2M2WA

Ternary complex of asfv pol x with dna and mgdgtp
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
174
structure length
174
Chain Sequence
MLTLIQGKKIVNHLRSRLAFEYNGQLIKILSKNIVAVGSLRREEKMLNDVDLLIIVPEKKLLKHVLPNIRIKGLSFSVKVCGERKCVLFIEWEKKTYQLDLFTALAEEKPYAIFHFTGPVSYLIRIRAALKKKNYKLNQYGLFKNQTLVPLKITTEKELIKELGFTYRIPKKRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Repair DNA polymerase X
publication title How a low-fidelity DNA polymerase chooses non-Watson-Crick from Watson-Crick incorporation.
pubmed doi rcsb
source organism African swine fever virus
molecule tags Transferase/dna
total genus 37
structure length 174
sequence length 174
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-01-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 2m2wA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 2m2wA01
5DB9A 4PPXA 4NXZA 8ICKA 1ZQHA 4WC1A 7ICVA 1ZQBA 8ICWA 4FH5A 3WFQE 2ISOA 4FO6A 4YN4A 5HC9A 3NYBA 5IIIA 5J2HA 3RJHA 4I2BA 5J2AA 4PGQA 1ZQVA 3H37A 9ICNA 5J2DA 4MF8A 3TFSA 4RQ3A 3AQLA 4KLDA 5HRLA 2PBEA 1ZQUA 1XSNA 4QZBA 4NM1A 8ICOA 4X4QA 3OUYB 3JPOA 4NM2A 4X4UA 4I2HA 7ICHA 7ICRA 4F5RA 3MGHA 2RFFA 3C18A 4NKUA 2DRAA 5HRKA 2PFOA 3JPTA 3UXOA 4QZEA 5DBCA 4NLNA 3HIYA 1BPEA 3UPQA 4TUSA 4GXIA 4K4GA 4DOCA 5HRDA 4XQ7A 4RT3A 2ZH9A 4WC0A 3V7LA 1ZQDA 5BPCA 4KLSA 4UD5A 4PGYA 2ZH3A 7ICOA 3UQ0A 4R65A 2ID1A 3ISDA 5EOZA 4QZFA 4M47A 3WFRE 1ZQAA 5DBBA 3C2KA 3OGUA 1ZQZA 4QZIA 3UXPA 3AU6A 5DB6A 1XSPA 3PNCA 3JZ0A 4XA5A 3C66A 4UBCA 3UXNA 4XQ8A 4DOAA 4UAZA 3JYYA 2M2TA 4X5VA 1R8BA 1BPDA 1ZQRA 4FHVA 3RJJA 2BPCA 3ISBA 7ICJA 1ZQEA 1JN3A 2BE3A 4WC4A 9ICFA 1BPBA 1TFWA 5J0UA 5J0OA 1ZQCA 8ICJA 5J0TA 3AQMA 4DOBA 4JWMA 3AQNA 2HHPA 3UQ2A 7ICMA 4LVSA 4KLFA 8ICBA 7ICLA 1JAJA 5J0PA 5J2JA 2DR8A 5J2FA 1ZJMA 4YCXA 4WC2A 4UB5A 