2M2WA

Ternary complex of asfv pol x with dna and mgdgtp
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
174
structure length
174
Chain Sequence
MLTLIQGKKIVNHLRSRLAFEYNGQLIKILSKNIVAVGSLRREEKMLNDVDLLIIVPEKKLLKHVLPNIRIKGLSFSVKVCGERKCVLFIEWEKKTYQLDLFTALAEEKPYAIFHFTGPVSYLIRIRAALKKKNYKLNQYGLFKNQTLVPLKITTEKELIKELGFTYRIPKKRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna
molecule keywords Repair DNA polymerase X
publication title How a low-fidelity DNA polymerase chooses non-Watson-Crick from Watson-Crick incorporation.
pubmed doi rcsb
source organism African swine fever virus
total genus 37
structure length 174
sequence length 174
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 2m2wA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 2m2wA01
7ICEA 4LZGA 4UB3A 5HRHA 5BPCA 4KLJA 4F5RA 4YD1A 4RQ2A 3JPNA 4MFAA 3MGHA 4QZCA 1TV9A 4IQWA 3JPQA 5CHGA 4AT9A 3V72A 3WFSC 4P4PA 3AQKA 9ICVA 3RJKA 1JAJA 2PXIA 4X4SA 1KNYA 3H37A 5J2JA 5HRDA 8ICZA 3TFSA 3MBYA 4PHPA 3OVSA 2DRBA 3PNCA 8ICEA 4RPYA 4X4VA 2FMQA 2BE3A 4UD4A 2M2VA 2FMPA 5DBCA 4RQ6A 3MDCA 5IILA 4RQ0A 4GXKA 1BPBA 8ICOA 4I28A 2ZH8A 1ZQEA 4EP7A 2M2WA 4I2CA 2RFFA 4FH5A 8ICCA 1OU5A 1YLQA 3UQ0A 1ZQSA 4KLTA 9ICPA 4RWPA 1ZQYA 4YD2A 2P66A 3H38A 4YMMA 3AU2A 4QZ9A 3C2MA 5J2GA 8ICXA 4M9NA 5BOMA 5EOZA 4X4OA 5J2AA 2ZH1A 4R64A 4WC3A 3C5FA 8ICYA 4I2GA 3V7KA 1Q79A 4UB1A 4I2BA 4XQ7A 4QZAA 5IIKA 3UXPA 2BCSA 2I9GA 4UBCA 7ICOA 7ICTA 4RT2A 3RH6A 1UETA 8ICFA 1MQ3A 4AT8B 4RT3A 8ICLA 2O5AA 2BPGA 4X4PA 4NLNA 4QZGA 8ICKA 8ICWA 4M0AA 8ICGA 3JPPA 7ICUA 1R8AA 8ICPA 1ZQIA 5J29A 4QZDA 1ZQOA 4I2HA 2IHMA 4RWOA 3WFOA 1MQ2A 1ZJNA 4KLIA 5J0UA 4R63A 1F5AA 4WC5A 4KLEA 4M04A 1ZQQA 1RZTA 3GDXA 1BPXA 4IQVA 4YN4A 3AUOA 2ISOA 4I2JA 3NYBA 3RH5A 9ICSA 4M5DA 4KLUA 1ZQFA 1ZQGA 1ZQAA 9ICQA 4X0AA 2ZH9A 1ZQDA 4E7XA 1TFWA 4M9GA 2GWSA 1ZQJA 1VFGA 4X4TA 4UB2A 4QZHA 4IQTA 3JZ0A 7ICSA 7ICKA 4I2IA 4YMOA 4NY8A 4TUPA 4PGXA 1ZQZA 4F5NA 3B0YA 4X5VA 3HWTA 3AU6A 5DEDA 2M2UA 4XUSA 5DB9A 5DBBA 1ZQVA 5DECA 4ATBA 3OGUA 5J0QA 4KLSA 8ICRA 9ICUA 1ZQPA 1MIYA 8ICIA 3PMLA 5HRLA 4RQ7A 9ICLA 3RJFA 4E8FA 3AQLA 5DBAA 1ZJMA 8ICJA 3UXNA 4AT9B 2BPCA 4FHPA 2DR7A 2W9MA 3JPOA 2ZH4A 4Z6FA 4RWQA 4FH3A 4WBYA 4UAWA 4LT6A 4M9JA 1JMSA 2ZHAA 4LZDA 1ZQRA 4QZEA 1BPYA 4I27A 2BCVA 4DOCA 4KLDA 4YCXA 5J0WA 3UPQA 1BPZA 2PFNA 7ICJA 7ICVA 1PX5A 4AT7A 4AT7B 2ZH2A 7ICPA 4XQ8A 1MIWA 3JPTA 5HREA 3UQ2A 3JYYA 9ICOA 4FHVA 3MGIA 1XSPA 5HRGA 3RJEA 3H39A 4Z6EA 4JWNA 5DKWA 4NKTA 3ISBA 4PH5A 4MFCA 2DVIA 4M9HA 4WC2A 4M47A 5DB6A 4RQ1A 4F5OA 2BPFA 4P2HA 3OV7A 1ZQNA 1ZQWA 5TZVA 5J2DA 3C66A 9ICFA 4F5PA 8ICAA 9ICNA 4FO6A 5HHIA 2ZH5A 4K4IA 4QZIA 3H3AA 3RH4A 3V7JA 5J2FA 4TUQA 3UXOA 4KLFA 3RJIA 4UD5A 4KLLA 3PMNA 7ICGA 5D49A 4I29A 3JPRA 4MF8A 1WOTA 2Q66A 4F5QA 4KLGA 2DRAA 3HX0A 1VJ7A 4NLKA 4DOBA 4YMNA 3HJ4A 9ICCA 1V4AA 1ZQKA 1R8CA 3TFRA 3OUYA 5IIIA 7ICIA 4FHYA 5J2EA 2O1PA 4K4GA 4E80A 5CA7A 5IIOA 3WFQE 5HRBA 4DOAA 5DB8A 1NO5A 3K75D 5D46A 4RPZA 1HUZA 4WC1A 1Q78A 4X0BA 4FHWA 2M2TA 3B0XA 7ICFA 3AQNA 2DR8A 3ISCA 4TURA 5J2IA 4RQ4A 5CJ7A 3HW8A 1KDHA 4ATBB 5F2VO 4IG8A 4MFFA 4RQ3A 4KLHA 1TVAA 5HRIA 9ICBA 1ZQBA 1BPDA 5J2KA 4Z6DA 9ICXA 4WC7A 1ZQCA 4M9LA 3OVBA 3AQMA 1KEJA 4X4RA 4UB4A 9ICMA 1TFYA 2FMSA 3LK9A 4NXZA 9ICKA 3JPSA 5D4BA 5J0RA 4X4QA 7ICMA 4I2FA 5BOLA 7ICHA 4PHDA 7ICRA 5CP2A 4RQ5A 7ICQA 4PHEA 4GXJA 4XRHA 4O5EA 5J0OA 4GXIA 3WFPA 2DR5A 4K4HA 1UEUA 3C18A 1NOMA 2ZH3A 4RPXA 9ICGA 5J2BA 2ZH7A 3ISDA 1JQRA 4R65A 4WC0A 2VANA 1ZQUA 9ICJA 9ICHA 4NLZA 3V7LA 4PGQA 4UBBA 5CWRA 9ICTA 2ISPA 1UEVA 8ICHA 5J0TA 1R8BA 4EBJA 2ZHBA 7ICLA 4PHAA 5J0SA 4LVSA 4UAYA 