2M2WA

Ternary complex of asfv pol x with dna and mgdgtp
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
174
structure length
174
Chain Sequence
MLTLIQGKKIVNHLRSRLAFEYNGQLIKILSKNIVAVGSLRREEKMLNDVDLLIIVPEKKLLKHVLPNIRIKGLSFSVKVCGERKCVLFIEWEKKTYQLDLFTALAEEKPYAIFHFTGPVSYLIRIRAALKKKNYKLNQYGLFKNQTLVPLKITTEKELIKELGFTYRIPKKRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title How a low-fidelity DNA polymerase chooses non-Watson-Crick from Watson-Crick incorporation.
pubmed doi rcsb
source organism African swine fever virus
molecule tags Transferase/dna
molecule keywords Repair DNA polymerase X
total genus 37
structure length 174
sequence length 174
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 2m2wA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 2m2wA01
4AT9B 7ICLA 4Z6DA 4I2AA 2BCVA 4XQ8A 4M9LA 3V7JA 5DECA 5HREA 8ICZA 4YN4A 5J0QA 2FMQA 4F5PA 1ZQQA 4WC7A 3RJFA 4I27A 4RQ3A 1ZQEA 4LZDA 4YMOA 4X5VA 5HRBA 3UXPA 5HRIA 4X4NA 2BPFA 4EP7A 1JAJA 5IIIA 8ICKA 7ICQA 3RJKA 4R65A 3AQLA 1ZJNA 4X4VA 3C2LA 4WBYA 3HJ4A 5CA7A 2PFNA 3B0YA 4QZAA 5J2CA 3JPTA 7ICIA 7ICKA 9ICLA 1ZQMA 4R63A 4QZFA 1V4AA 4KLGA 4RWQA 5J0RA 4UAZA 5HRGA 4PHPA 3C5GA 4DOBA 4TUQA 5J2GA 3MBYA 8ICVA 4Z6CA 4PHAA 9ICXA 4YD1A 7ICMA 2M2TA 5BPCA 1HUZA 2BPGA 4PGQA 3HX0A 1ZQSA 4RQ2A 1Q79A 3NYBA 4RPYA 4M04A 5CR0A 4MFAA 3MGIA 9ICFA 9ICPA 2DR8A 4AT7B 2DR9A 5CHGA 4X4RA 4K4GA 2PXIA 5J0WA 8ICQA 4E8FA 5HC9A 2BCRA 4I2CA 1KDHA 3H3AA 1VFGA 4AT9A 1RPLA 1Q78A 3GDXA 1R89A 4DOAA 9ICEA 3RJGA 3JPRA 3RH6A 2ZHBA 4QZEA 4UD4A 4WBZA 5IILA 9ICMA 5HRFA 3OVSA 3RJIA 4M9NA 4Z6EA 1ZQAA 2O5AA 5DDMA 2BCSA 9ICNA 9ICVA 4QZCA 4RQ4A 4R64A 4X4TA 2ZH3A 3MDCA 5BOLA 1ZQJA 4O5KA 2FMSA 4FHYA 1F5AA 4UAYA 4XUSA 4RWNA 3C2MA 4P4OA 1UETA 2ZH5A 8ICRA 7ICFA 5DBAA 1RZTA 4UD5A 4WCWA 4ATBA 4YMNA 4QZ8A 5IIOA 2ZH9A 4Z6FA 4NY8A 4XRHA 2NRKA 4DO9A 4K4HA 4PPXA 5D49A 4P4MA 3WFQE 8ICMA 4E80A 3RH5A 4QZ9A 5HRLA 5HRKA 2BPCA 9ICAA 8ICSA 4E7XA 5IIKA 7ICSA 2FMPA 2BCUA 4PHDA 4RWPA 5D46A 5BOMA 4F5NA 2GWSA 4RQ5A 3JPSA 5J2IA 3TFSA 7ICOA 5DB6A 2HHPA 3LQCB 4PH5A 1ZQZA 4R66A 3RJEA 4F5RA 2DRAA 3OUYA 4EBJA 4MFFA 4I2FA 1ZQLA 1ZQNA 1R8CA 8ICXA 3OGUA 4QZDA 3UQ0A 4YCXA 7ICTA 1KEJA 8ICOA 1ZQOA 4M9GA 2PFOA 7ICUA 1WOTA 4IQWA 3ISCA 1TFYA 4WC1A 4FH5A 1TVAA 3RJJA 5J2KA 9ICSA 2ID1A 4X4UA 3WFOA 5J29A 3PMNA 1FA0A 1TFWA 4IQUA 4QZIA 4KLLA 3AQMA 3JYYA 7ICNA 3WFRE 5DBBA 4KLDA 4I2DA 8ICWA 4WC2A 4RQ6A 4LT6A 3L9DA 4RQ8A 5J0YA 4S3NA 3OUYB 5TZVA 4UB3A 9ICIA 1ZQXA 1ZQVA 9ICWA 8ICAA 4KLIA 9ICGA 4M47A 4MFCA 5EOZA 5J2FA 5J2BA 4X0BA 3JPPA 3WFPA 1PX5A 4GXJA 5IIMA 4ATBB 1ZQCA 5HR9A 2VANA 5J0PA 8ICBA 2DRBA 9ICRA 4TUPA 9ICTA 1ZQPA 2BCQA 1NOMA 3C2KA 4JWNA 5HHHA 3PMLA 1KNYA 4O9MA 4NLZA 2PBEA 2ZH2A 1XSNA 7ICRA 4I29A 3V7LA 3PNCA 4X4PA 2M2WA 8ICHA 4P4PA 3HJ1A 3UXNA 3B0XA 5J2AA 1JQRA 1YLQA 1JN3A 5J2HA 8ICEA 9ICQA 1R8BA 4NM1A 1VJ7A 8ICNA 4I2EA 4UBBA 3AU2A 4UB5A 4EBKA 3JPQA 1BPDA 5CB1A 3AU6A 2M2UA 5DDYA 2DR5A 4NLNA 4FHVA 4NLKA 2DVIA 4YMMA 4LVSA 4MF2A 5CJ7A 5J0SA 1ZQWA 9ICOA 4IQVA 4KLMA 7ICJA 2ZHAA 3AUOA 4RT2A 4FO6A 1BPBA 8ICCA 4RT3A 3OV7A 4XQ7A 4WC3A 5HRDA 4UB4A 5DKWA 1ZQFA 4M0AA 4M2YA 4KLOA 4AT8B 8ICJA 5HHIA 4AT7A 1ZQIA 4UB2A 8ICTA 4FH3A 4I2BA 9ICJA 3H39A 4RPZA 3H38A 4KLSA 2ZH1A 2M2VA 3TFRA 5CP2A 3JPOA 9ICBA 2Q66A 1UEUA 2ISPA 3HIYA 5F2VO 4DOCA 4RQ0A 8ICUA 9ICKA 2BE3A 4X4SA 5IIJA 4X4QA 4F5QA 3LK9A 4JWMA 3ISBA 3WFSC 1JMSA 5DB7A 1ZQGA 3HW8A 2PFQA 3RJHA 1MIWA 4NKUA 4PHEA 5J2JA 4K4IA 4O5EA 7ICHA 4RQ1A 4F5OA 5HRHA 4TUSA 4WC4A 3AQKA 4M9JA 3H37A 1ZJMA 4TURA 3UPQA 1BPZA 1XSLA 4WC0A 1BPXA 4PGXA 4I2JA 2ZH8A 5J0OA 3UXOA 1ZQTA 4GXIA 