  1MNE A;  1BDJ B;  4O5K A;  2L9J A;  3MDA A;  3U2L A;  3RYL A;  3BRJ A;  1R5I D;  2W9M A;  1ORS C;  5JVE A;  1ZQW A;  3JSZ A;  1GQA A;  5IIO A;  2BCV A;  5A6J A;  3LS1 A;  3LK9 A;  2LD6 A;  4K4I A;  2J8W A;  4DVZ A;  2QTV A;  4IQV A;  1LE2 A;  4E7Z A;  1FFH A;  3C62 A;  4UB3 A;  2R05 A;  4KLI A;  9ICA A;  4PJJ A;  4KBL A;  3UQ2 A;  3FOP A;  5D63 A;  5TZV A;  1K05 A;  5KYY A;  4JIO A;  2IM8 A;  3T9O A;  2DI3 A;  3GWN A;  5BQI A;  4JTA B;  1B68 A;  3MBG A;  3B0Y A;  3MGH A;  4OD5 A;  2NG1 A;  4JJF A;  1WAT A;  5D92 A;  4CJG A;  1UG7 A;  3EQL F;  2EIJ C;  3PMN A;  5E3C A;  4DRI B;  4EED A;  4LER A;  4AX2 A;  1D0X A;  1C03 A;  4X0B A;  4PK4 A;  2PX3 A;  1Q0F A;  2LK4 A;  5K0I A;  2DYR C;  5DQT A;  2NRK A;  4BJ5 C;  4GEH A;  4M9L A;  5L0I A;  2XM0 A;  3AU2 A;  2DR8 A;  3GOR A;  4O79 A;  4YD2 A;  2BCS A;  2HMZ A;  2XLV A;  3H39 A;  7ICP A;  4K4G A;  7ICU A;  7ICO A;  1YZC A;  4UB4 A;  1TWC A;  4S3N A;  3ITF A;  2R02 A;  3NYL A;  2E87 A;  4IRU A;  4K4H A;  2A0B A;  5DB6 A;  4X0A A;  5EHH A;  4R66 A;  2ID1 A;  1HW2 A;  1M2O A;  1E83 A;  3K66 A;  1CGN A;  2YL7 A;  5DS5 A;  5HRG A;  1FNT c;  4EEB A;  4NTF A;  3DKA A;  2H7O A;  5HRD A;  2OQM A;  2VC9 A;  2HHP A;  4IAQ A;  1ZQN A;  2IHM A;  3OVS A;  1ZQE A;  3NRH A;  4O7G A;  4WBZ A;  3RQF A;  7ICF A;  2Z15 A;  4BEM J;  1VK5 A;  2GWW A;  2A6H F;  4HEA J;  1YYJ A;  3UMI A;  3U9J A;  1G8X A;  4KLJ A;  2IXO A;  1NFO A;  2ISP A;  1A7V A;  2DRB A;  1YZA A;  5J2C A;  2GA9 D;  4JTD B;  2FMQ A;  2B4V A;  2L7A A;  4IQU A;  2YHS A;  1OXK A;  3RH4 A;  3DI5 A;  3KYI A;  1ZJN A;  4WQK A;  4PHA A;  5F5F A;  3S27 A;  3UMH A;  4BJ6 C;  2R7X A;  4G7Z F;  2OJQ A;  1YVI A;  4KM5 A;  4PHP A;  1OCO C;  8ICV A;  4XLN F;  5HRI A;  1Z23 A;  3E70 C;  3ZVR A;  9ICR A;  4YL1 A;  3B0P A;  3UR3 C;  3RQG A;  4QZI A;  4NM2 A;  5JUA A;  1DOW A;  4I2G A;  5L0H A;  1QZX A;  1T6U A;  4WC3 A;  5DB9 A;  1OW6 A;  3HNL A;  1MQ3 A;  3UPS A;  4RQ1 A;  1APC A;  1E2X A;  3U0C A;  2PF4 E;  1FAP B;  5COG A;  8ICQ A;  4LZD A;  2IOQ A;  1D0Z A;  1Z5Z A;  2PFQ A;  2J9V A;  4CDA A;  4QZB A;  9ICX