8ICTA 3HIYA 4KLQA 5HC9A 4NM1A 4WCWA 5IINA 5DDYA 5HRFA 4PGYA 4KLMA 1ZQTA 8ICSA 3MDAA 4PPXA 4EBKA 4QZ8A 3L9DA 3HJ1A 3LQCB 2HHPA 1ZQXA 4FHXA 1FA0A 5J0YA 5IIMA 2PFOA 4UB5A 5J2CA 5CB1A 5DDMA 5HR9A 2BCQA 4O9MA 7ICNA 9ICRA 5HRKA 8ICMA 4AT8A 2ID1A 1R89A 4O5KA 3UPSA 5CR0A 4DO9A 3RJJA 4NKUA 3OUYB 4M2YA 4I2AA 3C2KA 4R66A 2BCRA 2PFPA 9ICAA 4XA5A 5HHHA 1HUOA 8ICBA 4WBZA 4WC6A 4Z6CA 4QZFA 8ICUA 9ICIA 4X4UA 4IQUA 2NRKA 1ZQMA 8ICNA 8ICQA 3C5GA 4X4NA 5J0XA 3OVAA 1BPEA 1ZQHA 4QZBA 5DB7A 1XSNA 1RPLA 5J2HA 8ICVA 2PBEA 4RWNA 5J0PA 3RJHA 3WFRE 4I2DA 4I2EA 4P4OA 3RJGA 4TUSA 2DR9A 2ZH6A 4NM2A 4O5CA 9ICEA 4UAZA 4MF2A 1MIVA 9ICWA 4P4MA 2BCUA 1ZQLA 4JWMA 4KLOA 4WC4A 5IIJA 3C2LA 2PFQA 1JN3A 4S3NA 4RQ8A 1XSLA
chains in the Genus database with same CATH superfamily
7ICEA 4LZGA 4UB3A 5HRHA 5BPCA 4KLJA 4F5RA 4WH5A 4YD1A 4RQ2A 3JPNA 4MFAA 3MGHA 4QZCA 1TV9A 4IQWA 3JPQA 5CHGA 4AT9A 3V72A 3WFSC 4P4PA 4HX0A 3AQKA 9ICVA 3RJKA 1JAJA 2PXIA 4X4SA 1KNYA 3H37A 5J2JA 5HRDA 8ICZA 3TFSA 3MBYA 4PHPA 3OVSA 2DRBA 3PNCA 8ICEA 4RPYA 4X4VA 2FMQA 2BE3A 4UD4A 2M2VA 4O69A 2FMPA 5DBCA 4RQ6A 3MDCA 4O67A 5IILA 4RQ0A 4GXKA 1BPBA 8ICOA 4OAGA 4I28A 2ZH8A 3ERCC 1ZQEA 4OAIZ 4EP7A 2M2WA 4I2CA 2RFFA 4FH5A 8ICCA 1OU5A 1YLQA 3UQ0A 1ZQSA 4KLTA 9ICPA 4RWPA 1ZQYA 4YD2A 2P66A 3H38A 4YMMA 3AU2A 4QZ9A 3C2MA 5J2GA 8ICXA 4WOYA 4M9NA 1GPJA 5BOMA 5EOZA 4X4OA 5J2AA 2ZH1A 4R64A 4WC3A 3C5FA 8ICYA 4I2GA 3V7KA 1Q79A 4UB1A 4I2BA 4XQ7A 4QZAA 5IIKA 3UXPA 2BCSA 2I9GA 4UBCA 7ICOA 7ICTA 4RT2A 3RH6A 1UETA 8ICFA 1MQ3A 4AT8B 4RT3A 8ICLA 2O5AA 2BPGA 5B3QA 4NLNA 4QZGA 4X4PA 8ICKA 8ICWA 2B51A 4M0AA 8ICGA 3JPPA 7ICUA 1R8AA 8ICPA 1ZQIA 5J29A 4QZDA 1ZQOA 4I2HA 2IHMA 3NKUA 3WFOA 4RWOA 1MQ2A 1ZJNA 4KLIA 4WQLA 5J0UA 4R63A 1F5AA 4WC5A 4KLEA 4M04A 1ZQQA 1RZTA 3GDXA 1BPXA 5JTGA 4IQVA 2B56A 4YN4A 3AUOA 2ISOA 4I2JA 3NYBA 3RH5A 9ICSA 4M5DA 4KLUA 1ZQFA 1ZQGA 1ZQAA 9ICQA 4X0AA 2ZH9A 1ZQDA 4E7XA 4KB6A 1TFWA 4M9GA 4LEYA 2GWSA 1ZQJA 1VFGA 4X4TA 3ER8C 4UB2A 4QZHA 4IQTA 3JZ0A 7ICSA 4KM5A 7ICKA 4I2IA 4YMOA 4NY8A 4TUPA 4PGXA 1ZQZA 4K8VA 4F5NA 3B0YA 4X5VA 3HWTA 3AU6A 5DEDA 2M2UA 4XUSA 5DB9A 5DBBA 3NVOA 1ZQVA 4EEBA 5DECA 4ATBA 3OGUA 5CHEA 5J0QA 4KLSA 8ICRA 9ICUA 3EF2A 1ZQPA 1MIYA 8ICIA 3PMLA 5HRLA 2HN1A 4RQ7A 9ICLA 3RJFA 4E8FA 3AQLA 5DBAA 1ZJMA 8ICJA 3UXNA 2EWRA 4AT9B 2BPCA 4FHPA 4N7RA 2W9MA 3JPOA 2DR7A 2ZH4A 4Z6FA 4NXXA 4RWQA 4FH3A 4WBYA 4UAWA 4LT6A 4M9JA 4OAFA 1JMSA 4NXUA 2ZHAA 4LZDA 1ZQRA 3ER9B 4QZEA 4OAHA 1BPYA 4I27A 5D62A 2BCVA 4DOCA 4KLDA 4YCXA 5J0WA 3UPQA 1BPZA 2PFNA 7ICJA 7ICVA 1PX5A 4AT7A 4AT7B 2ZH2A 7ICPA 5CFTA 4XQ8A 1MIWA 3JPTA 5HREA 3UQ2A 3JYYA 9ICOA 4FHVA 3MGIA 1XSPA 5HRGA 3RJEA 5D61A 3H39A 4Z6EA 4JWNA 5DKWA 4NKTA 3ISBA 4PH5A 4NXWA 4MFCA 4FO1A 2DVIA 4M9HA 4WC2A 3CK6A 4M47A 5DB6A 4WQKA 4RQ1A 4F5OA 4MKPA 2BPFA 4P2HA 3OV7A 1ZQNA 4O68A 1ZQWA 5TZVA 5J2DA 3C66A 9ICFA 2GAFD 4F5PA 8ICAA 9ICNA 4FO6A 3JCFA 5HHIA 2ZH5A 4K4IA 4K9AA 4QZIA 3H3AA 3RH4A 4NXVA 3V7JA 5J2FA 4TUQA 3PHZA 3UXOA 4JLXA 4KLFA 3RJIA 4UD5A 4KLLA 3PMNA 7ICGA 5D49A 4I29A 3JPRA 4MF8A 4EV6A 1WOTA 2Q66A 4F5QA 4KLGA 4K98A 3HX0A 2DRAA 1VJ7A 4NLKA 4DOBA 4YMNA 2FCLA 3HJ4A 5D63A 9ICCA 1V4AA 1ZQKA 1R8CA 3TFRA 3OUYA 4K9BA 5IIIA 7ICIA 4FHYA 5J2EA 2O1PA 4K4GA 4E80A 5CA7A 5IIOA 2B4VA 5HRBA 4DOAA 3WFQE 5DB8A 1NO5A 4LEZA 3K75D 5D46A 4RPZA 1HUZA 4WC1A 1Q78A 4X0BA 4FHWA 2M2TA 5CFUA 3B0XA 7ICFA 3AQNA 2DR8A 2IHOA 3ISCA 4TURA 3NWIA 5J2IA 4RQ4A 5CJ7A 3HW8A 4LEVA 1KDHA 2BBHA 4ATBB 5F2VO 4IG8A 4MFFA 4RQ3A 4K99A 4KLHA 1TVAA 5B3PA 5HRIA 9ICBA 1ZQBA 1BPDA 5J2KA 4Z6DA 9ICXA 4WC7A 1ZQCA 4M9LA 3OVBA 3AQMA 1KEJA 4X4RA 4UB4A 9ICMA 1TFYA 2FMSA 3K7DA 