1ZQBA 1ZQDA 4AT8A 4NXZA 4X0AA 4NM2A 8ICLA 3MGHA 3ISDA 5J0UA 4KLFA 1NO5A 5D4BA 1BPYA 4KLHA 5J2DA 1R8AA 1OU5A 5DBCA 4KLEA 4FHWA 4M5DA 3OVAA 5DB8A 4UAWA 8ICFA 1ZQRA 7ICEA 5DB9A 4IG8A 4QZGA 4WC5A 4RPXA 4NKTA 5DEDA 4FHPA 7ICVA 4IQTA 4UB1A 1BPEA 4KLUA 7ICPA 8ICGA 1UEVA 1ZQKA 5J2EA 1ZQUA 3V7KA 2ISOA 9ICHA 1MIYA 3RH4A 3UPSA 4FHXA 2P66A 5J0XA 4QZBA 1XSPA 4QZHA 4M9HA 4UBCA 3AQNA 4PGYA 1ZQHA 4I28A 4KLQA 1MQ3A 4O5CA 2ZH6A 1TV9A 4RQ7A 4WC6A 4YD2A 3V72A 4I2HA 2ZH7A 8ICPA 9ICCA 2W9MA 4MF8A 3K75D 2O1PA 4X4OA 4I2IA 7ICGA 4KLTA 3C18A 2PFPA 4I2GA 3MDAA 1ZQYA 2IHMA 8ICIA 3C66A 3JPNA 2ZH4A 3JZ0A 4XA5A 5J0TA 3UQ2A 4LZGA 4RWOA 4GXKA 9ICUA 4P2HA 2DR7A 2RFFA 4KLJA 5CWRA 1MQ2A 8ICYA 3OVBA 2I9GA 1MIVA 1HUOA 3HWTA 5IINA 3C5FA
chains in the Genus database with same CATH superfamily
2IUBA 4AT9B 7ICLA 4Z6DA 4WOYA 4I2AA 5B3PA 2BCVA 4XQ8A 4M9LA 4WQKA 3V7JA 5DECA 5HREA 8ICZA 4N7RA 4YN4A 5J0QA 2FMQA 4LEWA 4F5PA 1ZQQA 4WC7A 3RJFA 4I27A 4RQ3A 1ZQEA 4LZDA 4YMOA 4X5VA 5HRBA 3UXPA 5HRIA 4X4NA 2BPFA 4EP7A 1JAJA 5IIIA 8ICKA 7ICQA 3RJKA 4R65A 3AQLA 1ZJNA 4X4VA 3C2LA 4WBYA 4FO1A 3HJ4A 5CA7A 2PFNA 4EV6A 3B0YA 4QZAA 5J2CA 3JPTA 7ICIA 7ICKA 9ICLA 1ZQMA 4R63A 4QZFA 1V4AA 4KLGA 4RWQA 5J0RA 4UAZA 5HRGA 4PHPA 3C5GA 4DOBA 4KM5A 4TUQA 5J2GA 3MBYA 8ICVA 5CFUA 4Z6CA 4PHAA 9ICXA 4YD1A 7ICMA 2M2TA 5BPCA 1HUZA 2HN1A 2BPGA 4PGQA 3HX0A 1ZQSA 4RQ2A 1Q79A 3NYBA 4RPYA 4M04A 5CR0A 4MFAA 3MGIA 3JCFA 9ICFA 9ICPA 2DR8A 3PHZA 4AT7B 2DR9A 5CHGA 4X4RA 4K4GA 2PXIA 5J0WA 8ICQA 4E8FA 5HC9A 2BCRA 4I2CA 1KDHA 3H3AA 1VFGA 2GAFD 4AT9A 1RPLA 1Q78A 3GDXA 1R89A 4DOAA 9ICEA 3RJGA 4WQLA 3JPRA 3RH6A 2ZHBA 4QZEA 4UD4A 4WBZA 5IILA 9ICMA 5HRFA 3OVSA 3RJIA 4M9NA 4Z6EA 2IHOA 1ZQAA 2O5AA 5DDMA 2BCSA 9ICNA 9ICVA 4QZCA 4RQ4A 4R64A 4O6AA 4X4TA 2ZH3A 4K9AA 3MDCA 5BOLA 1ZQJA 4O5KA 2FMSA 2GA9D 4FHYA 1F5AA 4UAYA 4XUSA 4RWNA 3C2MA 4P4OA 4K97A 1UETA 2ZH5A 8ICRA 7ICFA 5DBAA 1RZTA 4UD5A 4WCWA 4JLXA 4ATBA 4YMNA 4QZ8A 5IIOA 4OAIZ 3ER8C 2ZH9A 4Z6FA 4NY8A 4XRHA 2NRKA 4DO9A 4K4HA 4PPXA 5D49A 4P4MA 3WFQE 8ICMA 4NXTA 4E80A 3RH5A 4QZ9A 5HRLA 5HRKA 2BPCA 9ICAA 8ICSA 5D62A 4E7XA 5IIKA 3NVOA 7ICSA 2FMPA 4OAGA 2BCUA 4PHDA 3ER9B 4RWPA 5D46A 5BOMA 4F5NA 4O67A 2GWSA 4RQ5A 3JPSA 5CHEA 5J2IA 3TFSA 7ICOA 5DB6A 2HHPA 3LQCB 4PH5A 1ZQZA 4R66A 3RJEA 4F5RA 2DRAA 3OUYA 4EBJA 3OWGA 4MFFA 2B51A 4I2FA 1ZQLA 1ZQNA 1R8CA 8ICXA 3OGUA 4QZDA 3UQ0A 4YCXA 7ICTA 1KEJA 8ICOA 1ZQOA 4M9GA 2PFOA 7ICUA 1WOTA 4IQWA 3ISCA 1TFYA 4WC1A 4FH5A 1TVAA 3RJJA 4K8VA 5J2KA 9ICSA 2ID1A 4X4UA 3WFOA 5J29A 3PMNA 1FA0A 4OAHA 1TFWA 4IQUA 4QZIA 4KLLA 4JLZA 3AQMA 3JYYA 7ICNA 3WFRE 5DBBA 4KLDA 4I2DA 8ICWA 4WC2A 4K98A 4RQ6A 4LT6A 3L9DA 4RQ8A 5J0YA 5D63A 4S3NA 3OUYB 5TZVA 4UB3A 9ICIA 1ZQXA 4EEDA 1ZQVA 9ICWA 8ICAA 4KLIA 9ICGA 4M47A 4MFCA 4LEZA 5EOZA 5J2FA 5J2BA 4O68A 4X0BA 3JPPA 4NXWA 3WFPA 1PX5A 4GXJA 5IIMA 4ATBB 1ZQCA 5HR9A 2VANA 5J0PA 8ICBA 2DRBA 9ICRA 4TUPA 9ICTA 1ZQPA 2BCQA 4O69A 1NOMA 3C2KA 4JWNA 5HHHA 3PMLA 1KNYA 4O9MA 4NLZA 2PBEA 2ZH2A 1XSNA 7ICRA 4I29A 3V7LA 3PNCA 4X4PA 2M2WA 8ICHA 4P4PA 3HJ1A 4EGWA 3UXNA 3B0XA 5J2AA 1JQRA 1YLQA 1JN3A 5J2HA 8ICEA 9ICQA 1R8BA 4NM1A 3NKUA 4I0UA 1VJ7A 8ICNA 4I2EA 4UBBA 3AU2A 2FCLA 4UB5A 3MCRA 4EBKA 3JPQA 1BPDA 5CB1A 3AU6A 2M2UA 5DDYA 2DR5A 4NLNA 4FHVA 4NLKA 2DVIA 4YMMA 4LVSA 4MF2A 2B56A 5CJ7A 5J0SA 1ZQWA 9ICOA 4IQVA 4KLMA 7ICJA 2ZHAA 3AUOA 4RT2A 4FO6A 4K99A 1BPBA 8ICCA 4RT3A 3OV7A 4XQ7A 4WC3A 5HRDA 4UB4A 5DKWA 1ZQFA 4M0AA 4M2YA 4KLOA 4AT8B 8ICJA 4NXUA 5HHIA 4AT7A 1ZQIA 3ERCC 4UB2A 8ICTA 4WH5A 4FH3A 4I2BA 9ICJA 3H39A 4RPZA 3H38A 4KLSA 2ZH1A 2M2VA 3TFRA 5CP2A 3JPOA 9ICBA 2Q66A 1UEUA 2ISPA 3HIYA 5F2VO 