2M2WA

Ternary complex of asfv pol x with dna and mgdgtp
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
174
structure length
174
Chain Sequence
MLTLIQGKKIVNHLRSRLAFEYNGQLIKILSKNIVAVGSLRREEKMLNDVDLLIIVPEKKLLKHVLPNIRIKGLSFSVKVCGERKCVLFIEWEKKTYQLDLFTALAEEKPYAIFHFTGPVSYLIRIRAALKKKNYKLNQYGLFKNQTLVPLKITTEKELIKELGFTYRIPKKRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Repair DNA polymerase X
publication title How a low-fidelity DNA polymerase chooses non-Watson-Crick from Watson-Crick incorporation.
pubmed doi rcsb
source organism African swine fever virus
molecule tags Transferase/dna
total genus 37
structure length 174
sequence length 174
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 2m2wA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 2m2wA01
3ISDA 2PFNA 4AT8B 4DOCA 2IHMA 3MDAA 3GDXA 7ICJA 4EP7A 4PHPA 4MFFA 1UETA 5IIOA 5J2CA 1ZQHA 5HRDA 1ZJMA 4I2IA 4UAWA 4UBCA 4WC3A 4X4TA 5DBCA 4R65A 1JMSA 9ICQA 3PNCA 9ICKA 1FA0A 1BPEA 4I2DA 4RQ0A 3AQKA 4RPZA 5HRKA 4UB1A 4X4OA 4RWOA 9ICPA 1R8CA 4F5QA 9ICVA 3RJIA 2BCSA 1RZTA 3V7JA 9ICTA 9ICWA 5BOMA 1ZQQA 2ZH2A 8ICMA 2FMPA 2M2UA 7ICQA 2I9GA 8ICSA 4X5VA 4I2GA 5DDMA 4NLKA 4PPXA 3ISCA 8ICTA 2FMSA 4M2YA 2BCRA 5J0SA 4UB5A 5DBBA 2PXIA 3H39A 3V7KA 3OUYB 4F5RA 5CJ7A 5J2DA 4I2CA 4WC1A 1WOTA 4R63A 9ICIA 4ATBA 3RJGA 2BCVA 5DB6A 9ICFA 4RPYA 4X0BA 2PFPA 4FH3A 4PHAA 4X4QA 2DVIA 5DDYA 4NY8A 1XSNA 4NXZA 5DB9A 7ICHA 4DO9A 4KLFA 4TUPA 8ICOA 4FH5A 5DBAA 8ICZA 8ICQA 1HUZA 4YMOA 1JN3A 1ZQCA 4WC2A 4M5DA 2M2VA 3JPNA 4RPXA 7ICPA 4EBJA 5J0RA 4O5EA 4TUQA 4NLNA 1ZJNA 2BPFA 4YMNA 4MFCA 8ICLA 4Z6CA 3HX0A 4PH5A 3LK9A 2DR9A 7ICFA 4I28A 8ICYA 4WBYA 3JPSA 3H37A 2ZHBA 5HRGA 7ICGA 5IILA 1JAJA 9ICNA 9ICLA 3AQLA 5HRLA 5IINA 9ICEA 2ZH9A 4AT9B 2BCUA 3UPQA 5HRBA 1PX5A 1KEJA 5HC9A 4KLLA 3AU2A 5HRIA 4M47A 1BPDA 5J2EA 4X0AA 7ICKA 1MIYA 3B0XA 1ZQTA 2ZH7A 5J2BA 4YD1A 1BPYA 3C18A 4YD2A 4WC0A 2DR7A 4UAZA 4I29A 3UPSA 4E7XA 2HHPA 4P4OA 4F5OA 9ICJA 4FHYA 4WC6A 2P66A 4M04A 4I27A 3OVBA 3OUYA 8ICNA 5J2JA 4DOBA 1ZQOA 4KLEA 4I2FA 4TURA 1NOMA 4I2JA 5J29A 5CP2A 1V4AA 2PFOA 5TZVA 4IQTA 1TFWA 4P2HA 4PGQA 5J0XA 8ICBA 4WBZA 2PFQA 4XQ7A 3WFOA 5DB7A 4IQUA 5DB8A 7ICMA 1Q79A 4Z6FA 1ZQGA 4QZCA 3C5GA 5DECA 3PMLA 3OVSA 4Z6EA 4I2EA 1VJ7A 3AUOA 4S3NA 4FO6A 8ICJA 4K4IA 4IG8A 4MF2A 3OV7A 4P4PA 7ICIA 4M9NA 5IIKA 4X4UA 4O5CA 4KLHA 2Q66A 4QZFA 4M0AA 3C66A 3WFPA 4O9MA 4XA5A 3JPRA 4NKUA 5D49A 2O1PA 4UD5A 1MQ3A 5J2HA 1HUOA 7ICVA 4F5PA 3RJJA 3UQ2A 1BPZA 4KLQA 4UD4A 1ZQDA 4KLMA 4UB4A 2BE3A 4AT9A 1F5AA 2DR5A 4QZIA 2ISOA 1ZQWA 3JPQA 3RH5A 5EOZA 9ICXA 4R64A 4NLZA 1TFYA 4PGXA 5CHGA 3PMNA 7ICSA 8ICFA 1JQRA 4GXKA 4XRHA 4QZGA 4Z6DA 1ZQFA 4RQ4A 5BOLA 3AQNA 4M9GA 5IIMA 4UB2A 8ICRA 1ZQUA 4TUSA 4IQWA 4KLOA 4M9LA 1ZQNA 3UQ0A 2ZHAA 5J0PA 4FHVA 3C2LA 4KLUA 1TV9A 3HIYA 5DEDA 5HRHA 1MQ2A 4O5KA 4MF8A 2DRBA 1ZQVA 4EBKA 4RQ5A 4RQ7A 3UXPA 2ZH6A 9ICCA 1ZQZA 9ICSA 4X4VA 3MGHA 4LVSA 4NM2A 3C2KA 9ICUA 9ICRA 4LT6A 3HWTA 3H38A 8ICUA 4YN4A 1MIWA 2RFFA 9ICAA 4UAYA 8ICGA 5J0YA 3UXNA 5F2VO 2BPGA 1ZQPA 5HR9A 3RJHA 4RT2A 1ZQJA 8ICXA 4X4RA 1ZQRA 1ZQEA 7ICOA 1Q78A 5J0TA 1ZQIA 3WFSC 4RT3A 4KLIA 3JPOA 7ICEA 4K4GA 3WFQE 1NO5A 3HJ1A 5J2IA 5D46A 8ICWA 3MDCA 3V72A 1BPXA 4JWMA 4QZDA 4KLSA 1RPLA 1ZQMA 4DOAA 4RQ1A 4KLDA 4FHPA 3K75D 1OU5A 3MGIA 4UBBA 4WC5A 5HRFA 3TFSA 4QZAA 4JWNA 9ICOA 4LZDA 4FHWA 5IIJA 5DKWA 4K4HA 5HHIA 3AU6A 2NRKA 4X4SA 7ICRA 5J0QA 8ICPA 5J0OA 4I2HA 3L9DA 4RQ8A 4F5NA 8ICEA 2ID1A 8ICVA 9ICHA 3JPPA 3OVAA 4PHDA 3HJ4A 2VANA 2ZH1A 5HREA 1XSLA 1ZQAA 4WC7A 4X4NA 2BCQA 7ICTA 4KLGA 1KNYA 4GXIA 1YLQA 5CA7A 1XSPA 4AT7A 4M9JA 5D4BA 