3LK9A 4NXZA 9ICKA 3JPSA 2IUBA 4JLZA 5D4BA 5J0RA 4X4QA 7ICMA 4I2FA 5BOLA 7ICHA 2HN2A 4PHDA 7ICRA 5CP2A 4RQ5A 7ICQA 4PHEA 4GXJA 4XRHA 4O5EA 5J0OA 4GXIA 3WFPA 2DR5A 4K4HA 1UEUA 3C18A 1NOMA 4XJEA 2ZH3A 4RPXA 9ICGA 5J2BA 2ZH7A 3ISDA 1JQRA 4R65A 4WC0A 2VANA 1ZQUA 9ICJA 9ICHA 4NLZA 3V7LA 4PGQA 4UBBA 5CWRA 9ICTA 2ISPA 1UEVA 8ICHA 4O6AA 5J0TA 1R8BA 3OWGA 4EBJA 2ZHBA 7ICLA 4PHAA 5J0SA 4LVSA 4UAYA 8ICTA 3HIYA 4KLQA 5HC9A 4NM1A 4WCWA 4LEWA 5IINA 5DDYA 5HRFA 4PGYA 4KLMA 1ZQTA 8ICSA 3MDAA 4PPXA 4EBKA 4QZ8A 3L9DA 3HJ1A 3LQCB 2HHPA 1ZQXA 4FHXA 1FA0A 5J0YA 5IIMA 2PFOA 4UB5A 5J2CA 5CB1A 5DDMA 2BBJA 5HR9A 2BCQA 4O9MA 7ICNA 9ICRA 5HRKA 8ICMA 4AT8A 2ID1A 1R89A 4O5KA 3UPSA 5CR0A 4DO9A 3RJJA 4NKUA 3OUYB 4M2YA 4I2AA 3C2KA 4R66A 2BCRA 2PFPA 5CFSA 9ICAA 4XA5A 5HHHA 1HUOA 8ICBA 4NXTA 4WBZA 4WC6A 4K97A 4Z6CA 4QZFA 8ICUA 9ICIA 4X4UA 4IQUA 2NRKA 1ZQMA 8ICNA 8ICQA 3MCRA 3C5GA 4X4NA 5J0XA 3OVAA 1BPEA 1ZQHA 4QZBA 5DB7A 1XSNA 1RPLA 5J2HA 8ICVA 2PBEA 4RWNA 4I0UA 5J0PA 3RJHA 4K96A 4I2DA 3WFRE 4I2EA 4EGWA 2GA9D 4P4OA 3RJGA 4EEDA 4TUSA 2DR9A 2ZH6A 4NM2A 4O5CA 9ICEA 4UAZA 4MF2A 1MIVA 9ICWA 4P4MA 2BCUA 1ZQLA 4JWMA 4KLOA 4WC4A 5IIJA 3C2LA 2PFQA 1JN3A 4S3NA 4RQ8A 1XSLA
chains in the Genus database with same CATH topology
7ICEA 4LZGA 4UB3A 5HRHA 5BPCA 4KLJA 4F5RA 4YD1A 4RQ2A 3JPNA 4MFAA 3MGHA 4QZCA 1TV9A 4IQWA 3JPQA 5CHGA 4AT9A 3V72A 3WFSC 4P4PA 3AQKA 9ICVA 3RJKA 1JAJA 2PXIA 4X4SA 1KNYA 3H37A 5J2JA 5HRDA 8ICZA 3TFSA 3MBYA 4PHPA 3OVSA 2DRBA 3PNCA 8ICEA 4RPYA 4X4VA 2FMQA 2BE3A 4UD4A 2M2VA 2FMPA 5DBCA 4RQ6A 3MDCA 5IILA 4RQ0A 4GXKA 1BPBA 8ICOA 4I28A 2ZH8A 1ZQEA 4EP7A 2M2WA 4I2CA 2RFFA 4FH5A 8ICCA 1OU5A 1YLQA 3UQ0A 1ZQSA 4KLTA 9ICPA 4RWPA 1ZQYA 4YD2A 2P66A 3H38A 4YMMA 3AU2A 4QZ9A 3C2MA 5J2GA 8ICXA 4M9NA 5BOMA 5EOZA 4X4OA 5J2AA 2ZH1A 4R64A 4WC3A 3C5FA 8ICYA 4I2GA 3V7KA 1Q79A 4UB1A 4I2BA 4XQ7A 4QZAA 5IIKA 3UXPA 2BCSA 2I9GA 4UBCA 7ICOA 7ICTA 4RT2A 3RH6A 1UETA 8ICFA 1MQ3A 4AT8B 4RT3A 8ICLA 2O5AA 2BPGA 4X4PA 4NLNA 4QZGA 8ICKA 8ICWA 4M0AA 8ICGA 3JPPA 7ICUA 1R8AA 8ICPA 1ZQIA 5J29A 4QZDA 1ZQOA 4I2HA 2IHMA 4RWOA 3WFOA 1MQ2A 1ZJNA 4KLIA 5J0UA 4R63A 1F5AA 4WC5A 4KLEA 4M04A 1ZQQA 1RZTA 3GDXA 1BPXA 4IQVA 4YN4A 3AUOA 2ISOA 4I2JA 3NYBA 3RH5A 9ICSA 4M5DA 4KLUA 1ZQFA 1ZQGA 1ZQAA 9ICQA 4X0AA 2ZH9A 1ZQDA 4E7XA 1TFWA 4M9GA 2GWSA 1ZQJA 1VFGA 4X4TA 4UB2A 4QZHA 4IQTA 3JZ0A 7ICSA 7ICKA 4I2IA 4YMOA 4NY8A 4TUPA 4PGXA 1ZQZA 4F5NA 3B0YA 4X5VA 3HWTA 3AU6A 5DEDA 2M2UA 4XUSA 5DB9A 5DBBA 1ZQVA 5DECA 4ATBA 3OGUA 5J0QA 4KLSA 8ICRA 9ICUA 1ZQPA 1MIYA 8ICIA 3PMLA 5HRLA 4RQ7A 9ICLA 3RJFA 4E8FA 3AQLA 5DBAA 1ZJMA 8ICJA 3UXNA 4AT9B 2BPCA 4FHPA 2DR7A 2W9MA 3JPOA 2ZH4A 4Z6FA 4RWQA 4FH3A 4WBYA 4UAWA 4LT6A 4M9JA 1JMSA 2ZHAA 4LZDA 1ZQRA 4QZEA 1BPYA 4I27A 2BCVA 4DOCA 4KLDA 4YCXA 5J0WA 3UPQA 1BPZA 2PFNA 7ICJA 7ICVA 1PX5A 4AT7A 4AT7B 2ZH2A 7ICPA 4XQ8A 1MIWA 3JPTA 5HREA 3UQ2A 3JYYA 9ICOA 4FHVA 3MGIA 1XSPA 5HRGA 3RJEA 3H39A 4Z6EA 4JWNA 5DKWA 4NKTA 3ISBA 4PH5A 4MFCA 2DVIA 4M9HA 4WC2A 4M47A 5DB6A 4RQ1A 4F5OA 2BPFA 4P2HA 3OV7A 1ZQNA 1ZQWA 5TZVA 5J2DA 3C66A 9ICFA 4F5PA 8ICAA 9ICNA 4FO6A 5HHIA 2ZH5A 4K4IA 4QZIA 3H3AA 3RH4A 3V7JA 5J2FA 4TUQA 3UXOA 4KLFA 3RJIA 4UD5A 4KLLA 3PMNA 7ICGA 5D49A 4I29A 3JPRA 4MF8A 1WOTA 2Q66A 4F5QA 4KLGA 2DRAA 3HX0A 1VJ7A 4NLKA 4DOBA 4YMNA 3HJ4A 9ICCA 1V4AA 1ZQKA 1R8CA 3TFRA 3OUYA 5IIIA 7ICIA 4FHYA 5J2EA 2O1PA 4K4GA 4E80A 5CA7A 5IIOA 3WFQE 5HRBA 4DOAA 5DB8A 1NO5A 3K75D 5D46A 4RPZA 1HUZA 4WC1A 1Q78A 4X0BA 4FHWA 2M2TA 3B0XA 7ICFA 3AQNA 2DR8A 3ISCA 4TURA 5J2IA 4RQ4A 5CJ7A 3HW8A 1KDHA 4ATBB 5F2VO 4IG8A 4MFFA 4RQ3A 4KLHA 1TVAA 5HRIA 9ICBA 1ZQBA 1BPDA 