4HX0A 4LEYA 4DOCA 4RQ0A 8ICUA 9ICKA 2BE3A 5CFTA 4X4SA 5IIJA 4X4QA 4F5QA 3LK9A 4JWMA 3ISBA 3WFSC 4NXVA 1JMSA 5DB7A 1ZQGA 3HW8A 2PFQA 3RJHA 1MIWA 4NKUA 4PHEA 5J2JA 4K4IA 4O5EA 7ICHA 4RQ1A 4F5OA 5HRHA 4TUSA 4WC4A 3AQKA 4XJEA 4M9JA 3H37A 1ZJMA 4TURA 3UPQA 1BPZA 4K9BA 1XSLA 4WC0A 1BPXA 4PGXA 4I2JA 2ZH8A 5J0OA 3UXOA 1ZQTA 4GXIA 1ZQBA 1ZQDA 2EWRA 4AT8A 4NXZA 4X0AA 4KB6A 3K7DA 4NM2A 8ICLA 3MGHA 3ISDA 5J0UA 4KLFA 1NO5A 5D4BA 1BPYA 4KLHA 5J2DA 2HN2A 1R8AA 1OU5A 5DBCA 4KLEA 4FHWA 4M5DA 3OVAA 5DB8A 4UAWA 8ICFA 1ZQRA 3EF2A 7ICEA 5DB9A 4IG8A 4NXXA 4QZGA 4WC5A 4RPXA 4NKTA 5DEDA 4FHPA 7ICVA 4IQTA 4UB1A 1BPEA 4KLUA 5B3QA 7ICPA 8ICGA 4MKPA 1UEVA 1ZQKA 5J2EA 1ZQUA 4LEVA 3V7KA 2ISOA 9ICHA 1MIYA 3RH4A 2BBHA 3UPSA 4FHXA 2BBJA 2P66A 2B4VA 5J0XA 4QZBA 4K96A 1XSPA 4QZHA 4M9HA 4UBCA 3AQNA 4PGYA 1ZQHA 4I28A 4KLQA 1MQ3A 4O5CA 2ZH6A 1TV9A 4RQ7A 4WC6A 4YD2A 3V72A 4I2HA 2ZH7A 8ICPA 9ICCA 2W9MA 1GPJA 4EEBA 4MF8A 3K75D 2O1PA 4X4OA 4I2IA 7ICGA 4KLTA 3C18A 2PFPA 5D61A 4I2GA 5JTGA 3MDAA 1ZQYA 2IHMA 8ICIA 3C66A 5CFSA 3NWIA 3JPNA 4OAFA 2ZH4A 3JZ0A 4XA5A 5J0TA 3UQ2A 4LZGA 4RWOA 4GXKA 9ICUA 3CK6A 4P2HA 2DR7A 2RFFA 4KLJA 5CWRA 1MQ2A 8ICYA 3OVBA 2I9GA 1MIVA 1HUOA 3HWTA 5IINA 3C5FA
chains in the Genus database with same CATH topology
4AT9B 7ICLA 4Z6DA 4I2AA 2BCVA 4XQ8A 4M9LA 3V7JA 5DECA 5HREA 8ICZA 4YN4A 5J0QA 2FMQA 4F5PA 1ZQQA 4WC7A 3RJFA 4I27A 4RQ3A 1ZQEA 4LZDA 4YMOA 4X5VA 5HRBA 3UXPA 5HRIA 4X4NA 2BPFA 4EP7A 1JAJA 5IIIA 8ICKA 7ICQA 3RJKA 4R65A 3AQLA 1ZJNA 4X4VA 3C2LA 4WBYA 3HJ4A 5CA7A 2PFNA 3B0YA 4QZAA 5J2CA 3JPTA 7ICIA 7ICKA 9ICLA 1ZQMA 4R63A 4QZFA 1V4AA 4KLGA 4RWQA 5J0RA 4UAZA 5HRGA 4PHPA 3C5GA 4DOBA 4TUQA 5J2GA 3MBYA 8ICVA 4Z6CA 4PHAA 9ICXA 4YD1A 7ICMA 2M2TA 5BPCA 1HUZA 2BPGA 4PGQA 3HX0A 1ZQSA 4RQ2A 1Q79A 3NYBA 4RPYA 4M04A 5CR0A 4MFAA 3MGIA 9ICFA 9ICPA 2DR8A 4AT7B 2DR9A 5CHGA 4X4RA 4K4GA 2PXIA 5J0WA 8ICQA 4E8FA 5HC9A 2BCRA 4I2CA 1KDHA 3H3AA 1VFGA 4AT9A 1RPLA 1Q78A 3GDXA 1R89A 4DOAA 9ICEA 3RJGA 3JPRA 3RH6A 2ZHBA 4QZEA 4UD4A 4WBZA 5IILA 9ICMA 5HRFA 3OVSA 3RJIA 4M9NA 4Z6EA 1ZQAA 2O5AA 5DDMA 2BCSA 9ICNA 9ICVA 4QZCA 4RQ4A 4R64A 4X4TA 2ZH3A 3MDCA 5BOLA 1ZQJA 4O5KA 2FMSA 4FHYA 1F5AA 4UAYA 4XUSA 4RWNA 3C2MA 4P4OA 1UETA 2ZH5A 8ICRA 7ICFA 5DBAA 1RZTA 4UD5A 4WCWA 4ATBA 4YMNA 4QZ8A 5IIOA 2ZH9A 4Z6FA 4NY8A 4XRHA 2NRKA 4DO9A 4K4HA 4PPXA 5D49A 4P4MA 3WFQE 8ICMA 4E80A 3RH5A 4QZ9A 5HRLA 5HRKA 2BPCA 9ICAA 8ICSA 4E7XA 5IIKA 7ICSA 2FMPA 2BCUA 4PHDA 4RWPA 5D46A 5BOMA 4F5NA 2GWSA 4RQ5A 3JPSA 5J2IA 3TFSA 7ICOA 5DB6A 2HHPA 3LQCB 4PH5A 1ZQZA 4R66A 3RJEA 4F5RA 2DRAA 3OUYA 4EBJA 4MFFA 4I2FA 1ZQLA 1ZQNA 1R8CA 8ICXA 3OGUA 4QZDA 3UQ0A 4YCXA 7ICTA 1KEJA 8ICOA 1ZQOA 4M9GA 2PFOA 7ICUA 1WOTA 4IQWA 3ISCA 1TFYA 4WC1A 4FH5A 1TVAA 3RJJA 5J2KA 9ICSA 2ID1A 4X4UA 3WFOA 5J29A 3PMNA 1FA0A 1TFWA 4IQUA 4QZIA 4KLLA 3AQMA 3JYYA 7ICNA 3WFRE 5DBBA 4KLDA 4I2DA 8ICWA 4WC2A 4RQ6A 4LT6A 3L9DA 4RQ8A 5J0YA 4S3NA 3OUYB 5TZVA 4UB3A 9ICIA 1ZQXA 1ZQVA 9ICWA 8ICAA 4KLIA 9ICGA 4M47A 4MFCA 5EOZA 5J2FA 5J2BA 4X0BA 3JPPA 3WFPA 1PX5A 4GXJA 5IIMA 4ATBB 1ZQCA 5HR9A 2VANA 5J0PA 8ICBA 2DRBA 9ICRA 4TUPA 9ICTA 1ZQPA 2BCQA 1NOMA 3C2KA 4JWNA 5HHHA 3PMLA 1KNYA 4O9MA 4NLZA 2PBEA 2ZH2A 1XSNA 7ICRA 4I29A 3V7LA 3PNCA 4X4PA 2M2WA 8ICHA 4P4PA 3HJ1A 3UXNA 3B0XA 5J2AA 1JQRA 1YLQA 1JN3A 5J2HA 8ICEA 9ICQA 1R8BA 4NM1A 1VJ7A 8ICNA 4I2EA 4UBBA 3AU2A 4UB5A 4EBKA 3JPQA 1BPDA 5CB1A 3AU6A 2M2UA 5DDYA 2DR5A 4NLNA 4FHVA 4NLKA 2DVIA 4YMMA 4LVSA 4MF2A 5CJ7A 5J0SA 1ZQWA 9ICOA 4IQVA 4KLMA 7ICJA 2ZHAA 3AUOA 4RT2A 4FO6A 1BPBA 8ICCA 4RT3A 3OV7A 4XQ7A 4WC3A 5HRDA 4UB4A 5DKWA 1ZQFA 4M0AA 4M2YA 4KLOA 4AT8B 