2ZH4A 5CWRA 3B0YA 1ZQXA 4IQVA 3ISBA 1UEUA 1ZQLA 4RWPA 8ICKA 3UXOA 3JZ0A 2DRAA 3JPTA 4YMMA 4QZBA 4RQ3A 9ICGA 3C5FA 4E8FA 2M2TA 4WC4A 8ICCA 2BPCA 1ZQBA 4LZGA 4QZ8A 4I2AA 4NM1A 2ISPA 1UEVA 3TFRA 4KLTA 8ICAA 2M2WA 4GXJA 1R89A 4KLJA 5J2AA 4RWNA 1R8AA 3H3AA 3MBYA 2W9MA 4QZEA 4FHXA 1VFGA 4PHEA 5J0WA 2DR8A 1ZQKA 3HW8A 4I2BA 4XUSA 3OGUA 1MIVA 4RWQA 3RJEA 4AT7B 3JYYA 5HHHA 4AT8A 5IIIA 1ZQYA 5CR0A 3LQCB 4M9HA 3V7LA 2FMQA 1R8BA 8ICHA 3RH6A 2ZH3A 1TVAA 4UB3A 5J2GA 4NKTA 2ZH5A 4P4MA 4PGYA 4QZ9A 4MFAA 5J0UA 4ATBB 4RQ6A 1ZQSA 3C2MA 2O5AA 5BPCA 4XQ8A 7ICLA 2GWSA 1KDHA 4WCWA 5J2KA 5J2FA 3RH4A 4RQ2A 2PBEA 4E80A 4X4PA 3RJFA 3WFRE 4QZHA 9ICBA 4YCXA 1BPBA 7ICNA 8ICIA 3NYBA 7ICUA 9ICMA 4R66A 2ZH8A 5CB1A 3AQMA 3RJKA
chains in the Genus database with same CATH superfamily
3ISDA 4JLXA 2PFNA 4AT8B 4O69A 4DOCA 2IHMA 3MDAA 3GDXA 7ICJA 4EP7A 4PHPA 4MFFA 1UETA 5IIOA 5J2CA 1ZQHA 5HRDA 1ZJMA 4I2IA 4UAWA 4UBCA 4WC3A 4WH5A 4X4TA 5DBCA 4R65A 4WQLA 1JMSA 2B4VA 9ICQA 3PNCA 9ICKA 1FA0A 1BPEA 4I2DA 4RQ0A 3AQKA 4RPZA 5HRKA 4UB1A 4X4OA 4RWOA 9ICPA 1R8CA 4F5QA 4OAIZ 9ICVA 3RJIA 2BCSA 1RZTA 3V7JA 9ICTA 9ICWA 5BOMA 1ZQQA 2B51A 8ICMA 2ZH2A 2FMPA 2M2UA 7ICQA 2I9GA 8ICSA 4X5VA 4I2GA 5DDMA 4NLKA 4PPXA 3ISCA 8ICTA 2FMSA 4M2YA 2BCRA 2EWRA 5J0SA 4UB5A 5DBBA 2PXIA 3H39A 3V7KA 3OUYB 4F5RA 5CJ7A 5J2DA 4I2CA 4WC1A 1WOTA 4R63A 9ICIA 4ATBA 3RJGA 2BCVA 5DB6A 4KB6A 9ICFA 2BBHA 4RPYA 4X0BA 2PFPA 4FH3A 4FO1A 4PHAA 4X4QA 2DVIA 5DDYA 5CHEA 4NY8A 1XSNA 4O67A 4NXZA 4K99A 5DB9A 5CFUA 7ICHA 3CK6A 4DO9A 4KLFA 5D63A 4TUPA 8ICOA 2B56A 5DBAA 4FH5A 8ICZA 8ICQA 1HUZA 4YMOA 1JN3A 1ZQCA 4WC2A 4EEDA 4M5DA 3NWIA 2M2VA 3JPNA 4RPXA 7ICPA 4EBJA 5J0RA 4O5EA 4TUQA 4NLNA 3OWGA 1ZJNA 2BPFA 4YMNA 4MFCA 8ICLA 4O68A 4Z6CA 3HX0A 4PH5A 3LK9A 2DR9A 7ICFA 4I28A 8ICYA 4WBYA 3JPSA 3H37A 2ZHBA 3ER9B 5HRGA 7ICGA 5IILA 1JAJA 9ICNA 9ICLA 3AQLA 5HRLA 5IINA 9ICEA 2ZH9A 4AT9B 2BCUA 3UPQA 5HRBA 1PX5A 1KEJA 5HC9A 4KLLA 3AU2A 5HRIA 4M47A 1BPDA 5J2EA 4X0AA 7ICKA 1MIYA 3B0XA 1ZQTA 2ZH7A 5J2BA 5CFSA 4YD1A 1BPYA 3C18A 4YD2A 4WC0A 2DR7A 4WQKA 4UAZA 4I29A 3UPSA 2IUBA 4E7XA 2HHPA 4P4OA 4F5OA 9ICJA 4FHYA 4EEBA 4WC6A 2P66A 4XJEA 4M04A 4I27A 3OVBA 3OUYA 8ICNA 4NXUA 5J2JA 4EGWA 4DOBA 1ZQOA 4KLEA 2FCLA 4I2FA 4TURA 1NOMA 4I2JA 5J29A 5CP2A 1V4AA 4NXVA 2PFOA 5TZVA 4IQTA 1TFWA 4P2HA 4PGQA 5J0XA 8ICBA 4WBZA 2PFQA 4XQ7A 3WFOA 5DB7A 4IQUA 5DB8A 7ICMA 1Q79A 4Z6FA 1ZQGA 4QZCA 3C5GA 5D61A 5DECA 3PMLA 3OVSA 4Z6EA 4I2EA 1VJ7A 3PHZA 3AUOA 4S3NA 4FO6A 5D62A 8ICJA 4LEVA 2HN2A 5B3PA 4K4IA 4IG8A 4MF2A 3OV7A 4K96A 4P4PA 7ICIA 4M9NA 4K98A 5IIKA 4X4UA 4O5CA 4K9BA 4KLHA 2Q66A 4QZFA 4M0AA 3C66A 3WFPA 4O9MA 4XA5A 3JPRA 4NKUA 5D49A 2O1PA 4UD5A 1MQ3A 5J2HA 1HUOA 4O6AA 7ICVA 4F5PA 4NXXA 3RJJA 3UQ2A 1BPZA 5CFTA 4KLQA 4UD4A 1ZQDA 4KLMA 4UB4A 2BE3A 4AT9A 1F5AA 2DR5A 4QZIA 2ISOA 1ZQWA 3JPQA 3RH5A 5EOZA 9ICXA 4R64A 4NLZA 1TFYA 4PGXA 5CHGA 3PMNA 7ICSA 8ICFA 1JQRA 4GXKA 4XRHA 4QZGA 4Z6DA 1ZQFA 4RQ4A 5BOLA 3AQNA 4HX0A 4K9AA 4M9GA 5IIMA 4UB2A 2GAFD 8ICRA 1ZQUA 4TUSA 4IQWA 4KLOA 4M9LA 1ZQNA 3UQ0A 2ZHAA 5J0PA 4FHVA 3C2LA 4KLUA 1TV9A 3HIYA 5DEDA 5HRHA 1MQ2A 4O5KA 4MF8A 1GPJA 2DRBA 1ZQVA 4EBKA 4LEZA 4RQ5A 4RQ7A 3UXPA 2ZH6A 9ICCA 4NXTA 1ZQZA 9ICSA 4X4VA 3MGHA 4LVSA 4NM2A 3C2KA 4WOYA 9ICUA 9ICRA 4LT6A 3HWTA 3H38A 8ICUA 4YN4A 1MIWA 2RFFA 9ICAA 4UAYA 8ICGA 4OAGA 3JCFA 5J0YA 3UXNA 5F2VO 2BPGA 3NVOA 1ZQPA 2GA9D 5HR9A 3RJHA 4RT2A 2IHOA 1ZQJA 8ICXA 4X4RA 1ZQRA 1ZQEA 7ICOA 1Q78A 5J0TA 1ZQIA 3WFSC 4RT3A 4KLIA 3JPOA 4JLZA 7ICEA 4K4GA 3WFQE 1NO5A 3HJ1A 5J2IA 5D46A 8ICWA 3MDCA 3V72A 4OAHA 1BPXA 4JWMA 4QZDA 4KLSA 1RPLA 1ZQMA 4DOAA 4RQ1A 