5J2KA 4Z6DA 9ICXA 4WC7A 1ZQCA 4M9LA 3OVBA 3AQMA 1KEJA 4X4RA 4UB4A 9ICMA 1TFYA 2FMSA 3LK9A 4NXZA 9ICKA 3JPSA 5D4BA 5J0RA 4X4QA 7ICMA 4I2FA 5BOLA 7ICHA 4PHDA 7ICRA 5CP2A 4RQ5A 7ICQA 4PHEA 4GXJA 4XRHA 4O5EA 5J0OA 4GXIA 3WFPA 2DR5A 4K4HA 1UEUA 3C18A 1NOMA 2ZH3A 4RPXA 9ICGA 5J2BA 2ZH7A 3ISDA 1JQRA 4R65A 4WC0A 2VANA 1ZQUA 9ICJA 9ICHA 4NLZA 3V7LA 4PGQA 4UBBA 5CWRA 9ICTA 2ISPA 1UEVA 8ICHA 5J0TA 1R8BA 4EBJA 2ZHBA 7ICLA 4PHAA 5J0SA 4LVSA 4UAYA 8ICTA 3HIYA 4KLQA 5HC9A 4NM1A 4WCWA 5IINA 5DDYA 5HRFA 4PGYA 4KLMA 1ZQTA 8ICSA 3MDAA 4PPXA 4EBKA 4QZ8A 3L9DA 3HJ1A 3LQCB 2HHPA 1ZQXA 4FHXA 1FA0A 5J0YA 5IIMA 2PFOA 4UB5A 5J2CA 5CB1A 5DDMA 5HR9A 2BCQA 4O9MA 7ICNA 9ICRA 5HRKA 8ICMA 4AT8A 2ID1A 1R89A 4O5KA 3UPSA 5CR0A 4DO9A 3RJJA 4NKUA 3OUYB 4M2YA 4I2AA 3C2KA 4R66A 2BCRA 2PFPA 9ICAA 4XA5A 5HHHA 1HUOA 8ICBA 4WBZA 4WC6A 4Z6CA 4QZFA 8ICUA 9ICIA 4X4UA 4IQUA 2NRKA 1ZQMA 8ICNA 8ICQA 3C5GA 4X4NA 5J0XA 3OVAA 1BPEA 1ZQHA 4QZBA 5DB7A 1XSNA 1RPLA 5J2HA 8ICVA 2PBEA 4RWNA 5J0PA 3RJHA 3WFRE 4I2DA 4I2EA 4P4OA 3RJGA 4TUSA 2DR9A 2ZH6A 4NM2A 4O5CA 9ICEA 4UAZA 4MF2A 1MIVA 9ICWA 4P4MA 2BCUA 1ZQLA 4JWMA 4KLOA 4WC4A 5IIJA 3C2LA 2PFQA 1JN3A 4S3NA 4RQ8A 1XSLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 7ICE A;  4LZG A;  4UB3 A;  5HRH A;  5BPC A;  4KLJ A;  4F5R A;  4YD1 A;  4RQ2 A;  3JPN A;  4MFA A;  3MGH A;  4QZC A;  1TV9 A;  4IQW A;  3JPQ A;  5CHG A;  4AT9 A;  3V72 A;  3WFS C;  4P4P A;  3AQK A;  9ICV A;  3RJK A;  1JAJ A;  2PXI A;  4X4S A;  1KNY A;  3H37 A;  5J2J A;  5HRD A;  8ICZ A;  3TFS A;  3MBY A;  4PHP A;  3OVS A;  2DRB A;  3PNC A;  8ICE A;  4RPY A;  4X4V A;  2FMQ A;  2BE3 A;  4UD4 A;  2M2V A;  2FMP A;  5DBC A;  4RQ6 A;  3MDC A;  5IIL A;  4RQ0 A;  4GXK A;  1BPB A;  8ICO A;  4I28 A;  2ZH8 A;  1ZQE A;  4EP7 A;  2M2W A;  4I2C A;  2RFF A;  4FH5 A;  8ICC A;  1OU5 A;  1YLQ A;  3UQ0 A;  1ZQS A;  4KLT A;  9ICP A;  4RWP A;  1ZQY A;  4YD2 A;  2P66 A;  3H38 A;  4YMM A;  3AU2 A;  4QZ9 A;  3C2M A;  5J2G A;  8ICX A;  4M9N A;  5BOM A;  5EOZ A;  4X4O A;  5J2A A;  2ZH1 A;  4R64 A;  4WC3 A;  3C5F A;  8ICY A;  4I2G A;  3V7K A;  1Q79 A;  4UB1 A;  4I2B A;  4XQ7 A;  4QZA A;  5IIK A;  3UXP A;  2BCS A;  2I9G A;  4UBC A;  7ICO A;  7ICT A;  4RT2 A;  3RH6 A;  1UET A;  8ICF A;  1MQ3 A;  4AT8 B;  4RT3 A;  8ICL A;  2O5A A;  2BPG A;  4X4P A;  4NLN A;  4QZG A;  8ICK A;  8ICW A;  4M0A A;  8ICG A;  3JPP A;  7ICU A;  1R8A A;  8ICP A;  1ZQI A;  5J29 A;  4QZD A;  1ZQO A;  4I2H A;  2IHM A;  4RWO A;  3WFO A;  1MQ2 A;  1ZJN A;  4KLI A;  5J0U A;  4R63 A;  1F5A A;  4WC5 A;  4KLE A;  4M04 A;  1ZQQ A;  1RZT A;  3GDX A;  1BPX A;  4IQV A;  4YN4 A;  3AUO A;  2ISO A;  4I2J A;  3NYB A;  3RH5 A;  9ICS A;  4M5D A;  4KLU A;  1ZQF A;  1ZQG A;  1ZQA A;  9ICQ A;  4X0A A;  2ZH9 A;  1ZQD A;  4E7X A;  1TFW A;  4M9G A;  2GWS A;  1ZQJ A;  1VFG A;  4X4T A;  4UB2 A;  4QZH A;  4IQT A;  3JZ0 A;  7ICS A;  7ICK A;  4I2I A;  4YMO A;  4NY8 A;  4TUP A;  4PGX A;  1ZQZ A;  4F5N A;  3B0Y A;  4X5V A;  3HWT A;  3AU6 A;  5DED A;  2M2U A;  4XUS A;  5DB9 A;  5DBB A;  1ZQV A;  5DEC A;  4ATB A;  3OGU A;  5J0Q A;  4KLS A;  8ICR A;  9ICU A;  1ZQP A;  1MIY A;  8ICI A;  3PML A;  5HRL A;  4RQ7 A;  9ICL A;  3RJF A;  4E8F A;  3AQL A;  5DBA A;  1ZJM A;  8ICJ A;  3UXN A;  4AT9 B;  2BPC A;  4FHP A;  2DR7 A;  2W9M A;  3JPO A;  2ZH4 A;  4Z6F A;  4RWQ A;  4FH3 A;  4WBY A;  4UAW A;  4LT6 A;  4M9J A;  1JMS A;  2ZHA A;  4LZD A;  1ZQR A;  4QZE A;  1BPY A;  4I27 A;  2BCV A;  4DOC A;  4KLD A;  4YCX A;  5J0W A;  3UPQ A;  1BPZ A;  2PFN A;  7ICJ A;  7ICV A;  1PX5 A;  4AT7 A;  4AT7 B;  2ZH2 A;  7ICP A;  4XQ8 