3C5GA 3OUYA 5J2KA 4X4NA 9ICMA 4EBKA 4E80A 1ZQOA 1R8AA 4I2DA 5J0XA 5IINA 2O5AA 4X4SA 8ICLA 8ICQA 2DVIA 1ZQGA 5HRIA 4UAWA 4YD1A 5HRFA 1Q79A 7ICFA 8ICHA 5J0RA 4GXKA 2ZH1A 5DB8A 4M9HA 4TUQA 2M2UA 2O1PA 5HRHA 4PH5A 9ICXA 8ICPA 2IHMA 4F5NA 7ICIA 7ICTA 5J2GA 1RZTA 3GDXA 1TVAA 4O5CA 4QZHA 4NLKA 4PHPA 7ICGA 5IIOA 4R64A 3H3AA 2ZH5A 5DDMA 4F5PA 4XUSA 4ATBB 3RJIA 1ZQXA 4X4RA 5J2IA 8ICFA 4FHPA 4FH3A 4XRHA 4YMMA 8ICMA 4X4VA 4RQ5A 4M9NA 4KLJA 9ICWA 5CB1A 2ZHAA 2DRBA 7ICSA 1V4AA 1VJ7A 3AQKA 1WOTA 1ZQYA 1ZQLA 4M9LA 2DR5A 1ZQMA 4GXJA 8ICYA 5J0QA 5HR9A 1TV9A 4QZCA 4KLLA 4RPZA 4KLUA 9ICEA 4E7XA 9ICBA 5CP2A 1JQRA 4X4TA 4IQTA 4FHWA 1PX5A 4WBYA 4EP7A 4K4IA 5J2BA 1NOMA 3RH6A 4R63A 4X4PA 1BPYA 5HRBA 8ICEA 3JPPA 4KLIA 9ICHA 5D46A 7ICEA 5DKWA 5BOLA 9ICSA 2BCQA 4P2HA 2ZH6A 8ICSA 3MBYA 4QZDA 3HWTA 4RQ8A 4YMNA 5CA7A 3HX0A 4PHDA 2ZHBA 4KLOA 2FMSA 4TUPA 4I28A 1OU5A 5J2CA 3AU2A 4IQWA 1FA0A 4PHAA 1UEVA 4Z6DA 4KLGA 4X0BA 2Q66A 2ZH4A 2DR7A 1ZQJA 4RQ2A 9ICJA 5CR0A 8ICAA 3V7KA 4I2EA 2BCRA 4AT7A 3RJEA 4MF2A 3LQCB 5F2VO 8ICZA 5D49A 1F5AA 7ICUA 2PFPA 3WFOA 4X0AA 2FMPA 4UB4A 8ICCA 3RH5A 7ICNA 4ATBA 1TFYA 4QZGA 3PMLA 4K4HA 3HJ1A 1MQ2A 5IIMA 4FHXA 1ZQFA 3OV7A 5J0YA 2M2VA 3AUOA 1ZQIA 8ICXA 4WBZA 4AT7B 4I29A 5DB7A 4UAYA 4QZ9A 3H39A 4E8FA 4O5KA 4F5OA 4MFFA 4KLTA 3JPRA 1UETA 2ZH7A 1HUZA 1ZQNA 1BPXA 4M04A 3RJGA 4EBJA 4WCWA 1KDHA 2ISPA 2P66A 4RQ7A 4I2JA 2BCVA 4RT2A 8ICRA 5D4BA 4RQ4A 1NO5A 4UB1A 5J2EA 1ZQTA 9ICVA 3V7JA 4I2IA 9ICCA 3OVSA 1KEJA 3H38A 4WC7A 4LZGA 4YD2A 3K75D 4QZAA 7ICPA 1Q78A 4I2AA 4X4OA 5IIKA 8ICVA 9ICIA 2BPFA 4M2YA 4KLMA 3L9DA 9ICKA 3WFSC 9ICPA 9ICTA 4JWNA 2FMQA 5IIJA 4WC6A 4YMOA 4P4MA 4UBBA 4MFAA 1MIYA 4TURA 2BPGA 4IG8A 4R66A 3MDAA 4I2CA 5J0WA 1R8CA 3ISCA 3HW8A 4F5QA 5IILA 3JPQA 3C2LA 4P4PA 8ICGA 4AT8A 1VFGA 4RQ6A 5HHHA 5HHIA 5CHGA 1HUOA 