A;  2NPU A;  5DVW A;  4K8V A;  5DDY A;  4YD1 A;  3T6B A;  3HKK A;  1R89 A;  4C3D A;  4KLF A;  3LS0 A;  4YCX A;  1ZHX A;  5CP2 A;  2VCB A;  5AC4 A;  3JPT A;  1GM5 A;  4QZ9 A;  1ZQS A;  3DD7 A;  1A7E A;  4LT6 A;  3X1O A;  4RBN A;  1WGW A;  3ZIB A;  3MDC A;  2AU5 A;  9ICL A;  1XSP A;  2R25 A;  4MQ9 F;  2J9W A;  1VLS A;  4XPX A;  2Q66 A;  2EWR A;  4I3M A;  1V55 C;  4N4W A;  5CFU A;  5L3V A;  1TV9 A;  4BPM A;  4I2E A;  4XWJ A;  3RJF A;  1VTM P;  2ZXO A;  2KQ9 A;  3QVZ A;  3UPQ A;  5CI9 A;  3NG1 A;  2FAP B;  1QVX A;  5DDM A;  5GPG B;  2ZH9 A;  2GWS A;  4JLZ A;  3W2V A;  3R2P A;  2H7V C;  2HKV A;  4NXT A;  5COM A;  5A6K A;  1TFO B;  5J2K A;  2BPF A;  5A6B D;  5EOZ A;  4RWN A;  7ICH A;  1R4T A;  7ICV A;  2Q7R A;  5KYW A;  1HUO A;  1NU7 D;  4MF2 A;  3LNR A;  4JCH A;  4EWC A;  8ICZ A;  1RZT A;  4JC7 A;  4X4Q A;  4W8K A;  2QE9 A;  2EPL X;  3C8G B;  2R7U A;  1Q79 A;  5BQG A;  3F47 A;  2M64 A;  4NLN A;  1F1M A;  3JPQ A;  1UEV A;  5IIJ A;  4LEY A;  3U8V A;  1RXQ A;  4DOB A;  3ISD A;  4NCQ A;  4GQH A;  4OAH A;  5B1A C;  1NZE A;  2HJ3 A;  3LEO A;  2IYL D;  3S90 A;  3EPV A;  1N1C A;  4ULV A;  4WC4 A;  4I27 A;  3H2V A;  3OA1 A;  1ZQT A;  1ZQO A;  4JE9 A;  3RJH A;  1M2V B;  4UB1 A;  4ER9 A;  2ZHB A;  3HNI A;  1MMN A;  7ICJ A;  1L7C A;  1ZQH A;  3V7L A;  4BEJ A;  3NVO A;  3EGD A;  5BOM A;  4NXW A;  1U6H A;  1JPJ A;  8ICU A;  4FHW A;  4E0H A;  4PGQ A;  4PHD A;  3ASO C;  2Y3B A;  4M9G A;  4AT8 A;  4XPY A;  1ZYR F;  5HHI A;  1RPL A;  5D62 A;  4O5C A;  3B29 A;  4XEK A;  3T4R A;  3ABK C;  3C8Z A;  2XLW A;  2FCL A;  8ICM A;  3TOM A;  1PV3 A;  2R7T A;  5B3S C;  3DM5 A;  1ZQX A;  3M79 A;  3O39 A;  3CAX A;  2DGJ A;  1BPD A;  2CW0 F;  4YMN A;  4K98 A;  3TUL A;  2QY9 A;  3M4C A;  3C8G D;  1KTM A;  1LPE A;  4M9J A;  4Z6C A;  1YLQ A;  3K1H A;  3TD7 A;  2HSQ A;  2J45 A;  1Q0M A;  1XWJ A;  4YL3 A;  3WFS C;  2MHR A;  4OAG A;  1TFK B;  4YL0 A;  2WZL A;  4NLK A;  4P4O A;  4NC3 A;  1OCR C;  3RH3 A;  4WC7 A;  2W4B A;  1ZQR A;  1E84 A;  1RMV A;  3HJ1 A;  1TWG A;  4DXW A;  3AU6 A;  4OIR F;  2H7B A;  2KK1 A;  4GXJ A;  3M15 A;  1RCP