4KLDA 4FHPA 3K75D 1OU5A 3MGIA 4UBBA 4WC5A 4I0UA 5HRFA 3TFSA 4QZAA 4JWNA 9ICOA 4LZDA 4FHWA 5IIJA 5DKWA 4K4HA 5HHIA 3AU6A 2NRKA 4X4SA 7ICRA 5J0QA 8ICPA 5J0OA 4I2HA 3NKUA 3L9DA 4RQ8A 4F5NA 8ICEA 2ID1A 8ICVA 9ICHA 3JPPA 4K8VA 3OVAA 4PHDA 3HJ4A 2VANA 2ZH1A 5HREA 1XSLA 1ZQAA 4WC7A 4X4NA 2BCQA 7ICTA 4KLGA 3K7DA 1KNYA 4GXIA 1YLQA 5CA7A 1XSPA 4AT7A 4M9JA 5D4BA 2ZH4A 5CWRA 5JTGA 3B0YA 1ZQXA 4IQVA 3ISBA 1UEUA 1ZQLA 4RWPA 8ICKA 3UXOA 3JZ0A 2DRAA 3JPTA 4YMMA 4QZBA 4RQ3A 9ICGA 3C5FA 4E8FA 2M2TA 4WC4A 8ICCA 2BPCA 1ZQBA 4LZGA 4QZ8A 4I2AA 4NM1A 2ISPA 1UEVA 3TFRA 4OAFA 4KLTA 8ICAA 2M2WA 4GXJA 1R89A 4KLJA 5J2AA 4RWNA 1R8AA 3H3AA 3MBYA 4LEWA 2W9MA 4QZEA 4FHXA 1VFGA 4PHEA 5J0WA 2DR8A 1ZQKA 3HW8A 4I2BA 4XUSA 3OGUA 1MIVA 4NXWA 4RWQA 3RJEA 4AT7B 4K97A 3JYYA 5HHHA 4MKPA 4AT8A 5IIIA 1ZQYA 5CR0A 3LQCB 4M9HA 3V7LA 2FMQA 3EF2A 1R8BA 8ICHA 3RH6A 2ZH3A 1TVAA 2HN1A 4LEYA 4KM5A 4UB3A 3ER8C 5J2GA 4NKTA 2ZH5A 4P4MA 4PGYA 4QZ9A 4MFAA 5J0UA 4ATBB 4RQ6A 1ZQSA 4N7RA 3C2MA 2O5AA 5BPCA 4XQ8A 7ICLA 2GWSA 1KDHA 4WCWA 5J2KA 5J2FA 3RH4A 4RQ2A 2PBEA 3MCRA 2BBJA 4E80A 4X4PA 3RJFA 3WFRE 4QZHA 9ICBA 4YCXA 1BPBA 7ICNA 8ICIA 3NYBA 3ERCC 4EV6A 7ICUA 9ICMA 4R66A 2ZH8A 5CB1A 3AQMA 3RJKA 5B3QA
chains in the Genus database with same CATH topology
3ISDA 2PFNA 4AT8B 4DOCA 2IHMA 3MDAA 3GDXA 7ICJA 4EP7A 4PHPA 4MFFA 1UETA 5IIOA 5J2CA 1ZQHA 5HRDA 1ZJMA 4I2IA 4UAWA 4UBCA 4WC3A 4X4TA 5DBCA 4R65A 1JMSA 9ICQA 3PNCA 9ICKA 1FA0A 1BPEA 4I2DA 4RQ0A 3AQKA 4RPZA 5HRKA 4UB1A 4X4OA 4RWOA 9ICPA 1R8CA 4F5QA 9ICVA 3RJIA 2BCSA 1RZTA 3V7JA 9ICTA 9ICWA 5BOMA 1ZQQA 2ZH2A 8ICMA 2FMPA 2M2UA 7ICQA 2I9GA 8ICSA 4X5VA 4I2GA 5DDMA 4NLKA 4PPXA 3ISCA 8ICTA 2FMSA 4M2YA 2BCRA 5J0SA 4UB5A 5DBBA 2PXIA 3H39A 3V7KA 3OUYB 4F5RA 5CJ7A 5J2DA 4I2CA 4WC1A 1WOTA 4R63A 9ICIA 4ATBA 3RJGA 2BCVA 5DB6A 9ICFA 4RPYA 4X0BA 2PFPA 4FH3A 4PHAA 4X4QA 2DVIA 5DDYA 4NY8A 1XSNA 4NXZA 5DB9A 7ICHA 4DO9A 4KLFA 4TUPA 8ICOA 4FH5A 5DBAA 8ICZA 8ICQA 1HUZA 4YMOA 1JN3A 1ZQCA 4WC2A 4M5DA 2M2VA 3JPNA 4RPXA 7ICPA 4EBJA 5J0RA 4O5EA 4TUQA 4NLNA 1ZJNA 2BPFA 4YMNA 4MFCA 8ICLA 4Z6CA 3HX0A 4PH5A 3LK9A 2DR9A 7ICFA 4I28A 8ICYA 4WBYA 3JPSA 3H37A 2ZHBA 5HRGA 7ICGA 5IILA 1JAJA 9ICNA 9ICLA 3AQLA 5HRLA 5IINA 9ICEA 2ZH9A 4AT9B 2BCUA 3UPQA 5HRBA 1PX5A 1KEJA 5HC9A 4KLLA 3AU2A 5HRIA 4M47A 1BPDA 5J2EA 4X0AA 7ICKA 1MIYA 3B0XA 1ZQTA 2ZH7A 5J2BA 4YD1A 1BPYA 3C18A 4YD2A 4WC0A 2DR7A 4UAZA 4I29A 3UPSA 4E7XA 2HHPA 4P4OA 4F5OA 9ICJA 4FHYA 4WC6A 2P66A 4M04A 4I27A 3OVBA 3OUYA 8ICNA 5J2JA 4DOBA 1ZQOA 4KLEA 4I2FA 4TURA 1NOMA 4I2JA 5J29A 5CP2A 1V4AA 2PFOA 5TZVA 4IQTA 1TFWA 4P2HA 4PGQA 5J0XA 8ICBA 4WBZA 2PFQA 4XQ7A 3WFOA 5DB7A 4IQUA 5DB8A 7ICMA 1Q79A 4Z6FA 1ZQGA 4QZCA 3C5GA 5DECA 3PMLA 3OVSA 4Z6EA 4I2EA 1VJ7A 3AUOA 4S3NA 4FO6A 8ICJA 4K4IA 4IG8A 4MF2A 3OV7A 4P4PA 7ICIA 4M9NA 5IIKA 4X4UA 4O5CA 4KLHA 2Q66A 4QZFA 4M0AA 3C66A 3WFPA 4O9MA 4XA5A 3JPRA 4NKUA 5D49A 2O1PA 4UD5A 1MQ3A 5J2HA 1HUOA 7ICVA 4F5PA 3RJJA 3UQ2A 1BPZA 4KLQA 4UD4A 1ZQDA 4KLMA 4UB4A 2BE3A 4AT9A 1F5AA 2DR5A 4QZIA 2ISOA 1ZQWA 3JPQA 3RH5A 5EOZA 9ICXA 4R64A 4NLZA 1TFYA 4PGXA 5CHGA 3PMNA 7ICSA 8ICFA 1JQRA 4GXKA 4XRHA 4QZGA 4Z6DA 1ZQFA 4RQ4A 5BOLA 3AQNA 4M9GA 5IIMA 4UB2A 8ICRA 1ZQUA 4TUSA 4IQWA 4KLOA 4M9LA 1ZQNA 3UQ0A 2ZHAA 5J0PA 4FHVA 3C2LA 4KLUA 1TV9A 3HIYA 5DEDA 5HRHA 1MQ2A 4O5KA 4MF8A 2DRBA 1ZQVA 4EBKA 4RQ5A 4RQ7A 3UXPA 2ZH6A 9ICCA 1ZQZA 9ICSA 4X4VA 3MGHA 4LVSA 4NM2A 3C2KA 9ICUA 9ICRA 4LT6A 3HWTA 3H38A 8ICUA 4YN4A 1MIWA 2RFFA 9ICAA 4UAYA 8ICGA 5J0YA 3UXNA 5F2VO 2BPGA 1ZQPA 5HR9A 3RJHA 4RT2A 1ZQJA 8ICXA 4X4RA 1ZQRA 1ZQEA 7ICOA 1Q78A 5J0TA 1ZQIA 3WFSC 4RT3A 4KLIA 3JPOA 7ICEA 