A;  1MIW A;  3JPT A;  5HRE A;  3UQ2 A;  3JYY A;  9ICO A;  4FHV A;  3MGI A;  1XSP A;  5HRG A;  3RJE A;  3H39 A;  4Z6E A;  4JWN A;  5DKW A;  4NKT A;  3ISB A;  4PH5 A;  4MFC A;  2DVI A;  4M9H A;  4WC2 A;  4M47 A;  5DB6 A;  4RQ1 A;  4F5O A;  2BPF A;  4P2H A;  3OV7 A;  1ZQN A;  1ZQW A;  5TZV A;  5J2D A;  3C66 A;  9ICF A;  4F5P A;  8ICA A;  9ICN A;  4FO6 A;  5HHI A;  2ZH5 A;  4K4I A;  4QZI A;  3H3A A;  3RH4 A;  3V7J A;  5J2F A;  4TUQ A;  3UXO A;  4KLF A;  3RJI A;  4UD5 A;  4KLL A;  3PMN A;  7ICG A;  5D49 A;  4I29 A;  3JPR A;  4MF8 A;  1WOT A;  2Q66 A;  4F5Q A;  4KLG A;  2DRA A;  3HX0 A;  1VJ7 A;  4NLK A;  4DOB A;  4YMN A;  3HJ4 A;  9ICC A;  1V4A A;  1ZQK A;  1R8C A;  3TFR A;  3OUY A;  5III A;  7ICI A;  4FHY A;  5J2E A;  2O1P A;  4K4G A;  4E80 A;  5CA7 A;  5IIO A;  3WFQ E;  5HRB A;  4DOA A;  5DB8 A;  1NO5 A;  3K75 D;  5D46 A;  4RPZ A;  1HUZ A;  4WC1 A;  1Q78 A;  4X0B A;  4FHW A;  2M2T A;  3B0X A;  7ICF A;  3AQN A;  2DR8 A;  3ISC A;  4TUR A;  5J2I A;  4RQ4 A;  5CJ7 A;  3HW8 A;  1KDH A;  4ATB B;  5F2V O;  4IG8 A;  4MFF A;  4RQ3 A;  4KLH A;  1TVA A;  5HRI A;  9ICB A;  1ZQB A;  1BPD A;  5J2K A;  4Z6D A;  9ICX A;  4WC7 A;  1ZQC A;  4M9L A;  3OVB A;  3AQM A;  1KEJ A;  4X4R A;  4UB4 A;  9ICM A;  1TFY A;  2FMS A;  3LK9 A;  4NXZ A;  9ICK A;  3JPS A;  5D4B A;  5J0R A;  4X4Q A;  7ICM A;  4I2F A;  5BOL A;  7ICH A;  4PHD A;  7ICR A;  5CP2 A;  4RQ5 A;  7ICQ A;  4PHE A;  4GXJ A;  4XRH A;  4O5E A;  5J0O A;  4GXI A;  3WFP A;  2DR5 A;  4K4H A;  1UEU A;  3C18 A;  1NOM A;  2ZH3 A;  4RPX A;  9ICG A;  5J2B A;  2ZH7 A;  3ISD A;  1JQR A;  4R65 A;  4WC0 A;  2VAN A;  1ZQU A;  9ICJ A;  9ICH A;  4NLZ A;  3V7L A;  4PGQ A;  4UBB A;  5CWR A;  9ICT A;  2ISP A;  1UEV A;  8ICH A;  5J0T A;  1R8B A;  4EBJ A;  2ZHB A;  7ICL A;  4PHA A;  5J0S A;  4LVS A;  4UAY A;  8ICT A;  3HIY A;  4KLQ A;  5HC9 A;  4NM1 A;  4WCW A;  5IIN A;  5DDY A;  5HRF A;  4PGY A;  4KLM A;  1ZQT A;  8ICS A;  3MDA A;  4PPX A;  4EBK A;  4QZ8 A;  3L9D A;  3HJ1 A;  3LQC B;  2HHP A;  1ZQX A;  4FHX A;  1FA0 A;  5J0Y A;  5IIM A;  2PFO A;  4UB5 A;  5J2C A;  5CB1 A;  5DDM A;  5HR9 A;  2BCQ A;  4O9M A;  7ICN A;  9ICR A;  5HRK A;  8ICM A;  4AT8 A;  2ID1 A;  1R89 A;  4O5K A;  3UPS A;  5CR0 A;  4DO9 A;  3RJJ A;  4NKU A;  3OUY B;  4M2Y A;  4I2A A;  3C2K A;  4R66 A;  2BCR A;  2PFP A;  9ICA A;  4XA5 A;  5HHH A;  1HUO A;  8ICB A;  4WBZ A;  4WC6 A;  4Z6C A;  4QZF A;  8ICU A;  9ICI A;  4X4U A;  4IQU A;  2NRK A;  1ZQM A;  8ICN A;  8ICQ A;  3C5G A;  4X4N A;  5J0X A;  3OVA A;  1BPE A;  1ZQH A;  4QZB A;  5DB7 A;  1XSN A;  1RPL A;  5J2H A;  8ICV A;  2PBE A;  4RWN A;  5J0P A;  3RJH A;  3WFR E;  4I2D A;  4I2E A;  4P4O A;  3RJG A;  4TUS A;  2DR9 A;  2ZH6 A;  4NM2 A;  4O5C A;  9ICE A;  4UAZ A;  4MF2 A;  1MIV A;  9ICW A;  4P4M A;  2BCU A;  1ZQL A;  4JWM A;  4KLO A;  4WC4 A;  5IIJ A;  3C2L A;  2PFQ A;  1JN3 A;  4S3N A;  4RQ8 A;  1XSL A; 
#chains in the Genus database with same CATH topology
 7ICE A;  4LZG A;  4UB3 A;  5HRH A;  5BPC A;  4KLJ A;  4F5R A;  4WH5 A;  4YD1 A;  4RQ2 A;  3JPN A;  4MFA A;  3MGH A;  4QZC A;  1TV9 A;  4IQW A;  3JPQ A;  5CHG A;  4AT9 A;  3V72 A;  3WFS C;  4P4P A;  4HX0 A;  3AQK A;  9ICV A;  3RJK A;  1JAJ A;  2PXI A;  4X4S A;  1KNY A;  3H37 A;  5J2J A;  5HRD A;  8ICZ A;  3TFS A;  3MBY A;  4PHP A;  3OVS A;  2DRB A;  3PNC A;  8ICE A;  4RPY A;  4X4V A;  2FMQ A;  2BE3 A;  4UD4 A;  2M2V A;  4O69 A;  2FMP A;  5DBC A;  4RQ6 A;  3MDC A;  4O67 A;  5IIL A;  4RQ0 A;  4GXK A;  1BPB A;  8ICO A;  4OAG A;  4I28 A;  2ZH8 A;  3ERC C;  1ZQE A;  4OAI Z;  4EP7 A;  2M2W A;  