A;  1OW8 A;  4EIY A;  5EGY A;  1WTY A;  4ANJ A;  4HX0 A;  3L34 A;  4KB6 A;  1UET A;  5AGF A;  1TWA A;  2KJG A;  1BBH A;  4JJG A;  5HRH A;  3L0I A;  3DE9 A;  5J2D A;  4RQ4 A;  3C18 A;  4TUS A;  1OCZ C;  4OAI Z;  2AP3 A;  2VH3 A;  9ICV A;  4QZ8 A;  4I1M A;  8ICK A;  4D4X A;  2QNL A;  1JQR A;  4LLC A;  4A2N B;  3OWG A;  4K96 A;  5L0F A;  4UB2 A;  3KMI A;  1Q0K A;  2FFH A;  2L6H A;  4F5R A;  2MYS A;  3WAQ A;  3B9Q A;  4RWO A;  1ZHY A;  4XRH A; 
#chains in the Genus database with same CATH homology
 4I2D A;  3HJ4 A;  7ICK A;  1HUZ A;  5IIM A;  2M2V A;  3PMN A;  5J2J A;  5J0W A;  4RT3 A;  9ICK A;  4TUR A;  3B71 A;  3UXO A;  4NQF A;  4IG8 A;  4X4O A;  4X0B A;  4M9H A;  4KLQ A;  4P2H A;  2LK4 A;  4X4U A;  2BCQ A;  9ICC A;  2NRK A;  4AT8 B;  5CHG A;  4F5N A;  5IIK A;  4M9L A;  7ICQ A;  5IIN A;  5J0R A;  3AU2 A;  3NYB A;  2DR8 A;  4X4S A;  2ZHA A;  2ZH5 A;  1ZQJ A;  3ISB A;  1ZQD A;  1K04 A;  2ISO A;  4YD2 A;  2BCS A;  4RQ6 A;  1ZQV A;  3H39 A;  7ICP A;  4K4G A;  4NKU A;  7ICU A;  7ICO A;  4UD4 A;  4UB4 A;  1ZZP A;  4FH3 A;  1ZQZ A;  8ICT A;  4S3N A;  1MQ2 A;  4QZD A;  2BCR A;  4MFF A;  9ICE A;  4RQ5 A;  1BPY A;  8ICX A;  4M04 A;  4K4H A;  5DB6 A;  4X0A A;  9ICM A;  4R66 A;  2ID1 A;  4X4N A;  4F5O A;  4WC1 A;  5J2I A;  4NLZ A;  1BPE A;  4RQ3 A;  2ZH4 A;  5HRG A;  5J2H A;  4F5Q A;  2FMS A;  4KLU A;  3UXN A;  4Z6E A;  8ICA A;  9ICQ A;  5HRD A;  3H37 A;  2HHP A;  9ICO A;  1ZQN A;  1KEJ A;  2IHM A;  4I2C A;  4M9N A;  3OVS A;  5J2G A;  1ZQE A;  8ICN A;  4EBJ A;  4WBZ A;  4KLE A;  3RQF A;  4X4V A;  7ICF A;  3AQM A;  3C2M A;  1NOM A;  3K7D A;  4RPY A;  2M2T A;  2PFN A;  3GDX A;  4WBY A;  5DKW A;  4IQT A;  5J0S A;  5CJ7 A;  4YMM A;  4KLJ A;  2L6F A;  4TUQ A;  5J0P A;  5DBA A;  9ICP A;  4XA5 A;  2DR7 A;  3RH6 A;  2ISP A;  4AT7 B;  4KLH A;  1MIW A;  1BPZ A;  2DRB A;  5J2C A;  1XSN A;  3WFR E;  2FMQ A;  4IQU A;  1ZQP A;  4QZC A;  4PGY A;  3RH4 A;  3AJM A;  1ZJN A;  3MBY A;  7ICG A;  4UAZ A;  2BCU A;  4JWN A;  1V4A A;  4PHA A;  5CR0 A;  5J0U A;  4AT9 B;  4QZA A;  3WFQ E;  4FO6 A;  4PHP A;  8ICV A;  3MFN A;  