8ICJA 5HHIA 4AT7A 1ZQIA 4UB2A 8ICTA 4FH3A 4I2BA 9ICJA 3H39A 4RPZA 3H38A 4KLSA 2ZH1A 2M2VA 3TFRA 5CP2A 3JPOA 9ICBA 2Q66A 1UEUA 2ISPA 3HIYA 5F2VO 4DOCA 4RQ0A 8ICUA 9ICKA 2BE3A 4X4SA 5IIJA 4X4QA 4F5QA 3LK9A 4JWMA 3ISBA 3WFSC 1JMSA 5DB7A 1ZQGA 3HW8A 2PFQA 3RJHA 1MIWA 4NKUA 4PHEA 5J2JA 4K4IA 4O5EA 7ICHA 4RQ1A 4F5OA 5HRHA 4TUSA 4WC4A 3AQKA 4M9JA 3H37A 1ZJMA 4TURA 3UPQA 1BPZA 1XSLA 4WC0A 1BPXA 4PGXA 4I2JA 2ZH8A 5J0OA 3UXOA 1ZQTA 4GXIA 1ZQBA 1ZQDA 4AT8A 4NXZA 4X0AA 4NM2A 8ICLA 3MGHA 3ISDA 5J0UA 4KLFA 1NO5A 5D4BA 1BPYA 4KLHA 5J2DA 1R8AA 1OU5A 5DBCA 4KLEA 4FHWA 4M5DA 3OVAA 5DB8A 4UAWA 8ICFA 1ZQRA 7ICEA 5DB9A 4IG8A 4QZGA 4WC5A 4RPXA 4NKTA 5DEDA 4FHPA 7ICVA 4IQTA 4UB1A 1BPEA 4KLUA 7ICPA 8ICGA 1UEVA 1ZQKA 5J2EA 1ZQUA 3V7KA 2ISOA 9ICHA 1MIYA 3RH4A 3UPSA 4FHXA 2P66A 5J0XA 4QZBA 1XSPA 4QZHA 4M9HA 4UBCA 3AQNA 4PGYA 1ZQHA 4I28A 4KLQA 1MQ3A 4O5CA 2ZH6A 1TV9A 4RQ7A 4WC6A 4YD2A 3V72A 4I2HA 2ZH7A 8ICPA 9ICCA 2W9MA 4MF8A 3K75D 2O1PA 4X4OA 4I2IA 7ICGA 4KLTA 3C18A 2PFPA 4I2GA 3MDAA 1ZQYA 2IHMA 8ICIA 3C66A 3JPNA 2ZH4A 3JZ0A 4XA5A 5J0TA 3UQ2A 4LZGA 4RWOA 4GXKA 9ICUA 4P2HA 2DR7A 2RFFA 4KLJA 5CWRA 1MQ2A 8ICYA 3OVBA 2I9GA 1MIVA 1HUOA 3HWTA 5IINA 3C5FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AT9 B;  7ICL A;  4Z6D A;  4I2A A;  2BCV A;  4XQ8 A;  4M9L A;  3V7J A;  5DEC A;  5HRE A;  8ICZ A;  4YN4 A;  5J0Q A;  2FMQ A;  4F5P A;  1ZQQ A;  4WC7 A;  3RJF A;  4I27 A;  4RQ3 A;  1ZQE A;  4LZD A;  4YMO A;  4X5V A;  5HRB A;  3UXP A;  5HRI A;  4X4N A;  2BPF A;  4EP7 A;  1JAJ A;  5III A;  8ICK A;  7ICQ A;  3RJK A;  4R65 A;  3AQL A;  1ZJN A;  4X4V A;  3C2L A;  4WBY A;  3HJ4 A;  5CA7 A;  2PFN A;  3B0Y A;  4QZA A;  5J2C A;  3JPT A;  7ICI A;  7ICK A;  9ICL A;  1ZQM A;  4R63 A;  4QZF A;  1V4A A;  4KLG A;  4RWQ A;  5J0R A;  4UAZ A;  5HRG A;  4PHP A;  3C5G A;  4DOB A;  4TUQ A;  5J2G A;  3MBY A;  8ICV A;  4Z6C A;  4PHA A;  9ICX A;  4YD1 A;  7ICM A;  2M2T A;  5BPC A;  1HUZ A;  2BPG A;  4PGQ A;  3HX0 A;  1ZQS A;  4RQ2 A;  1Q79 A;  3NYB A;  4RPY A;  4M04 A;  5CR0 A;  4MFA A;  3MGI A;  9ICF A;  9ICP A;  2DR8 A;  4AT7 B;  2DR9 A;  5CHG A;  4X4R A;  4K4G A;  2PXI A;  5J0W A;  8ICQ A;  4E8F A;  5HC9 A;  2BCR A;  4I2C A;  1KDH A;  3H3A A;  1VFG A;  4AT9 A;  1RPL A;  1Q78 A;  3GDX A;  1R89 A;  4DOA A;  9ICE A;  3RJG A;  3JPR A;  3RH6 A;  2ZHB A;  4QZE A;  4UD4 A;  4WBZ A;  5IIL A;  9ICM A;  5HRF A;  3OVS A;  3RJI A;  4M9N A;  4Z6E A;  1ZQA A;  2O5A A;  5DDM A;  2BCS A;  9ICN A;  9ICV A;  4QZC A;  4RQ4 A;  4R64 A;  4X4T A;  2ZH3 A;  3MDC A;  5BOL A;  1ZQJ A;  4O5K A;  2FMS A;  4FHY A;  1F5A A;  4UAY A;  4XUS A;  4RWN A;  3C2M A;  4P4O A;  1UET A;  2ZH5 A;  8ICR A;  7ICF A;  5DBA A;  1RZT A;  4UD5 A;  4WCW A;  4ATB A;  4YMN A;  4QZ8 A;  5IIO A;  2ZH9 A;  4Z6F A;  4NY8 A;  4XRH A;  2NRK A;  4DO9 A;  4K4H A;  4PPX A;  5D49 A;  4P4M A;  3WFQ E;  8ICM A;  4E80 A;  3RH5 A;  4QZ9 A;  5HRL A;  5HRK A;  2BPC A;  9ICA A;  8ICS A;  4E7X A;  5IIK A;  7ICS A;  2FMP A;  2BCU A;  4PHD A;  4RWP A;  5D46 A;  5BOM A;  4F5N A;  2GWS A;  4RQ5 A;  3JPS A;  5J2I A;  3TFS A;  7ICO A;  5DB6 A;  2HHP A;  3LQC B;  4PH5 A;  1ZQZ A;  4R66 A;  3RJE A;  4F5R A;  2DRA A;  3OUY A;  4EBJ A;  4MFF A;  4I2F A;  1ZQL A;  1ZQN A;  1R8C A;  8ICX A;  3OGU A;  4QZD A;  3UQ0 A;  4YCX A;  7ICT A;  1KEJ A;  8ICO A;  1ZQO A;  4M9G A;  2PFO A;  7ICU A;  1WOT A;  4IQW A;  3ISC A;  1TFY A;  4WC1 A;  4FH5 A;  1TVA A;  3RJJ A;  5J2K A;  9ICS A;  2ID1 A;  4X4U A;  3WFO A;  5J29 A;  3PMN A;  1FA0 A;  1TFW A;  4IQU A;  4QZI A;  4KLL A;  3AQM A;  3JYY A;  7ICN A;  3WFR E;  5DBB A;  