4K4GA 3WFQE 1NO5A 3HJ1A 5J2IA 5D46A 8ICWA 3MDCA 3V72A 1BPXA 4JWMA 4QZDA 4KLSA 1RPLA 1ZQMA 4DOAA 4RQ1A 4KLDA 4FHPA 3K75D 1OU5A 3MGIA 4UBBA 4WC5A 5HRFA 3TFSA 4QZAA 4JWNA 9ICOA 4LZDA 4FHWA 5IIJA 5DKWA 4K4HA 5HHIA 3AU6A 2NRKA 4X4SA 7ICRA 5J0QA 8ICPA 5J0OA 4I2HA 3L9DA 4RQ8A 4F5NA 8ICEA 2ID1A 8ICVA 9ICHA 3JPPA 3OVAA 4PHDA 3HJ4A 2VANA 2ZH1A 5HREA 1XSLA 1ZQAA 4WC7A 4X4NA 2BCQA 7ICTA 4KLGA 1KNYA 4GXIA 1YLQA 5CA7A 1XSPA 4AT7A 4M9JA 5D4BA 2ZH4A 5CWRA 3B0YA 1ZQXA 4IQVA 3ISBA 1UEUA 1ZQLA 4RWPA 8ICKA 3UXOA 3JZ0A 2DRAA 3JPTA 4YMMA 4QZBA 4RQ3A 9ICGA 3C5FA 4E8FA 2M2TA 4WC4A 8ICCA 2BPCA 1ZQBA 4LZGA 4QZ8A 4I2AA 4NM1A 2ISPA 1UEVA 3TFRA 4KLTA 8ICAA 2M2WA 4GXJA 1R89A 4KLJA 5J2AA 4RWNA 1R8AA 3H3AA 3MBYA 2W9MA 4QZEA 4FHXA 1VFGA 4PHEA 5J0WA 2DR8A 1ZQKA 3HW8A 4I2BA 4XUSA 3OGUA 1MIVA 4RWQA 3RJEA 4AT7B 3JYYA 5HHHA 4AT8A 5IIIA 1ZQYA 5CR0A 3LQCB 4M9HA 3V7LA 2FMQA 1R8BA 8ICHA 3RH6A 2ZH3A 1TVAA 4UB3A 5J2GA 4NKTA 2ZH5A 4P4MA 4PGYA 4QZ9A 4MFAA 5J0UA 4ATBB 4RQ6A 1ZQSA 3C2MA 2O5AA 5BPCA 4XQ8A 7ICLA 2GWSA 1KDHA 4WCWA 5J2KA 5J2FA 3RH4A 4RQ2A 2PBEA 4E80A 4X4PA 3RJFA 3WFRE 4QZHA 9ICBA 4YCXA 1BPBA 7ICNA 8ICIA 3NYBA 7ICUA 9ICMA 4R66A 2ZH8A 5CB1A 3AQMA 3RJKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ISD A;  2PFN A;  4AT8 B;  4DOC A;  2IHM A;  3MDA A;  3GDX A;  7ICJ A;  4EP7 A;  4PHP A;  4MFF A;  1UET A;  5IIO A;  5J2C A;  1ZQH A;  5HRD A;  1ZJM A;  4I2I A;  4UAW A;  4UBC A;  4WC3 A;  4X4T A;  5DBC A;  4R65 A;  1JMS A;  9ICQ A;  3PNC A;  9ICK A;  1FA0 A;  1BPE A;  4I2D A;  4RQ0 A;  3AQK A;  4RPZ A;  5HRK A;  4UB1 A;  4X4O A;  4RWO A;  9ICP A;  1R8C A;  4F5Q A;  9ICV A;  3RJI A;  2BCS A;  1RZT A;  3V7J A;  9ICT A;  9ICW A;  5BOM A;  1ZQQ A;  2ZH2 A;  8ICM A;  2FMP A;  2M2U A;  7ICQ A;  2I9G A;  8ICS A;  4X5V A;  4I2G A;  5DDM A;  4NLK A;  4PPX A;  3ISC A;  8ICT A;  2FMS A;  4M2Y A;  2BCR A;  5J0S A;  4UB5 A;  5DBB A;  2PXI A;  3H39 A;  3V7K A;  3OUY B;  4F5R A;  5CJ7 A;  5J2D A;  4I2C A;  4WC1 A;  1WOT A;  4R63 A;  9ICI A;  4ATB A;  3RJG A;  2BCV A;  5DB6 A;  9ICF A;  4RPY A;  4X0B A;  2PFP A;  4FH3 A;  4PHA A;  4X4Q A;  2DVI A;  5DDY A;  4NY8 A;  1XSN A;  4NXZ A;  5DB9 A;  7ICH A;  4DO9 A;  4KLF A;  4TUP A;  8ICO A;  4FH5 A;  5DBA A;  8ICZ A;  8ICQ A;  1HUZ A;  4YMO A;  1JN3 A;  1ZQC A;  4WC2 A;  4M5D A;  2M2V A;  3JPN A;  4RPX A;  7ICP A;  4EBJ A;  5J0R A;  4O5E A;  4TUQ A;  4NLN A;  1ZJN A;  2BPF A;  4YMN A;  4MFC A;  8ICL A;  4Z6C A;  3HX0 A;  4PH5 A;  3LK9 A;  2DR9 A;  7ICF A;  4I28 A;  8ICY A;  4WBY A;  3JPS A;  3H37 A;  2ZHB A;  5HRG A;  7ICG A;  5IIL A;  1JAJ A;  9ICN A;  9ICL A;  3AQL A;  5HRL A;  5IIN A;  9ICE A;  2ZH9 A;  4AT9 B;  2BCU A;  3UPQ A;  5HRB A;  1PX5 A;  1KEJ A;  5HC9 A;  4KLL A;  3AU2 A;  5HRI A;  4M47 A;  1BPD A;  5J2E A;  4X0A A;  7ICK A;  1MIY A;  3B0X A;  1ZQT A;  2ZH7 A;  5J2B A;  4YD1 A;  1BPY A;  3C18 A;  4YD2 A;  4WC0 A;  2DR7 A;  4UAZ A;  4I29 A;  3UPS A;  4E7X A;  2HHP A;  4P4O A;  4F5O A;  9ICJ A;  4FHY A;  4WC6 A;  2P66 A;  4M04 A;  4I27 A;  3OVB A;  3OUY A;  8ICN A;  5J2J A;  4DOB A;  1ZQO A;  4KLE A;  4I2F A;  4TUR A;  1NOM A;  4I2J A;  5J29 A;  5CP2 A;  1V4A A;  2PFO A;  5TZV A;  4IQT A;  1TFW A;  4P2H A;  4PGQ A;  5J0X A;  8ICB A;  4WBZ A;  2PFQ A;  4XQ7 A;  3WFO A;  5DB7 A;  4IQU A;  5DB8 A;  7ICM A;  1Q79 A;  4Z6F A;  1ZQG A;  4QZC A;  3C5G A;  5DEC A;  3PML A;  3OVS A;  4Z6E A;  4I2E A;  1VJ7 A;  3AUO A;  4S3N A;  4FO6 A;  8ICJ A;  4K4I A;  4IG8 A;  4MF2 A;  3OV7 A;  4P4P A;  7ICI A;  4M9N A;  5IIK A;  4X4U A;  4O5C A;  4KLH A;  2Q66 A;  4QZF A;  4M0A A;  3C66 A;  