5HRI A;  9ICR A;  2JPU A;  3UXP A;  3RQG A;  9ICB A;  5HRF A;  3JYY A;  1F5A A;  4QZI A;  4NM2 A;  5HC9 A;  8ICP A;  4RQ2 A;  1ZQF A;  4I2G A;  4FHX A;  4WC3 A;  2BPC A;  4AT9 A;  5DB9 A;  3HX0 A;  4GXK A;  4KLL A;  1OW6 A;  1TVA A;  5J0X A;  4DOC A;  3LQC B;  3WFP A;  4R63 A;  3ISC A;  1MQ3 A;  3UPS A;  4RQ1 A;  7ICS A;  4MF8 A;  2BPG A;  3RJE A;  4GXI A;  5CWR A;  4E80 A;  3U0C A;  4NM1 A;  1WOT A;  4RQ0 A;  7ICL A;  1PX5 A;  8ICQ A;  2M2U A;  1UFB A;  4LZD A;  3V72 A;  1ZQM A;  9ICS A;  7ICI A;  2PFO A;  7ICM A;  4FH5 A;  1VFG A;  4UBC A;  3JZ0 A;  3PML A;  4ATB A;  2PFQ A;  1JOG A;  4PH5 A;  4UD5 A;  1R8C A;  4QZB A;  3C2L A;  9ICX A;  8ICW A;  4MFC A;  5DDY A;  4YD1 A;  4WCW A;  1MIY A;  8ICF A;  9ICG A;  4Z6F A;  4DO9 A;  2RFF A;  3V7J A;  5DEC A;  1ZJM A;  1R89 A;  7ICT A;  4KLF A;  3V7K A;  4FHY A;  4NXZ A;  4YCX A;  5DED A;  3H38 A;  5J0T A;  5CP2 A;  4FHP A;  1JN3 A;  2ZH8 A;  4RWQ A;  5DBB A;  1UEU A;  3JPT A;  4QZ9 A;  1ZQS A;  1OW7 A;  1R8B A;  4LT6 A;  1WWP A;  4M2Y A;  3MDC A;  9ICL A;  1XSP A;  4UAY A;  4R32 A;  2ZH2 A;  1KDH A;  2O5A A;  3OUY B;  2Q66 A;  1TV9 A;  4I2E A;  2FMP A;  3RJF A;  5HR9 A;  2DRA A;  1ZQI A;  4XQ8 A;  3UPQ A;  3UQ0 A;  5J2A A;  3RJI A;  3AQN A;  3C2K A;  4WC2 A;  1QVX A;  5DDM A;  4RPX A;  3GM3 A;  2ZH9 A;  2GWS A;  9ICF A;  4FHV A;  4X4T A;  3HIY A;  1ZQY A;  4AT7 A;  1NO5 A;  4M47 A;  5J2K A;  3K75 D;  4YMO A;  3RJG A;  9ICJ A;  2BPF A;  3C5F A;  2DR9 A;  5EOZ A;  4RWN A;  7ICH A;  8ICI A;  5J0Q A;  7ICV A;  4RQ8 A;  1HUO A;  4O9M A;  4EP7 A;  5CA7 A;  4WC5 A;  4MF2 A;  9ICI A;  8ICZ A;  1RZT A;  4X4Q A;  3C8G B;  3GM2 A;  4P4M A;  5J0Y A;  3L9D A;  3HWT A;  1Q79 A;  5HRE A;  3OVB A;  3C8G A;  1ZQC A;  9ICT A;  4X5V A;  4NLN A;  8ICR A;  1KNY A;  3JPQ A;  8ICB A;  5HHH A;  5HRL A;  5J2F A;  1UEV A;  5IIJ A;  2ZH1 A;  4XEV A;  2ZH3 A;  3H3A A;  4DOB A;  3ISD A;  2I9G A;  1MIV A;  4I2I A;  4QZH A;  4I2A A;  3HW8 A;  2YWA A;  7ICE A;  4WC4 A;  4I27 A;  1ZQT A;  4YN4 A;  1ZQO A;  4X4R A;  3RJH A;  4UB1 A;  2ZHB A;  8ICH A;  5D46 A;  7ICJ A;  5III A;  