4KLD A;  4I2D A;  8ICW A;  4WC2 A;  4RQ6 A;  4LT6 A;  3L9D A;  4RQ8 A;  5J0Y A;  4S3N A;  3OUY B;  5TZV A;  4UB3 A;  9ICI A;  1ZQX A;  1ZQV A;  9ICW A;  8ICA A;  4KLI A;  9ICG A;  4M47 A;  4MFC A;  5EOZ A;  5J2F A;  5J2B A;  4X0B A;  3JPP A;  3WFP A;  1PX5 A;  4GXJ A;  5IIM A;  4ATB B;  1ZQC A;  5HR9 A;  2VAN A;  5J0P A;  8ICB A;  2DRB A;  9ICR A;  4TUP A;  9ICT A;  1ZQP A;  2BCQ A;  1NOM A;  3C2K A;  4JWN A;  5HHH A;  3PML A;  1KNY A;  4O9M A;  4NLZ A;  2PBE A;  2ZH2 A;  1XSN A;  7ICR A;  4I29 A;  3V7L A;  3PNC A;  4X4P A;  2M2W A;  8ICH A;  4P4P A;  3HJ1 A;  3UXN A;  3B0X A;  5J2A A;  1JQR A;  1YLQ A;  1JN3 A;  5J2H A;  8ICE A;  9ICQ A;  1R8B A;  4NM1 A;  1VJ7 A;  8ICN A;  4I2E A;  4UBB A;  3AU2 A;  4UB5 A;  4EBK A;  3JPQ A;  1BPD A;  5CB1 A;  3AU6 A;  2M2U A;  5DDY A;  2DR5 A;  4NLN A;  4FHV A;  4NLK A;  2DVI A;  4YMM A;  4LVS A;  4MF2 A;  5CJ7 A;  5J0S A;  1ZQW A;  9ICO A;  4IQV A;  4KLM A;  7ICJ A;  2ZHA A;  3AUO A;  4RT2 A;  4FO6 A;  1BPB A;  8ICC A;  4RT3 A;  3OV7 A;  4XQ7 A;  4WC3 A;  5HRD A;  4UB4 A;  5DKW A;  1ZQF A;  4M0A A;  4M2Y A;  4KLO A;  4AT8 B;  8ICJ A;  5HHI A;  4AT7 A;  1ZQI A;  4UB2 A;  8ICT A;  4FH3 A;  4I2B A;  9ICJ A;  3H39 A;  4RPZ A;  3H38 A;  4KLS A;  2ZH1 A;  2M2V A;  3TFR A;  5CP2 A;  3JPO A;  9ICB A;  2Q66 A;  1UEU A;  2ISP A;  3HIY A;  5F2V O;  4DOC A;  4RQ0 A;  8ICU A;  9ICK A;  2BE3 A;  4X4S A;  5IIJ A;  4X4Q A;  4F5Q A;  3LK9 A;  4JWM A;  3ISB A;  3WFS C;  1JMS A;  5DB7 A;  1ZQG A;  3HW8 A;  2PFQ A;  3RJH A;  1MIW A;  4NKU A;  4PHE A;  5J2J A;  4K4I A;  4O5E A;  7ICH A;  4RQ1 A;  4F5O A;  5HRH A;  4TUS A;  4WC4 A;  3AQK A;  4M9J A;  3H37 A;  1ZJM A;  4TUR A;  3UPQ A;  1BPZ A;  1XSL A;  4WC0 A;  1BPX A;  4PGX A;  4I2J A;  2ZH8 A;  5J0O A;  3UXO A;  1ZQT A;  4GXI A;  1ZQB A;  1ZQD A;  4AT8 A;  4NXZ A;  4X0A A;  4NM2 A;  8ICL A;  3MGH A;  3ISD A;  5J0U A;  4KLF A;  1NO5 A;  5D4B A;  1BPY A;  4KLH A;  5J2D A;  1R8A A;  1OU5 A;  5DBC A;  4KLE A;  4FHW A;  4M5D A;  3OVA A;  5DB8 A;  4UAW A;  8ICF A;  1ZQR A;  7ICE A;  5DB9 A;  4IG8 A;  4QZG A;  4WC5 A;  4RPX A;  4NKT A;  5DED A;  4FHP A;  7ICV A;  4IQT A;  4UB1 A;  1BPE A;  4KLU A;  7ICP A;  8ICG A;  1UEV A;  1ZQK A;  5J2E A;  1ZQU A;  3V7K A;  2ISO A;  9ICH A;  1MIY A;  3RH4 A;  3UPS A;  4FHX A;  2P66 A;  5J0X A;  4QZB A;  1XSP A;  4QZH A;  4M9H A;  4UBC A;  3AQN A;  4PGY A;  1ZQH A;  4I28 A;  4KLQ A;  1MQ3 A;  4O5C A;  2ZH6 A;  1TV9 A;  4RQ7 A;  4WC6 A;  4YD2 A;  3V72 A;  4I2H A;  2ZH7 A;  8ICP A;  9ICC A;  2W9M A;  4MF8 A;  3K75 D;  2O1P A;  4X4O A;  4I2I A;  7ICG A;  4KLT A;  3C18 A;  2PFP A;  4I2G A;  3MDA A;  1ZQY A;  2IHM A;  8ICI A;  3C66 A;  3JPN A;  2ZH4 A;  3JZ0 A;  4XA5 A;  5J0T A;  3UQ2 A;  4LZG A;  4RWO A;  4GXK A;  9ICU A;  4P2H A;  2DR7 A;  2RFF A;  4KLJ A;  5CWR A;  1MQ2 A;  8ICY A;  3OVB A;  2I9G A;  1MIV A;  1HUO A;  3HWT A;  5IIN A;  3C5F A; 
#chains in the Genus database with same CATH topology
 2IUB A;  4AT9 B;  7ICL A;  4Z6D A;  4WOY A;  4I2A A;  5B3P A;  2BCV A;  4XQ8 A;  4M9L A;  4WQK A;  3V7J A;  5DEC A;  5HRE A;  8ICZ A;  4N7R A;  4YN4 A;  5J0Q A;  2FMQ A;  4LEW A;  4F5P A;  1ZQQ A;  4WC7 A;  3RJF A;  4I27 A;  4RQ3 A;  1ZQE A;  4LZD A;  4YMO A;  4X5V A;  5HRB A;  3UXP A;  5HRI A;  4X4N A;  2BPF A;  4EP7 A;  1JAJ A;  5III A;  8ICK A;  7ICQ A;  3RJK A;  4R65 A;  3AQL A;  1ZJN A;  4X4V A;  3C2L A;  4WBY A;  4FO1 A;  3HJ4 A;  5CA7 A;  2PFN A;  4EV6 A;  3B0Y A;  4QZA A;  5J2C A;  3JPT A;  7ICI A;  7ICK A;  9ICL A;  1ZQM A;  4R63 A;  4QZF A;  1V4A A;  4KLG A;  4RWQ A;  5J0R