4I2C A;  2RFF A;  4FH5 A;  8ICC A;  1OU5 A;  1YLQ A;  3UQ0 A;  1ZQS A;  4KLT A;  9ICP A;  4RWP A;  1ZQY A;  4YD2 A;  2P66 A;  3H38 A;  4YMM A;  3AU2 A;  4QZ9 A;  3C2M A;  5J2G A;  8ICX A;  4WOY A;  4M9N A;  1GPJ A;  5BOM A;  5EOZ A;  4X4O A;  5J2A A;  2ZH1 A;  4R64 A;  4WC3 A;  3C5F A;  8ICY A;  4I2G A;  3V7K A;  1Q79 A;  4UB1 A;  4I2B A;  4XQ7 A;  4QZA A;  5IIK A;  3UXP A;  2BCS A;  2I9G A;  4UBC A;  7ICO A;  7ICT A;  4RT2 A;  3RH6 A;  1UET A;  8ICF A;  1MQ3 A;  4AT8 B;  4RT3 A;  8ICL A;  2O5A A;  2BPG A;  5B3Q A;  4NLN A;  4QZG A;  4X4P A;  8ICK A;  8ICW A;  2B51 A;  4M0A A;  8ICG A;  3JPP A;  7ICU A;  1R8A A;  8ICP A;  1ZQI A;  5J29 A;  4QZD A;  1ZQO A;  4I2H A;  2IHM A;  3NKU A;  3WFO A;  4RWO A;  1MQ2 A;  1ZJN A;  4KLI A;  4WQL A;  5J0U A;  4R63 A;  1F5A A;  4WC5 A;  4KLE A;  4M04 A;  1ZQQ A;  1RZT A;  3GDX A;  1BPX A;  5JTG A;  4IQV A;  2B56 A;  4YN4 A;  3AUO A;  2ISO A;  4I2J A;  3NYB A;  3RH5 A;  9ICS A;  4M5D A;  4KLU A;  1ZQF A;  1ZQG A;  1ZQA A;  9ICQ A;  4X0A A;  2ZH9 A;  1ZQD A;  4E7X A;  4KB6 A;  1TFW A;  4M9G A;  4LEY A;  2GWS A;  1ZQJ A;  1VFG A;  4X4T A;  3ER8 C;  4UB2 A;  4QZH A;  4IQT A;  3JZ0 A;  7ICS A;  4KM5 A;  7ICK A;  4I2I A;  4YMO A;  4NY8 A;  4TUP A;  4PGX A;  1ZQZ A;  4K8V A;  4F5N A;  3B0Y A;  4X5V A;  3HWT A;  3AU6 A;  5DED A;  2M2U A;  4XUS A;  5DB9 A;  5DBB A;  3NVO A;  1ZQV A;  4EEB A;  5DEC A;  4ATB A;  3OGU A;  5CHE A;  5J0Q A;  4KLS A;  8ICR A;  9ICU A;  3EF2 A;  1ZQP A;  1MIY A;  8ICI A;  3PML A;  5HRL A;  2HN1 A;  4RQ7 A;  9ICL A;  3RJF A;  4E8F A;  3AQL A;  5DBA A;  1ZJM A;  8ICJ A;  3UXN A;  2EWR A;  4AT9 B;  2BPC A;  4FHP A;  4N7R A;  2W9M A;  3JPO A;  2DR7 A;  2ZH4 A;  4Z6F A;  4NXX A;  4RWQ A;  4FH3 A;  4WBY A;  4UAW A;  4LT6 A;  4M9J A;  4OAF A;  1JMS A;  4NXU A;  2ZHA A;  4LZD A;  1ZQR A;  3ER9 B;  4QZE A;  4OAH A;  1BPY A;  4I27 A;  5D62 A;  2BCV A;  4DOC A;  4KLD A;  4YCX A;  5J0W A;  3UPQ A;  1BPZ A;  2PFN A;  7ICJ A;  7ICV A;  1PX5 A;  4AT7 A;  4AT7 B;  2ZH2 A;  7ICP A;  5CFT A;  4XQ8 A;  1MIW A;  3JPT A;  5HRE A;  3UQ2 A;  3JYY A;  9ICO A;  4FHV A;  3MGI A;  1XSP A;  5HRG A;  3RJE A;  5D61 A;  3H39 A;  4Z6E A;  4JWN A;  5DKW A;  4NKT A;  3ISB A;  4PH5 A;  4NXW A;  4MFC A;  4FO1 A;  2DVI A;  4M9H A;  4WC2 A;  3CK6 A;  4M47 A;  5DB6 A;  4WQK A;  4RQ1 A;  4F5O A;  4MKP A;  2BPF A;  4P2H A;  3OV7 A;  1ZQN A;  4O68 A;  1ZQW A;  5TZV A;  5J2D A;  3C66 A;  9ICF A;  2GAF D;  4F5P A;  8ICA A;  9ICN A;  4FO6 A;  3JCF A;  5HHI A;  2ZH5 A;  4K4I A;  4K9A A;  4QZI A;  3H3A A;  3RH4 A;  4NXV A;  3V7J A;  5J2F A;  4TUQ A;  3PHZ A;  3UXO A;  4JLX A;  4KLF A;  3RJI A;  4UD5 A;  4KLL A;  3PMN A;  7ICG A;  5D49 A;  4I29 A;  3JPR A;  4MF8 A;  4EV6 A;  1WOT A;  2Q66 A;  4F5Q A;  4KLG A;  4K98 A;  3HX0 A;  2DRA A;  1VJ7 A;  4NLK A;  4DOB A;  4YMN A;  2FCL A;  3HJ4 A;  5D63 A;  9ICC A;  1V4A A;  1ZQK A;  1R8C A;  3TFR A;  3OUY A;  4K9B A;  5III A;  7ICI A;  4FHY A;  5J2E A;  2O1P A;  4K4G A;  4E80 A;  5CA7 A;  5IIO A;  2B4V A;  5HRB A;  4DOA A;  3WFQ E;  5DB8 A;  1NO5 A;  4LEZ A;  3K75 D;  5D46 A;  4RPZ A;  1HUZ A;  4WC1 A;  1Q78 A;  4X0B A;  4FHW A;  2M2T A;  5CFU A;  3B0X A;  7ICF A;  3AQN A;  2DR8 A;  2IHO A;  3ISC A;  4TUR A;  3NWI A;  5J2I A;  4RQ4 A;  5CJ7 A;  3HW8 A;  4LEV A;  1KDH A;  2BBH A;  4ATB B;  5F2V O;  4IG8 A;  4MFF A;  4RQ3 A;  4K99 A;  4KLH A;  1TVA A;  5B3P A;  5HRI A;  9ICB A;  1ZQB A;  1BPD A;  5J2K A;  4Z6D A;  9ICX A;  4WC7 A;  1ZQC A;  4M9L A;  3OVB A;  3AQM A;  1KEJ A;  4X4R A;  4UB4 A;  9ICM A;  1TFY A;  2FMS A;  3K7D