3WFP A;  4O9M A;  4XA5 A;  3JPR A;  4NKU A;  5D49 A;  2O1P A;  4UD5 A;  1MQ3 A;  5J2H A;  1HUO A;  7ICV A;  4F5P A;  3RJJ A;  3UQ2 A;  1BPZ A;  4KLQ A;  4UD4 A;  1ZQD A;  4KLM A;  4UB4 A;  2BE3 A;  4AT9 A;  1F5A A;  2DR5 A;  4QZI A;  2ISO A;  1ZQW A;  3JPQ A;  3RH5 A;  5EOZ A;  9ICX A;  4R64 A;  4NLZ A;  1TFY A;  4PGX A;  5CHG A;  3PMN A;  7ICS A;  8ICF A;  1JQR A;  4GXK A;  4XRH A;  4QZG A;  4Z6D A;  1ZQF A;  4RQ4 A;  5BOL A;  3AQN A;  4M9G A;  5IIM A;  4UB2 A;  8ICR A;  1ZQU A;  4TUS A;  4IQW A;  4KLO A;  4M9L A;  1ZQN A;  3UQ0 A;  2ZHA A;  5J0P A;  4FHV A;  3C2L A;  4KLU A;  1TV9 A;  3HIY A;  5DED A;  5HRH A;  1MQ2 A;  4O5K A;  4MF8 A;  2DRB A;  1ZQV A;  4EBK A;  4RQ5 A;  4RQ7 A;  3UXP A;  2ZH6 A;  9ICC A;  1ZQZ A;  9ICS A;  4X4V A;  3MGH A;  4LVS A;  4NM2 A;  3C2K A;  9ICU A;  9ICR A;  4LT6 A;  3HWT A;  3H38 A;  8ICU A;  4YN4 A;  1MIW A;  2RFF A;  9ICA A;  4UAY A;  8ICG A;  5J0Y A;  3UXN A;  5F2V O;  2BPG A;  1ZQP A;  5HR9 A;  3RJH A;  4RT2 A;  1ZQJ A;  8ICX A;  4X4R A;  1ZQR A;  1ZQE A;  7ICO A;  1Q78 A;  5J0T A;  1ZQI A;  3WFS C;  4RT3 A;  4KLI A;  3JPO A;  7ICE A;  4K4G A;  3WFQ E;  1NO5 A;  3HJ1 A;  5J2I A;  5D46 A;  8ICW A;  3MDC A;  3V72 A;  1BPX A;  4JWM A;  4QZD A;  4KLS A;  1RPL A;  1ZQM A;  4DOA A;  4RQ1 A;  4KLD A;  4FHP A;  3K75 D;  1OU5 A;  3MGI A;  4UBB A;  4WC5 A;  5HRF A;  3TFS A;  4QZA A;  4JWN A;  9ICO A;  4LZD A;  4FHW A;  5IIJ A;  5DKW A;  4K4H A;  5HHI A;  3AU6 A;  2NRK A;  4X4S A;  7ICR A;  5J0Q A;  8ICP A;  5J0O A;  4I2H A;  3L9D A;  4RQ8 A;  4F5N A;  8ICE A;  2ID1 A;  8ICV A;  9ICH A;  3JPP A;  3OVA A;  4PHD A;  3HJ4 A;  2VAN A;  2ZH1 A;  5HRE A;  1XSL A;  1ZQA A;  4WC7 A;  4X4N A;  2BCQ A;  7ICT A;  4KLG A;  1KNY A;  4GXI A;  1YLQ A;  5CA7 A;  1XSP A;  4AT7 A;  4M9J A;  5D4B A;  2ZH4 A;  5CWR A;  3B0Y A;  1ZQX A;  4IQV A;  3ISB A;  1UEU A;  1ZQL A;  4RWP A;  8ICK A;  3UXO A;  3JZ0 A;  2DRA A;  3JPT A;  4YMM A;  4QZB A;  4RQ3 A;  9ICG A;  3C5F A;  4E8F A;  2M2T A;  4WC4 A;  8ICC A;  2BPC A;  1ZQB A;  4LZG A;  4QZ8 A;  4I2A A;  4NM1 A;  2ISP A;  1UEV A;  3TFR A;  4KLT A;  8ICA A;  2M2W A;  4GXJ A;  1R89 A;  4KLJ A;  5J2A A;  4RWN A;  1R8A A;  3H3A A;  3MBY A;  2W9M A;  4QZE A;  4FHX A;  1VFG A;  4PHE A;  5J0W A;  2DR8 A;  1ZQK A;  3HW8 A;  4I2B A;  4XUS A;  3OGU A;  1MIV A;  4RWQ A;  3RJE A;  4AT7 B;  3JYY A;  5HHH A;  4AT8 A;  5III A;  1ZQY A;  5CR0 A;  3LQC B;  4M9H A;  3V7L A;  2FMQ A;  1R8B A;  8ICH A;  3RH6 A;  2ZH3 A;  1TVA A;  4UB3 A;  5J2G A;  4NKT A;  2ZH5 A;  4P4M A;  4PGY A;  4QZ9 A;  4MFA A;  5J0U A;  4ATB B;  4RQ6 A;  1ZQS A;  3C2M A;  2O5A A;  5BPC A;  4XQ8 A;  7ICL A;  2GWS A;  1KDH A;  4WCW A;  5J2K A;  5J2F A;  3RH4 A;  4RQ2 A;  2PBE A;  4E80 A;  4X4P A;  3RJF A;  3WFR E;  4QZH A;  9ICB A;  4YCX A;  1BPB A;  7ICN A;  8ICI A;  3NYB A;  7ICU A;  9ICM A;  4R66 A;  2ZH8 A;  5CB1 A;  3AQM A;  3RJK A; 
#chains in the Genus database with same CATH topology
 3ISD A;  4JLX A;  2PFN A;  4AT8 B;  4O69 A;  4DOC A;  2IHM A;  3MDA A;  3GDX A;  7ICJ A;  4EP7 A;  4PHP A;  4MFF A;  1UET A;  5IIO A;  5J2C A;  1ZQH A;  5HRD A;  1ZJM A;  4I2I A;  4UAW A;  4UBC A;  4WC3 A;  4WH5 A;  4X4T A;  5DBC A;  4R65 A;  4WQL A;  1JMS A;  2B4V A;  9ICQ A;  3PNC A;  9ICK A;  1FA0 A;  1BPE A;  4I2D A;  4RQ0 A;  3AQK A;  4RPZ A;  5HRK A;  4UB1 A;  4X4O A;  4RWO A;  9ICP A;  1R8C A;  4F5Q A;  4OAI Z;  9ICV A;  3RJI A;  2BCS A;  1RZT A;  3V7J A;  9ICT A;  9ICW A;  5BOM A;  1ZQQ A;  2B51 A;  8ICM A;  2ZH2 A;  2FMP A;  2M2U A;  7ICQ A;  2I9G A;  8ICS A;  4X5V A;  4I2G