1TFW A;  1ZQH A;  3V7L A;  3MGI A;  4M0A A;  3AQL A;  5BOM A;  4NY8 A;  1FA0 A;  4WC0 A;  2HSB A;  8ICU A;  7ICR A;  4FHW A;  4UAW A;  3JPO A;  1ZQB A;  3JPN A;  8ICC A;  5J29 A;  3L8J A;  4PGQ A;  4I2F A;  4PHD A;  1JMS A;  3RQE A;  3OUY A;  4DOA A;  4Z6D A;  4KLS A;  5HRK A;  1ZQA A;  4M9G A;  4AT8 A;  5IIL A;  3WFO A;  5HHI A;  4KLM A;  5D49 A;  7ICN A;  4XEF A;  1RPL A;  4M5D A;  5CB1 A;  3C5G A;  4O5C A;  9ICW A;  4EBK A;  1BPB A;  3TFS A;  4I2J A;  4XEK A;  5F28 E;  2PFP A;  8ICM A;  1PV3 A;  4I28 A;  3OGU A;  2JX0 A;  1OU5 A;  1ZQX A;  3JPP A;  4KLO A;  3TFR A;  9ICU A;  8ICE A;  3OV7 A;  1BPD A;  4X4P A;  4YMN A;  4NKT A;  1ZQU A;  3TUL A;  3C8G D;  1KTM A;  3U3F A;  5BOL A;  4M9J A;  4Z6C A;  4I29 A;  1YLQ A;  1WOL A;  4PHE A;  8ICL A;  5DB7 A;  4JWM A;  4KLT A;  4XQ7 A;  3L8I A;  3GM1 A;  3WFS C;  2P66 A;  4LVS A;  2VAN A;  4RWP A;  2DVI A;  3OVA A;  1O3U A;  3JPR A;  2BE3 A;  4NLK A;  1ZQQ A;  3C66 A;  4P4O A;  3O10 A;  8ICJ A;  1JAJ A;  5DBC A;  4QZE A;  5D4B A;  4KLD A;  3S9O A;  8ICO A;  4WC7 A;  4IQW A;  1ZQR A;  1ZQK A;  3HJ1 A;  4LZG A;  2M2W A;  3AU6 A;  2KK1 A;  4ATB B;  5F2V O;  4RQ7 A;  4GXJ A;  1BPX A;  3PNC A;  2PXI A;  1Q78 A;  4QZG A;  5BPC A;  4KLG A;  4MFA A;  1OW8 A;  9ICH A;  4UBB A;  4PPX A;  1WTY A;  1VJ7 A;  3RJJ A;  1R8A A;  4I2H A;  1XSL A;  5J2B A;  4O5K A;  1UET A;  2Q00 A;  2L6G A;  3MDA A;  8ICG A;  3RJK A;  3B0X A;  4E8F A;  5HRH A;  4TUP A;  4I2B A;  3BRJ A;  2W9M A;  3JPS A;  5J2D A;  4WC6 A;  1ZQW A;  4RT2 A;  2ZH7 A;  4RQ4 A;  1ZQL A;  3C18 A;  5IIO A;  2BCV A;  4P4P A;  4F5P A;  4TUS A;  9ICV A;  1ZQG A;  5HRB A;  4QZ8 A;  3LK9 A;  2ZH6 A;  2PBE A;  4K4I A;  8ICK A;  5DB8 A;  4RPZ A;  2DR5 A;  4PGX A;  4XUS A;  4R65 A;  4O5E A;  2O1P A;  4IQV A;  4E7X A;  3AUO A;  4UB3 A;  4UB5 A;  1JQR A;  4KLI A;  1K40 A;  9ICA A;  4QZF A;  3UQ2 A;  4UB2 A;  5TZV A;  1K05 A;  5J0O A;  4R64 A;  2L6H A;  4F5R A;  5J2E A;  1TFY A;  8ICS A;  8ICY A;  9ICN A;  4RWO A;  3RH5 A;  4XRH A;  3B0Y A;  3MGH A;  3AQK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...