A;  4UAZ A;  5HRG A;  4PHP A;  3C5G A;  4DOB A;  4KM5 A;  4TUQ A;  5J2G A;  3MBY A;  8ICV A;  5CFU A;  4Z6C A;  4PHA A;  9ICX A;  4YD1 A;  7ICM A;  2M2T A;  5BPC A;  1HUZ A;  2HN1 A;  2BPG A;  4PGQ A;  3HX0 A;  1ZQS A;  4RQ2 A;  1Q79 A;  3NYB A;  4RPY A;  4M04 A;  5CR0 A;  4MFA A;  3MGI A;  3JCF A;  9ICF A;  9ICP A;  2DR8 A;  3PHZ A;  4AT7 B;  2DR9 A;  5CHG A;  4X4R A;  4K4G A;  2PXI A;  5J0W A;  8ICQ A;  4E8F A;  5HC9 A;  2BCR A;  4I2C A;  1KDH A;  3H3A A;  1VFG A;  2GAF D;  4AT9 A;  1RPL A;  1Q78 A;  3GDX A;  1R89 A;  4DOA A;  9ICE A;  3RJG A;  4WQL A;  3JPR A;  3RH6 A;  2ZHB A;  4QZE A;  4UD4 A;  4WBZ A;  5IIL A;  9ICM A;  5HRF A;  3OVS A;  3RJI A;  4M9N A;  4Z6E A;  2IHO A;  1ZQA A;  2O5A A;  5DDM A;  2BCS A;  9ICN A;  9ICV A;  4QZC A;  4RQ4 A;  4R64 A;  4O6A A;  4X4T A;  2ZH3 A;  4K9A A;  3MDC A;  5BOL A;  1ZQJ A;  4O5K A;  2FMS A;  2GA9 D;  4FHY A;  1F5A A;  4UAY A;  4XUS A;  4RWN A;  3C2M A;  4P4O A;  4K97 A;  1UET A;  2ZH5 A;  8ICR A;  7ICF A;  5DBA A;  1RZT A;  4UD5 A;  4WCW A;  4JLX A;  4ATB A;  4YMN A;  4QZ8 A;  5IIO A;  4OAI Z;  3ER8 C;  2ZH9 A;  4Z6F A;  4NY8 A;  4XRH A;  2NRK A;  4DO9 A;  4K4H A;  4PPX A;  5D49 A;  4P4M A;  3WFQ E;  8ICM A;  4NXT A;  4E80 A;  3RH5 A;  4QZ9 A;  5HRL A;  5HRK A;  2BPC A;  9ICA A;  8ICS A;  5D62 A;  4E7X A;  5IIK A;  3NVO A;  7ICS A;  2FMP A;  4OAG A;  2BCU A;  4PHD A;  3ER9 B;  4RWP A;  5D46 A;  5BOM A;  4F5N A;  4O67 A;  2GWS A;  4RQ5 A;  3JPS A;  5CHE A;  5J2I A;  3TFS A;  7ICO A;  5DB6 A;  2HHP A;  3LQC B;  4PH5 A;  1ZQZ A;  4R66 A;  3RJE A;  4F5R A;  2DRA A;  3OUY A;  4EBJ A;  3OWG A;  4MFF A;  2B51 A;  4I2F A;  1ZQL A;  1ZQN A;  1R8C A;  8ICX A;  3OGU A;  4QZD A;  3UQ0 A;  4YCX A;  7ICT A;  1KEJ A;  8ICO A;  1ZQO A;  4M9G A;  2PFO A;  7ICU A;  1WOT A;  4IQW A;  3ISC A;  1TFY A;  4WC1 A;  4FH5 A;  1TVA A;  3RJJ A;  4K8V A;  5J2K A;  9ICS A;  2ID1 A;  4X4U A;  3WFO A;  5J29 A;  3PMN A;  1FA0 A;  4OAH A;  1TFW A;  4IQU A;  4QZI A;  4KLL A;  4JLZ A;  3AQM A;  3JYY A;  7ICN A;  3WFR E;  5DBB A;  4KLD A;  4I2D A;  8ICW A;  4WC2 A;  4K98 A;  4RQ6 A;  4LT6 A;  3L9D A;  4RQ8 A;  5J0Y A;  5D63 A;  4S3N A;  3OUY B;  5TZV A;  4UB3 A;  9ICI A;  1ZQX A;  4EED A;  1ZQV A;  9ICW A;  8ICA A;  4KLI A;  9ICG A;  4M47 A;  4MFC A;  4LEZ A;  5EOZ A;  5J2F A;  5J2B A;  4O68 A;  4X0B A;  3JPP A;  4NXW A;  3WFP A;  1PX5 A;  4GXJ A;  5IIM A;  4ATB B;  1ZQC A;  5HR9 A;  2VAN A;  5J0P A;  8ICB A;  2DRB A;  9ICR A;  4TUP A;  9ICT A;  1ZQP A;  2BCQ A;  4O69 A;  1NOM A;  3C2K A;  4JWN A;  5HHH A;  3PML A;  1KNY A;  4O9M A;  4NLZ A;  2PBE A;  2ZH2 A;  1XSN A;  7ICR A;  4I29 A;  3V7L A;  3PNC A;  4X4P A;  2M2W A;  8ICH A;  4P4P A;  3HJ1 A;  4EGW A;  3UXN A;  3B0X A;  5J2A A;  1JQR A;  1YLQ A;  1JN3 A;  5J2H A;  8ICE A;  9ICQ A;  1R8B A;  4NM1 A;  3NKU A;  4I0U A;  1VJ7 A;  8ICN A;  4I2E A;  4UBB A;  3AU2 A;  2FCL A;  4UB5 A;  3MCR A;  4EBK A;  3JPQ A;  1BPD A;  5CB1 A;  3AU6 A;  2M2U A;  5DDY A;  2DR5 A;  4NLN A;  4FHV A;  4NLK A;  2DVI A;  4YMM A;  4LVS A;  4MF2 A;  2B56 A;  5CJ7 A;  5J0S A;  1ZQW A;  9ICO A;  4IQV A;  4KLM A;  7ICJ A;  2ZHA A;  3AUO A;  4RT2 A;  4FO6 A;  4K99 A;  1BPB A;  8ICC A;  4RT3 A;  3OV7 A;  4XQ7 A;  4WC3 A;  5HRD A;  4UB4 A;  5DKW A;  1ZQF A;  4M0A A;  4M2Y A;  4KLO A;  4AT8 B;  8ICJ A;  4NXU A;  5HHI A;  4AT7 A;  1ZQI A;  3ERC C;  4UB2 A;  8ICT A;  4WH5 A;  4FH3 A;  4I2B A;  9ICJ A;  3H39 A;  4RPZ A;  3H38 A;  4KLS A;  2ZH1 A;  2M2V A;  3TFR A;  5CP2 A;  3JPO A;  9ICB A;  2Q66 A;  1UEU A;  2ISP A;  3HIY A;  5F2V O;  4HX0 A;  