A;  5DDM A;  4NLK A;  4PPX A;  3ISC A;  8ICT A;  2FMS A;  4M2Y A;  2BCR A;  2EWR A;  5J0S A;  4UB5 A;  5DBB A;  2PXI A;  3H39 A;  3V7K A;  3OUY B;  4F5R A;  5CJ7 A;  5J2D A;  4I2C A;  4WC1 A;  1WOT A;  4R63 A;  9ICI A;  4ATB A;  3RJG A;  2BCV A;  5DB6 A;  4KB6 A;  9ICF A;  2BBH A;  4RPY A;  4X0B A;  2PFP A;  4FH3 A;  4FO1 A;  4PHA A;  4X4Q A;  2DVI A;  5DDY A;  5CHE A;  4NY8 A;  1XSN A;  4O67 A;  4NXZ A;  4K99 A;  5DB9 A;  5CFU A;  7ICH A;  3CK6 A;  4DO9 A;  4KLF A;  5D63 A;  4TUP A;  8ICO A;  2B56 A;  5DBA A;  4FH5 A;  8ICZ A;  8ICQ A;  1HUZ A;  4YMO A;  1JN3 A;  1ZQC A;  4WC2 A;  4EED A;  4M5D A;  3NWI A;  2M2V A;  3JPN A;  4RPX A;  7ICP A;  4EBJ A;  5J0R A;  4O5E A;  4TUQ A;  4NLN A;  3OWG A;  1ZJN A;  2BPF A;  4YMN A;  4MFC A;  8ICL A;  4O68 A;  4Z6C A;  3HX0 A;  4PH5 A;  3LK9 A;  2DR9 A;  7ICF A;  4I28 A;  8ICY A;  4WBY A;  3JPS A;  3H37 A;  2ZHB A;  3ER9 B;  5HRG A;  7ICG A;  5IIL A;  1JAJ A;  9ICN A;  9ICL A;  3AQL A;  5HRL A;  5IIN A;  9ICE A;  2ZH9 A;  4AT9 B;  2BCU A;  3UPQ A;  5HRB A;  1PX5 A;  1KEJ A;  5HC9 A;  4KLL A;  3AU2 A;  5HRI A;  4M47 A;  1BPD A;  5J2E A;  4X0A A;  7ICK A;  1MIY A;  3B0X A;  1ZQT A;  2ZH7 A;  5J2B A;  5CFS A;  4YD1 A;  1BPY A;  3C18 A;  4YD2 A;  4WC0 A;  2DR7 A;  4WQK A;  4UAZ A;  4I29 A;  3UPS A;  2IUB A;  4E7X A;  2HHP A;  4P4O A;  4F5O A;  9ICJ A;  4FHY A;  4EEB A;  4WC6 A;  2P66 A;  4XJE A;  4M04 A;  4I27 A;  3OVB A;  3OUY A;  8ICN A;  4NXU A;  5J2J A;  4EGW A;  4DOB A;  1ZQO A;  4KLE A;  2FCL A;  4I2F A;  4TUR A;  1NOM A;  4I2J A;  5J29 A;  5CP2 A;  1V4A A;  4NXV A;  2PFO A;  5TZV A;  4IQT A;  1TFW A;  4P2H A;  4PGQ A;  5J0X A;  8ICB A;  4WBZ A;  2PFQ A;  4XQ7 A;  3WFO A;  5DB7 A;  4IQU A;  5DB8 A;  7ICM A;  1Q79 A;  4Z6F A;  1ZQG A;  4QZC A;  3C5G A;  5D61 A;  5DEC A;  3PML A;  3OVS A;  4Z6E A;  4I2E A;  1VJ7 A;  3PHZ A;  3AUO A;  4S3N A;  4FO6 A;  5D62 A;  8ICJ A;  4LEV A;  2HN2 A;  5B3P A;  4K4I A;  4IG8 A;  4MF2 A;  3OV7 A;  4K96 A;  4P4P A;  7ICI A;  4M9N A;  4K98 A;  5IIK A;  4X4U A;  4O5C A;  4K9B A;  4KLH A;  2Q66 A;  4QZF A;  4M0A A;  3C66 A;  3WFP A;  4O9M A;  4XA5 A;  3JPR A;  4NKU A;  5D49 A;  2O1P A;  4UD5 A;  1MQ3 A;  5J2H A;  1HUO A;  4O6A A;  7ICV A;  4F5P A;  4NXX A;  3RJJ A;  3UQ2 A;  1BPZ A;  5CFT A;  4KLQ A;  4UD4 A;  1ZQD A;  4KLM A;  4UB4 A;  2BE3 A;  4AT9 A;  1F5A A;  2DR5 A;  4QZI A;  2ISO A;  1ZQW A;  3JPQ A;  3RH5 A;  5EOZ A;  9ICX A;  4R64 A;  4NLZ A;  1TFY A;  4PGX A;  5CHG A;  3PMN A;  7ICS A;  8ICF A;  1JQR A;  4GXK A;  4XRH A;  4QZG A;  4Z6D A;  1ZQF A;  4RQ4 A;  5BOL A;  3AQN A;  4HX0 A;  4K9A A;  4M9G A;  5IIM A;  4UB2 A;  2GAF D;  8ICR A;  1ZQU A;  4TUS A;  4IQW A;  4KLO A;  4M9L A;  1ZQN A;  3UQ0 A;  2ZHA A;  5J0P A;  4FHV A;  3C2L A;  4KLU A;  1TV9 A;  3HIY A;  5DED A;  5HRH A;  1MQ2 A;  4O5K A;  4MF8 A;  1GPJ A;  2DRB A;  1ZQV A;  4EBK A;  4LEZ A;  4RQ5 A;  4RQ7 A;  3UXP A;  2ZH6 A;  9ICC A;  4NXT A;  1ZQZ A;  9ICS A;  4X4V A;  3MGH A;  4LVS A;  4NM2 A;  3C2K A;  4WOY A;  9ICU A;  9ICR A;  4LT6 A;  3HWT A;  3H38 A;  8ICU A;  4YN4 A;  1MIW A;  2RFF A;  9ICA A;  4UAY A;  8ICG A;  4OAG A;  3JCF A;  5J0Y A;  3UXN A;  5F2V O;  2BPG A;  3NVO A;  1ZQP A;  2GA9 D;  5HR9 A;  3RJH A;  4RT2 A;  2IHO A;  1ZQJ A;  8ICX A;  4X4R A;  1ZQR A;  1ZQE A;  7ICO A;  1Q78 A;  5J0T A;  1ZQI A;  3WFS C;  4RT3 A;  4KLI A;  3JPO A;  4JLZ A;  7ICE A;  4K4G A;  3WFQ E;  1NO5 A;  3HJ1 A;  5J2I A;  5D46 A;  8ICW A;  3MDC A;  3V72 A;  4OAH A;  1BPX A;  4JWM A;  4QZD A;  4KLS A;  1RPL A;  1ZQM A;  4DOA A;  4RQ1 A;  4KLD A;  4FHP