A;  3LK9 A;  4NXZ A;  9ICK A;  3JPS A;  2IUB A;  4JLZ A;  5D4B A;  5J0R A;  4X4Q A;  7ICM A;  4I2F A;  5BOL A;  7ICH A;  2HN2 A;  4PHD A;  7ICR A;  5CP2 A;  4RQ5 A;  7ICQ A;  4PHE A;  4GXJ A;  4XRH A;  4O5E A;  5J0O A;  4GXI A;  3WFP A;  2DR5 A;  4K4H A;  1UEU A;  3C18 A;  1NOM A;  4XJE A;  2ZH3 A;  4RPX A;  9ICG A;  5J2B A;  2ZH7 A;  3ISD A;  1JQR A;  4R65 A;  4WC0 A;  2VAN A;  1ZQU A;  9ICJ A;  9ICH A;  4NLZ A;  3V7L A;  4PGQ A;  4UBB A;  5CWR A;  9ICT A;  2ISP A;  1UEV A;  8ICH A;  4O6A A;  5J0T A;  1R8B A;  3OWG A;  4EBJ A;  2ZHB A;  7ICL A;  4PHA A;  5J0S A;  4LVS A;  4UAY A;  8ICT A;  3HIY A;  4KLQ A;  5HC9 A;  4NM1 A;  4WCW A;  4LEW A;  5IIN A;  5DDY A;  5HRF A;  4PGY A;  4KLM A;  1ZQT A;  8ICS A;  3MDA A;  4PPX A;  4EBK A;  4QZ8 A;  3L9D A;  3HJ1 A;  3LQC B;  2HHP A;  1ZQX A;  4FHX A;  1FA0 A;  5J0Y A;  5IIM A;  2PFO A;  4UB5 A;  5J2C A;  5CB1 A;  5DDM A;  2BBJ A;  5HR9 A;  2BCQ A;  4O9M A;  7ICN A;  9ICR A;  5HRK A;  8ICM A;  4AT8 A;  2ID1 A;  1R89 A;  4O5K A;  3UPS A;  5CR0 A;  4DO9 A;  3RJJ A;  4NKU A;  3OUY B;  4M2Y A;  4I2A A;  3C2K A;  4R66 A;  2BCR A;  2PFP A;  5CFS A;  9ICA A;  4XA5 A;  5HHH A;  1HUO A;  8ICB A;  4NXT A;  4WBZ A;  4WC6 A;  4K97 A;  4Z6C A;  4QZF A;  8ICU A;  9ICI A;  4X4U A;  4IQU A;  2NRK A;  1ZQM A;  8ICN A;  8ICQ A;  3MCR A;  3C5G A;  4X4N A;  5J0X A;  3OVA A;  1BPE A;  1ZQH A;  4QZB A;  5DB7 A;  1XSN A;  1RPL A;  5J2H A;  8ICV A;  2PBE A;  4RWN A;  4I0U A;  5J0P A;  3RJH A;  4K96 A;  4I2D A;  3WFR E;  4I2E A;  4EGW A;  2GA9 D;  4P4O A;  3RJG A;  4EED A;  4TUS A;  2DR9 A;  2ZH6 A;  4NM2 A;  4O5C A;  9ICE A;  4UAZ A;  4MF2 A;  1MIV A;  9ICW A;  4P4M A;  2BCU A;  1ZQL A;  4JWM A;  4KLO A;  4WC4 A;  5IIJ A;  3C2L A;  2PFQ A;  1JN3 A;  4S3N A;  4RQ8 A;  1XSL A; 
#chains in the Genus database with same CATH homology
 7ICE A;  4LZG A;  4UB3 A;  5HRH A;  5BPC A;  4KLJ A;  4F5R A;  4YD1 A;  4RQ2 A;  3JPN A;  4MFA A;  3MGH A;  4QZC A;  1TV9 A;  4IQW A;  3JPQ A;  5CHG A;  4AT9 A;  3V72 A;  3WFS C;  4P4P A;  3AQK A;  9ICV A;  3RJK A;  1JAJ A;  2PXI A;  4X4S A;  1KNY A;  3H37 A;  5J2J A;  5HRD A;  8ICZ A;  3TFS A;  3MBY A;  4PHP A;  3OVS A;  2DRB A;  3PNC A;  8ICE A;  4RPY A;  4X4V A;  2FMQ A;  2BE3 A;  4UD4 A;  2M2V A;  2FMP A;  5DBC A;  4RQ6 A;  3MDC A;  5IIL A;  4RQ0 A;  4GXK A;  1BPB A;  8ICO A;  4I28 A;  2ZH8 A;  1ZQE A;  4EP7 A;  2M2W A;  4I2C A;  2RFF A;  4FH5 A;  8ICC A;  1OU5 A;  1YLQ A;  3UQ0 A;  1ZQS A;  4KLT A;  9ICP A;  4RWP A;  1ZQY A;  4YD2 A;  2P66 A;  3H38 A;  4YMM A;  3AU2 A;  4QZ9 A;  3C2M A;  5J2G A;  8ICX A;  4M9N A;  5BOM A;  5EOZ A;  4X4O A;  5J2A A;  2ZH1 A;  4R64 A;  4WC3 A;  3C5F A;  8ICY A;  4I2G A;  3V7K A;  1Q79 A;  4UB1 A;  4I2B A;  4XQ7 A;  4QZA A;  5IIK A;  3UXP A;  2BCS A;  2I9G A;  4UBC A;  7ICO A;  7ICT A;  4RT2 A;  3RH6 A;  1UET A;  8ICF A;  1MQ3 A;  4AT8 B;  4RT3 A;  8ICL A;  2O5A A;  2BPG A;  4X4P A;  4NLN A;  4QZG A;  8ICK A;  8ICW A;  4M0A A;  8ICG A;  3JPP A;  7ICU A;  1R8A A;  8ICP A;  1ZQI A;  5J29 A;  4QZD A;  1ZQO A;  4I2H A;  2IHM A;  4RWO A;  3WFO A;  1MQ2 A;  1ZJN A;  4KLI A;  5J0U A;  4R63 A;  1F5A A;  4WC5 A;  4KLE A;  4M04 A;  1ZQQ A;  1RZT A;  3GDX A;  1BPX A;  4IQV A;  4YN4 A;  3AUO A;  2ISO A;  4I2J A;  3NYB A;  3RH5 A;  9ICS A;  4M5D A;  4KLU A;  1ZQF A;  1ZQG A;  1ZQA A;  9ICQ A;  4X0A A;  2ZH9 A;  1ZQD A;  4E7X A;  1TFW A;  4M9G A;  2GWS A;  1ZQJ A;  1VFG A;  4X4T A;  4UB2 A;  4QZH A;  4IQT A;  3JZ0 A;  7ICS A;  7ICK A;  4I2I A;  4YMO A;  4NY8 A;  4TUP A;  4PGX A;  1ZQZ A;  4F5N A;  3B0Y A;  