4LEY A;  4DOC A;  4RQ0 A;  8ICU A;  9ICK A;  2BE3 A;  5CFT A;  4X4S A;  5IIJ A;  4X4Q A;  4F5Q A;  3LK9 A;  4JWM A;  3ISB A;  3WFS C;  4NXV A;  1JMS A;  5DB7 A;  1ZQG A;  3HW8 A;  2PFQ A;  3RJH A;  1MIW A;  4NKU A;  4PHE A;  5J2J A;  4K4I A;  4O5E A;  7ICH A;  4RQ1 A;  4F5O A;  5HRH A;  4TUS A;  4WC4 A;  3AQK A;  4XJE A;  4M9J A;  3H37 A;  1ZJM A;  4TUR A;  3UPQ A;  1BPZ A;  4K9B A;  1XSL A;  4WC0 A;  1BPX A;  4PGX A;  4I2J A;  2ZH8 A;  5J0O A;  3UXO A;  1ZQT A;  4GXI A;  1ZQB A;  1ZQD A;  2EWR A;  4AT8 A;  4NXZ A;  4X0A A;  4KB6 A;  3K7D A;  4NM2 A;  8ICL A;  3MGH A;  3ISD A;  5J0U A;  4KLF A;  1NO5 A;  5D4B A;  1BPY A;  4KLH A;  5J2D A;  2HN2 A;  1R8A A;  1OU5 A;  5DBC A;  4KLE A;  4FHW A;  4M5D A;  3OVA A;  5DB8 A;  4UAW A;  8ICF A;  1ZQR A;  3EF2 A;  7ICE A;  5DB9 A;  4IG8 A;  4NXX A;  4QZG A;  4WC5 A;  4RPX A;  4NKT A;  5DED A;  4FHP A;  7ICV A;  4IQT A;  4UB1 A;  1BPE A;  4KLU A;  5B3Q A;  7ICP A;  8ICG A;  4MKP A;  1UEV A;  1ZQK A;  5J2E A;  1ZQU A;  4LEV A;  3V7K A;  2ISO A;  9ICH A;  1MIY A;  3RH4 A;  2BBH A;  3UPS A;  4FHX A;  2BBJ A;  2P66 A;  2B4V A;  5J0X A;  4QZB A;  4K96 A;  1XSP A;  4QZH A;  4M9H A;  4UBC A;  3AQN A;  4PGY A;  1ZQH A;  4I28 A;  4KLQ A;  1MQ3 A;  4O5C A;  2ZH6 A;  1TV9 A;  4RQ7 A;  4WC6 A;  4YD2 A;  3V72 A;  4I2H A;  2ZH7 A;  8ICP A;  9ICC A;  2W9M A;  1GPJ A;  4EEB A;  4MF8 A;  3K75 D;  2O1P A;  4X4O A;  4I2I A;  7ICG A;  4KLT A;  3C18 A;  2PFP A;  5D61 A;  4I2G A;  5JTG A;  3MDA A;  1ZQY A;  2IHM A;  8ICI A;  3C66 A;  5CFS A;  3NWI A;  3JPN A;  4OAF A;  2ZH4 A;  3JZ0 A;  4XA5 A;  5J0T A;  3UQ2 A;  4LZG A;  4RWO A;  4GXK A;  9ICU A;  3CK6 A;  4P2H A;  2DR7 A;  2RFF A;  4KLJ A;  5CWR A;  1MQ2 A;  8ICY A;  3OVB A;  2I9G A;  1MIV A;  1HUO A;  3HWT A;  5IIN A;  3C5F A; 
#chains in the Genus database with same CATH homology
 4AT9 B;  7ICL A;  4Z6D A;  4I2A A;  2BCV A;  4XQ8 A;  4M9L A;  3V7J A;  5DEC A;  5HRE A;  8ICZ A;  4YN4 A;  5J0Q A;  2FMQ A;  4F5P A;  1ZQQ A;  4WC7 A;  3RJF A;  4I27 A;  4RQ3 A;  1ZQE A;  4LZD A;  4YMO A;  4X5V A;  5HRB A;  3UXP A;  5HRI A;  4X4N A;  2BPF A;  4EP7 A;  1JAJ A;  5III A;  8ICK A;  7ICQ A;  3RJK A;  4R65 A;  3AQL A;  1ZJN A;  4X4V A;  3C2L A;  4WBY A;  3HJ4 A;  5CA7 A;  2PFN A;  3B0Y A;  4QZA A;  5J2C A;  3JPT A;  7ICI A;  7ICK A;  9ICL A;  1ZQM A;  4R63 A;  4QZF A;  1V4A A;  4KLG A;  4RWQ A;  5J0R A;  4UAZ A;  5HRG A;  4PHP A;  3C5G A;  4DOB A;  4TUQ A;  5J2G A;  3MBY A;  8ICV A;  4Z6C A;  4PHA A;  9ICX A;  4YD1 A;  7ICM A;  2M2T A;  5BPC A;  1HUZ A;  2BPG A;  4PGQ A;  3HX0 A;  1ZQS A;  4RQ2 A;  1Q79 A;  3NYB A;  4RPY A;  4M04 A;  5CR0 A;  4MFA A;  3MGI A;  9ICF A;  9ICP A;  2DR8 A;  4AT7 B;  2DR9 A;  5CHG A;  4X4R A;  4K4G A;  2PXI A;  5J0W A;  8ICQ A;  4E8F A;  5HC9 A;  2BCR A;  4I2C A;  1KDH A;  3H3A A;  1VFG A;  4AT9 A;  1RPL A;  1Q78 A;  3GDX A;  1R89 A;  4DOA A;  9ICE A;  3RJG A;  3JPR A;  3RH6 A;  2ZHB A;  4QZE A;  4UD4 A;  4WBZ A;  5IIL A;  9ICM A;  5HRF A;  3OVS A;  3RJI A;  4M9N A;  4Z6E A;  1ZQA A;  2O5A A;  5DDM A;  2BCS A;  9ICN A;  9ICV A;  4QZC A;  4RQ4 A;  4R64 A;  4X4T A;  2ZH3 A;  3MDC A;  5BOL A;  1ZQJ A;  4O5K A;  2FMS A;  4FHY A;  1F5A A;  4UAY A;  4XUS A;  4RWN A;  3C2M A;  4P4O A;  1UET A;  2ZH5 A;  8ICR A;  7ICF A;  5DBA A;  1RZT A;  4UD5 A;  4WCW A;  4ATB A;  4YMN A;  4QZ8 A;  5IIO A;  2ZH9 A;  4Z6F A;  4NY8 A;  4XRH A;  2NRK A;  4DO9 A;  4K4H A;  4PPX A;  5D49 A;  4P4M A;  3WFQ E;  8ICM A;  4E80 A;  3RH5 A;  4QZ9 A;  5HRL A;  5HRK A;  2BPC A;  9ICA A;  8ICS A;  4E7X A;  5IIK A;  7ICS A;  