A;  3K75 D;  1OU5 A;  3MGI A;  4UBB A;  4WC5 A;  4I0U A;  5HRF A;  3TFS A;  4QZA A;  4JWN A;  9ICO A;  4LZD A;  4FHW A;  5IIJ A;  5DKW A;  4K4H A;  5HHI A;  3AU6 A;  2NRK A;  4X4S A;  7ICR A;  5J0Q A;  8ICP A;  5J0O A;  4I2H A;  3NKU A;  3L9D A;  4RQ8 A;  4F5N A;  8ICE A;  2ID1 A;  8ICV A;  9ICH A;  3JPP A;  4K8V A;  3OVA A;  4PHD A;  3HJ4 A;  2VAN A;  2ZH1 A;  5HRE A;  1XSL A;  1ZQA A;  4WC7 A;  4X4N A;  2BCQ A;  7ICT A;  4KLG A;  3K7D A;  1KNY A;  4GXI A;  1YLQ A;  5CA7 A;  1XSP A;  4AT7 A;  4M9J A;  5D4B A;  2ZH4 A;  5CWR A;  5JTG A;  3B0Y A;  1ZQX A;  4IQV A;  3ISB A;  1UEU A;  1ZQL A;  4RWP A;  8ICK A;  3UXO A;  3JZ0 A;  2DRA A;  3JPT A;  4YMM A;  4QZB A;  4RQ3 A;  9ICG A;  3C5F A;  4E8F A;  2M2T A;  4WC4 A;  8ICC A;  2BPC A;  1ZQB A;  4LZG A;  4QZ8 A;  4I2A A;  4NM1 A;  2ISP A;  1UEV A;  3TFR A;  4OAF A;  4KLT A;  8ICA A;  2M2W A;  4GXJ A;  1R89 A;  4KLJ A;  5J2A A;  4RWN A;  1R8A A;  3H3A A;  3MBY A;  4LEW A;  2W9M A;  4QZE A;  4FHX A;  1VFG A;  4PHE A;  5J0W A;  2DR8 A;  1ZQK A;  3HW8 A;  4I2B A;  4XUS A;  3OGU A;  1MIV A;  4NXW A;  4RWQ A;  3RJE A;  4AT7 B;  4K97 A;  3JYY A;  5HHH A;  4MKP A;  4AT8 A;  5III A;  1ZQY A;  5CR0 A;  3LQC B;  4M9H A;  3V7L A;  2FMQ A;  3EF2 A;  1R8B A;  8ICH A;  3RH6 A;  2ZH3 A;  1TVA A;  2HN1 A;  4LEY A;  4KM5 A;  4UB3 A;  3ER8 C;  5J2G A;  4NKT A;  2ZH5 A;  4P4M A;  4PGY A;  4QZ9 A;  4MFA A;  5J0U A;  4ATB B;  4RQ6 A;  1ZQS A;  4N7R A;  3C2M A;  2O5A A;  5BPC A;  4XQ8 A;  7ICL A;  2GWS A;  1KDH A;  4WCW A;  5J2K A;  5J2F A;  3RH4 A;  4RQ2 A;  2PBE A;  3MCR A;  2BBJ A;  4E80 A;  4X4P A;  3RJF A;  3WFR E;  4QZH A;  9ICB A;  4YCX A;  1BPB A;  7ICN A;  8ICI A;  3NYB A;  3ERC C;  4EV6 A;  7ICU A;  9ICM A;  4R66 A;  2ZH8 A;  5CB1 A;  3AQM A;  3RJK A;  5B3Q A; 
#chains in the Genus database with same CATH homology
 3ISD A;  2PFN A;  4AT8 B;  4DOC A;  2IHM A;  3MDA A;  3GDX A;  7ICJ A;  4EP7 A;  4PHP A;  4MFF A;  1UET A;  5IIO A;  5J2C A;  1ZQH A;  5HRD A;  1ZJM A;  4I2I A;  4UAW A;  4UBC A;  4WC3 A;  4X4T A;  5DBC A;  4R65 A;  1JMS A;  9ICQ A;  3PNC A;  9ICK A;  1FA0 A;  1BPE A;  4I2D A;  4RQ0 A;  3AQK A;  4RPZ A;  5HRK A;  4UB1 A;  4X4O A;  4RWO A;  9ICP A;  1R8C A;  4F5Q A;  9ICV A;  3RJI A;  2BCS A;  1RZT A;  3V7J A;  9ICT A;  9ICW A;  5BOM A;  1ZQQ A;  2ZH2 A;  8ICM A;  2FMP A;  2M2U A;  7ICQ A;  2I9G A;  8ICS A;  4X5V A;  4I2G A;  5DDM A;  4NLK A;  4PPX A;  3ISC A;  8ICT A;  2FMS A;  4M2Y A;  2BCR A;  5J0S A;  4UB5 A;  5DBB A;  2PXI A;  3H39 A;  3V7K A;  3OUY B;  4F5R A;  5CJ7 A;  5J2D A;  4I2C A;  4WC1 A;  1WOT A;  4R63 A;  9ICI A;  4ATB A;  3RJG A;  2BCV A;  5DB6 A;  9ICF A;  4RPY A;  4X0B A;  2PFP A;  4FH3 A;  4PHA A;  4X4Q A;  2DVI A;  5DDY A;  4NY8 A;  1XSN A;  4NXZ A;  5DB9 A;  7ICH A;  4DO9 A;  4KLF A;  4TUP A;  8ICO A;  4FH5 A;  5DBA A;  8ICZ A;  8ICQ A;  1HUZ A;  4YMO A;  1JN3 A;  1ZQC A;  4WC2 A;  4M5D A;  2M2V A;  3JPN A;  4RPX A;  7ICP A;  4EBJ A;  5J0R A;  4O5E A;  4TUQ A;  4NLN A;  1ZJN A;  2BPF A;  4YMN A;  4MFC A;  8ICL A;  4Z6C A;  3HX0 A;  4PH5 A;  3LK9 A;  2DR9 A;  7ICF A;  4I28 A;  8ICY A;  4WBY A;  3JPS A;  3H37 A;  2ZHB A;  5HRG A;  7ICG A;  5IIL A;  1JAJ A;  9ICN A;  9ICL A;  3AQL A;  5HRL A;  5IIN A;  9ICE A;  2ZH9 A;  4AT9 B;  2BCU A;  3UPQ A;  5HRB A;  1PX5 A;  1KEJ A;  5HC9 A;  4KLL A;  3AU2 A;  5HRI A;  4M47 A;  1BPD A;  5J2E A;  4X0A A;  7ICK A;  1MIY A;  3B0X A;  1ZQT A;  2ZH7 A;  5J2B A;  4YD1 A;  1BPY A;  3C18 A;  4YD2 A;  4WC0 A;  2DR7 A;  4UAZ A;  4I29 A;  3UPS A;  4E7X A;  2HHP A;  4P4O A;  4F5O A;  