4X5V A;  3HWT A;  3AU6 A;  5DED A;  2M2U A;  4XUS A;  5DB9 A;  5DBB A;  1ZQV A;  5DEC A;  4ATB A;  3OGU A;  5J0Q A;  4KLS A;  8ICR A;  9ICU A;  1ZQP A;  1MIY A;  8ICI A;  3PML A;  5HRL A;  4RQ7 A;  9ICL A;  3RJF A;  4E8F A;  3AQL A;  5DBA A;  1ZJM A;  8ICJ A;  3UXN A;  4AT9 B;  2BPC A;  4FHP A;  2DR7 A;  2W9M A;  3JPO A;  2ZH4 A;  4Z6F A;  4RWQ A;  4FH3 A;  4WBY A;  4UAW A;  4LT6 A;  4M9J A;  1JMS A;  2ZHA A;  4LZD A;  1ZQR A;  4QZE A;  1BPY A;  4I27 A;  2BCV A;  4DOC A;  4KLD A;  4YCX A;  5J0W A;  3UPQ A;  1BPZ A;  2PFN A;  7ICJ A;  7ICV A;  1PX5 A;  4AT7 A;  4AT7 B;  2ZH2 A;  7ICP A;  4XQ8 A;  1MIW A;  3JPT A;  5HRE A;  3UQ2 A;  3JYY A;  9ICO A;  4FHV A;  3MGI A;  1XSP A;  5HRG A;  3RJE A;  3H39 A;  4Z6E A;  4JWN A;  5DKW A;  4NKT A;  3ISB A;  4PH5 A;  4MFC A;  2DVI A;  4M9H A;  4WC2 A;  4M47 A;  5DB6 A;  4RQ1 A;  4F5O A;  2BPF A;  4P2H A;  3OV7 A;  1ZQN A;  1ZQW A;  5TZV A;  5J2D A;  3C66 A;  9ICF A;  4F5P A;  8ICA A;  9ICN A;  4FO6 A;  5HHI A;  2ZH5 A;  4K4I A;  4QZI A;  3H3A A;  3RH4 A;  3V7J A;  5J2F A;  4TUQ A;  3UXO A;  4KLF A;  3RJI A;  4UD5 A;  4KLL A;  3PMN A;  7ICG A;  5D49 A;  4I29 A;  3JPR A;  4MF8 A;  1WOT A;  2Q66 A;  4F5Q A;  4KLG A;  2DRA A;  3HX0 A;  1VJ7 A;  4NLK A;  4DOB A;  4YMN A;  3HJ4 A;  9ICC A;  1V4A A;  1ZQK A;  1R8C A;  3TFR A;  3OUY A;  5III A;  7ICI A;  4FHY A;  5J2E A;  2O1P A;  4K4G A;  4E80 A;  5CA7 A;  5IIO A;  3WFQ E;  5HRB A;  4DOA A;  5DB8 A;  1NO5 A;  3K75 D;  5D46 A;  4RPZ A;  1HUZ A;  4WC1 A;  1Q78 A;  4X0B A;  4FHW A;  2M2T A;  3B0X A;  7ICF A;  3AQN A;  2DR8 A;  3ISC A;  4TUR A;  5J2I A;  4RQ4 A;  5CJ7 A;  3HW8 A;  1KDH A;  4ATB B;  5F2V O;  4IG8 A;  4MFF A;  4RQ3 A;  4KLH A;  1TVA A;  5HRI A;  9ICB A;  1ZQB A;  1BPD A;  5J2K A;  4Z6D A;  9ICX A;  4WC7 A;  1ZQC A;  4M9L A;  3OVB A;  3AQM A;  1KEJ A;  4X4R A;  4UB4 A;  9ICM A;  1TFY A;  2FMS A;  3LK9 A;  4NXZ A;  9ICK A;  3JPS A;  5D4B A;  5J0R A;  4X4Q A;  7ICM A;  4I2F A;  5BOL A;  7ICH A;  4PHD A;  7ICR A;  5CP2 A;  4RQ5 A;  7ICQ A;  4PHE A;  4GXJ A;  4XRH A;  4O5E A;  5J0O A;  4GXI A;  3WFP A;  2DR5 A;  4K4H A;  1UEU A;  3C18 A;  1NOM A;  2ZH3 A;  4RPX A;  9ICG A;  5J2B A;  2ZH7 A;  3ISD A;  1JQR A;  4R65 A;  4WC0 A;  2VAN A;  1ZQU A;  9ICJ A;  9ICH A;  4NLZ A;  3V7L A;  4PGQ A;  4UBB A;  5CWR A;  9ICT A;  2ISP A;  1UEV A;  8ICH A;  5J0T A;  1R8B A;  4EBJ A;  2ZHB A;  7ICL A;  4PHA A;  5J0S A;  4LVS A;  4UAY A;  8ICT A;  3HIY A;  4KLQ A;  5HC9 A;  4NM1 A;  4WCW A;  5IIN A;  5DDY A;  5HRF A;  4PGY A;  4KLM A;  1ZQT A;  8ICS A;  3MDA A;  4PPX A;  4EBK A;  4QZ8 A;  3L9D A;  3HJ1 A;  3LQC B;  2HHP A;  1ZQX A;  4FHX A;  1FA0 A;  5J0Y A;  5IIM A;  2PFO A;  4UB5 A;  5J2C A;  5CB1 A;  5DDM A;  5HR9 A;  2BCQ A;  4O9M A;  7ICN A;  9ICR A;  5HRK A;  8ICM A;  4AT8 A;  2ID1 A;  1R89 A;  4O5K A;  3UPS A;  5CR0 A;  4DO9 A;  3RJJ A;  4NKU A;  3OUY B;  4M2Y A;  4I2A A;  3C2K A;  4R66 A;  2BCR A;  2PFP A;  9ICA A;  4XA5 A;  5HHH A;  1HUO A;  8ICB A;  4WBZ A;  4WC6 A;  4Z6C A;  4QZF A;  8ICU A;  9ICI A;  4X4U A;  4IQU A;  2NRK A;  1ZQM A;  8ICN A;  8ICQ A;  3C5G A;  4X4N A;  5J0X A;  3OVA A;  1BPE A;  1ZQH A;  4QZB A;  5DB7 A;  1XSN A;  1RPL A;  5J2H A;  8ICV A;  2PBE A;  4RWN A;  5J0P A;  3RJH A;  3WFR E;  4I2D A;  4I2E A;  4P4O A;  3RJG A;  4TUS A;  2DR9 A;  2ZH6 A;  4NM2 A;  4O5C A;  9ICE A;  4UAZ A;  4MF2 A;  1MIV A;  9ICW A;  4P4M A;  2BCU A;  1ZQL A;  4JWM A;  4KLO A;  4WC4 A;  5IIJ A;  3C2L A;  2PFQ A;  1JN3 A;  4S3N A;  4RQ8 A;  1XSL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...