2FMP A;  2BCU A;  4PHD A;  4RWP A;  5D46 A;  5BOM A;  4F5N A;  2GWS A;  4RQ5 A;  3JPS A;  5J2I A;  3TFS A;  7ICO A;  5DB6 A;  2HHP A;  3LQC B;  4PH5 A;  1ZQZ A;  4R66 A;  3RJE A;  4F5R A;  2DRA A;  3OUY A;  4EBJ A;  4MFF A;  4I2F A;  1ZQL A;  1ZQN A;  1R8C A;  8ICX A;  3OGU A;  4QZD A;  3UQ0 A;  4YCX A;  7ICT A;  1KEJ A;  8ICO A;  1ZQO A;  4M9G A;  2PFO A;  7ICU A;  1WOT A;  4IQW A;  3ISC A;  1TFY A;  4WC1 A;  4FH5 A;  1TVA A;  3RJJ A;  5J2K A;  9ICS A;  2ID1 A;  4X4U A;  3WFO A;  5J29 A;  3PMN A;  1FA0 A;  1TFW A;  4IQU A;  4QZI A;  4KLL A;  3AQM A;  3JYY A;  7ICN A;  3WFR E;  5DBB A;  4KLD A;  4I2D A;  8ICW A;  4WC2 A;  4RQ6 A;  4LT6 A;  3L9D A;  4RQ8 A;  5J0Y A;  4S3N A;  3OUY B;  5TZV A;  4UB3 A;  9ICI A;  1ZQX A;  1ZQV A;  9ICW A;  8ICA A;  4KLI A;  9ICG A;  4M47 A;  4MFC A;  5EOZ A;  5J2F A;  5J2B A;  4X0B A;  3JPP A;  3WFP A;  1PX5 A;  4GXJ A;  5IIM A;  4ATB B;  1ZQC A;  5HR9 A;  2VAN A;  5J0P A;  8ICB A;  2DRB A;  9ICR A;  4TUP A;  9ICT A;  1ZQP A;  2BCQ A;  1NOM A;  3C2K A;  4JWN A;  5HHH A;  3PML A;  1KNY A;  4O9M A;  4NLZ A;  2PBE A;  2ZH2 A;  1XSN A;  7ICR A;  4I29 A;  3V7L A;  3PNC A;  4X4P A;  2M2W A;  8ICH A;  4P4P A;  3HJ1 A;  3UXN A;  3B0X A;  5J2A A;  1JQR A;  1YLQ A;  1JN3 A;  5J2H A;  8ICE A;  9ICQ A;  1R8B A;  4NM1 A;  1VJ7 A;  8ICN A;  4I2E A;  4UBB A;  3AU2 A;  4UB5 A;  4EBK A;  3JPQ A;  1BPD A;  5CB1 A;  3AU6 A;  2M2U A;  5DDY A;  2DR5 A;  4NLN A;  4FHV A;  4NLK A;  2DVI A;  4YMM A;  4LVS A;  4MF2 A;  5CJ7 A;  5J0S A;  1ZQW A;  9ICO A;  4IQV A;  4KLM A;  7ICJ A;  2ZHA A;  3AUO A;  4RT2 A;  4FO6 A;  1BPB A;  8ICC A;  4RT3 A;  3OV7 A;  4XQ7 A;  4WC3 A;  5HRD A;  4UB4 A;  5DKW A;  1ZQF A;  4M0A A;  4M2Y A;  4KLO A;  4AT8 B;  8ICJ A;  5HHI A;  4AT7 A;  1ZQI A;  4UB2 A;  8ICT A;  4FH3 A;  4I2B A;  9ICJ A;  3H39 A;  4RPZ A;  3H38 A;  4KLS A;  2ZH1 A;  2M2V A;  3TFR A;  5CP2 A;  3JPO A;  9ICB A;  2Q66 A;  1UEU A;  2ISP A;  3HIY A;  5F2V O;  4DOC A;  4RQ0 A;  8ICU A;  9ICK A;  2BE3 A;  4X4S A;  5IIJ A;  4X4Q A;  4F5Q A;  3LK9 A;  4JWM A;  3ISB A;  3WFS C;  1JMS A;  5DB7 A;  1ZQG A;  3HW8 A;  2PFQ A;  3RJH A;  1MIW A;  4NKU A;  4PHE A;  5J2J A;  4K4I A;  4O5E A;  7ICH A;  4RQ1 A;  4F5O A;  5HRH A;  4TUS A;  4WC4 A;  3AQK A;  4M9J A;  3H37 A;  1ZJM A;  4TUR A;  3UPQ A;  1BPZ A;  1XSL A;  4WC0 A;  1BPX A;  4PGX A;  4I2J A;  2ZH8 A;  5J0O A;  3UXO A;  1ZQT A;  4GXI A;  1ZQB A;  1ZQD A;  4AT8 A;  4NXZ A;  4X0A A;  4NM2 A;  8ICL A;  3MGH A;  3ISD A;  5J0U A;  4KLF A;  1NO5 A;  5D4B A;  1BPY A;  4KLH A;  5J2D A;  1R8A A;  1OU5 A;  5DBC A;  4KLE A;  4FHW A;  4M5D A;  3OVA A;  5DB8 A;  4UAW A;  8ICF A;  1ZQR A;  7ICE A;  5DB9 A;  4IG8 A;  4QZG A;  4WC5 A;  4RPX A;  4NKT A;  5DED A;  4FHP A;  7ICV A;  4IQT A;  4UB1 A;  1BPE A;  4KLU A;  7ICP A;  8ICG A;  1UEV A;  1ZQK A;  5J2E A;  1ZQU A;  3V7K A;  2ISO A;  9ICH A;  1MIY A;  3RH4 A;  3UPS A;  4FHX A;  2P66 A;  5J0X A;  4QZB A;  1XSP A;  4QZH A;  4M9H A;  4UBC A;  3AQN A;  4PGY A;  1ZQH A;  4I28 A;  4KLQ A;  1MQ3 A;  4O5C A;  2ZH6 A;  1TV9 A;  4RQ7 A;  4WC6 A;  4YD2 A;  3V72 A;  4I2H A;  2ZH7 A;  8ICP A;  9ICC A;  2W9M A;  4MF8 A;  3K75 D;  2O1P A;  4X4O A;  4I2I A;  7ICG A;  4KLT A;  3C18 A;  2PFP A;  4I2G A;  3MDA A;  1ZQY A;  2IHM A;  8ICI A;  3C66 A;  3JPN A;  2ZH4 A;  3JZ0 A;  4XA5 A;  5J0T A;  3UQ2 A;  4LZG A;  4RWO A;  4GXK A;  9ICU A;  4P2H A;  2DR7 A;  2RFF A;  4KLJ A;  5CWR A;  1MQ2 A;  8ICY A;  3OVB A;  2I9G A;  1MIV A;  1HUO A;  3HWT A;  5IIN A;  3C5F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...