9ICJ A;  4FHY A;  4WC6 A;  2P66 A;  4M04 A;  4I27 A;  3OVB A;  3OUY A;  8ICN A;  5J2J A;  4DOB A;  1ZQO A;  4KLE A;  4I2F A;  4TUR A;  1NOM A;  4I2J A;  5J29 A;  5CP2 A;  1V4A A;  2PFO A;  5TZV A;  4IQT A;  1TFW A;  4P2H A;  4PGQ A;  5J0X A;  8ICB A;  4WBZ A;  2PFQ A;  4XQ7 A;  3WFO A;  5DB7 A;  4IQU A;  5DB8 A;  7ICM A;  1Q79 A;  4Z6F A;  1ZQG A;  4QZC A;  3C5G A;  5DEC A;  3PML A;  3OVS A;  4Z6E A;  4I2E A;  1VJ7 A;  3AUO A;  4S3N A;  4FO6 A;  8ICJ A;  4K4I A;  4IG8 A;  4MF2 A;  3OV7 A;  4P4P A;  7ICI A;  4M9N A;  5IIK A;  4X4U A;  4O5C A;  4KLH A;  2Q66 A;  4QZF A;  4M0A A;  3C66 A;  3WFP A;  4O9M A;  4XA5 A;  3JPR A;  4NKU A;  5D49 A;  2O1P A;  4UD5 A;  1MQ3 A;  5J2H A;  1HUO A;  7ICV A;  4F5P A;  3RJJ A;  3UQ2 A;  1BPZ A;  4KLQ A;  4UD4 A;  1ZQD A;  4KLM A;  4UB4 A;  2BE3 A;  4AT9 A;  1F5A A;  2DR5 A;  4QZI A;  2ISO A;  1ZQW A;  3JPQ A;  3RH5 A;  5EOZ A;  9ICX A;  4R64 A;  4NLZ A;  1TFY A;  4PGX A;  5CHG A;  3PMN A;  7ICS A;  8ICF A;  1JQR A;  4GXK A;  4XRH A;  4QZG A;  4Z6D A;  1ZQF A;  4RQ4 A;  5BOL A;  3AQN A;  4M9G A;  5IIM A;  4UB2 A;  8ICR A;  1ZQU A;  4TUS A;  4IQW A;  4KLO A;  4M9L A;  1ZQN A;  3UQ0 A;  2ZHA A;  5J0P A;  4FHV A;  3C2L A;  4KLU A;  1TV9 A;  3HIY A;  5DED A;  5HRH A;  1MQ2 A;  4O5K A;  4MF8 A;  2DRB A;  1ZQV A;  4EBK A;  4RQ5 A;  4RQ7 A;  3UXP A;  2ZH6 A;  9ICC A;  1ZQZ A;  9ICS A;  4X4V A;  3MGH A;  4LVS A;  4NM2 A;  3C2K A;  9ICU A;  9ICR A;  4LT6 A;  3HWT A;  3H38 A;  8ICU A;  4YN4 A;  1MIW A;  2RFF A;  9ICA A;  4UAY A;  8ICG A;  5J0Y A;  3UXN A;  5F2V O;  2BPG A;  1ZQP A;  5HR9 A;  3RJH A;  4RT2 A;  1ZQJ A;  8ICX A;  4X4R A;  1ZQR A;  1ZQE A;  7ICO A;  1Q78 A;  5J0T A;  1ZQI A;  3WFS C;  4RT3 A;  4KLI A;  3JPO A;  7ICE A;  4K4G A;  3WFQ E;  1NO5 A;  3HJ1 A;  5J2I A;  5D46 A;  8ICW A;  3MDC A;  3V72 A;  1BPX A;  4JWM A;  4QZD A;  4KLS A;  1RPL A;  1ZQM A;  4DOA A;  4RQ1 A;  4KLD A;  4FHP A;  3K75 D;  1OU5 A;  3MGI A;  4UBB A;  4WC5 A;  5HRF A;  3TFS A;  4QZA A;  4JWN A;  9ICO A;  4LZD A;  4FHW A;  5IIJ A;  5DKW A;  4K4H A;  5HHI A;  3AU6 A;  2NRK A;  4X4S A;  7ICR A;  5J0Q A;  8ICP A;  5J0O A;  4I2H A;  3L9D A;  4RQ8 A;  4F5N A;  8ICE A;  2ID1 A;  8ICV A;  9ICH A;  3JPP A;  3OVA A;  4PHD A;  3HJ4 A;  2VAN A;  2ZH1 A;  5HRE A;  1XSL A;  1ZQA A;  4WC7 A;  4X4N A;  2BCQ A;  7ICT A;  4KLG A;  1KNY A;  4GXI A;  1YLQ A;  5CA7 A;  1XSP A;  4AT7 A;  4M9J A;  5D4B A;  2ZH4 A;  5CWR A;  3B0Y A;  1ZQX A;  4IQV A;  3ISB A;  1UEU A;  1ZQL A;  4RWP A;  8ICK A;  3UXO A;  3JZ0 A;  2DRA A;  3JPT A;  4YMM A;  4QZB A;  4RQ3 A;  9ICG A;  3C5F A;  4E8F A;  2M2T A;  4WC4 A;  8ICC A;  2BPC A;  1ZQB A;  4LZG A;  4QZ8 A;  4I2A A;  4NM1 A;  2ISP A;  1UEV A;  3TFR A;  4KLT A;  8ICA A;  2M2W A;  4GXJ A;  1R89 A;  4KLJ A;  5J2A A;  4RWN A;  1R8A A;  3H3A A;  3MBY A;  2W9M A;  4QZE A;  4FHX A;  1VFG A;  4PHE A;  5J0W A;  2DR8 A;  1ZQK A;  3HW8 A;  4I2B A;  4XUS A;  3OGU A;  1MIV A;  4RWQ A;  3RJE A;  4AT7 B;  3JYY A;  5HHH A;  4AT8 A;  5III A;  1ZQY A;  5CR0 A;  3LQC B;  4M9H A;  3V7L A;  2FMQ A;  1R8B A;  8ICH A;  3RH6 A;  2ZH3 A;  1TVA A;  4UB3 A;  5J2G A;  4NKT A;  2ZH5 A;  4P4M A;  4PGY A;  4QZ9 A;  4MFA A;  5J0U A;  4ATB B;  4RQ6 A;  1ZQS A;  3C2M A;  2O5A A;  5BPC A;  4XQ8 A;  7ICL A;  2GWS A;  1KDH A;  4WCW A;  5J2K A;  5J2F A;  3RH4 A;  4RQ2 A;  2PBE A;  4E80 A;  4X4P A;  3RJF A;  3WFR E;  4QZH A;  9ICB A;  4YCX A;  1BPB A;  7ICN A;  8ICI A;  3NYB A;  7ICU A;  9ICM A;  4R66 A;  2ZH8 A;  5CB1 A;  3AQM A;  3RJK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...