5CJ7A 1ZQWA 5DDYA 5DEDA 1MQ3A 3RJFA 1ZQKA 2PFNA 4KLQA 4AT9A 4M9JA 4DO9A 2GWSA 8ICIA 7ICQA 3JPNA 9ICRA 4P4OA 9ICGA 4NLZA 5BOMA 4S3NA 4M9GA 2DR9A 4IQUA 1ZQSA 1MIWA 5DBAA 4PGXA 4UB3A 1RPLA 9ICQA 5HRGA 4RWNA 2BCUA 2ZH8A 4RQ0A 4RWOA 3OVBA 4M0AA 4Z6FA 4LZDA 1JMSA 4UB2A 4AT8B 2VANA 8ICNA 2W9MA 4IQVA 1UEUA 3C5FA 4WC3A 4I27A 1ZQPA 3HJ4A 4LT6A 2PFQA 4MFCA 4AT9B 7ICKA 5DECA 8ICUA 4I2FA 9ICUA 2BCSA 4PHEA 4Z6CA 3MGIA 2ZH2A 4RPXA 3PMNA 1XSLA 5J29A 4RQ1A 5CWRA 3RH4A 4KLEA 3TFRA 3UPSA 4O5EA 3RJKA 1BPZA 2NRKA 4RWQA 3B0YA 4I2GA 1MIVA 9ICLA 4WC5A 4FHYA 2PXIA 1KNYA 4M5DA 5TZVA 3LK9A 3JPSA 3MDCA 8ICTA 5HREA 4Z6EA 3B0XA 4O9MA 4NKTA 4RPYA 9ICOA 3WFPA 3OVAA 2I9GA 3V72A 9ICAA 4UD4A 4QZ8A 4RWPA 1ZJNA 1ZQQA 4NY8A 1YLQA 1R89A 4KLHA 2M2WA 3C2MA 5J0SA
chains in the Genus database with same CATH superfamily
5DB9A 4PPXA 4NXZA 8ICKA 1ZQHA 4NXXA 4WC1A 7ICVA 4I0UA 1ZQBA 8ICWA 4FH5A 5D63A 3WFQE 2ISOA 4K96A 4FO6A 4YN4A 5HC9A 3NYBA 5IIIA 5J2HA 3RJHA 4I2BA 5J2AA 4PGQA 2BBHA 2HN2A 1ZQVA 3H37A 9ICNA 4K8VA 5J2DA 4MF8A 3TFSA 4RQ3A 3AQLA 4KLDA 5HRLA 2PBEA 1ZQUA 1XSNA 4QZBA 4NM1A 8ICOA 4X4QA 3OUYB 3JPOA 4NM2A 4O69A 4X4UA 4I2HA 7ICHA 7ICRA 3JCFA 4F5RA 3MGHA 2RFFA 3C18A 4NKUA 4O6AA 5HRKA 2DRAA 2PFOA 3JPTA 3UXOA 4QZEA 5DBCA 4NLNA 2EWRA 3HIYA 1BPEA 2GAFD 3UPQA 4TUSA 4GXIA 4K4GA 4DOCA 4K99A 5HRDA 4LEWA 4OAFA 3ER8C 4XQ7A 4RT3A 2ZH9A 4WC0A 3V7LA 1ZQDA 5BPCA 4LEVA 4KLSA 4UD5A 4PGYA 2ZH3A 7ICOA 3UQ0A 4R65A 2ID1A 3ISDA 5EOZA 4QZFA 4M47A 4LEZA 3WFRE 1ZQAA 5DBBA 3C2KA 3OGUA 1GPJA 1ZQZA 4QZIA 3UXPA 3AU6A 5DB6A 3CK6A 1XSPA 3PNCA 3JZ0A 4NXWA 4XA5A 3C66A 4UBCA 3UXNA 4XQ8A 4DOAA 2B4VA 4UAZA 4NXTA 3JYYA 4EEDA 2M2TA 4X5VA 1R8BA 1BPDA 1ZQRA 4FHVA 3RJJA 2BPCA 3ISBA 7ICJA 1ZQEA 1JN3A 2BE3A 4WC4A 9ICFA 1BPBA 1TFWA 5J0UA 5J0OA 1ZQCA 8ICJA 5J0TA 3AQMA 4DOBA 4JWMA 3AQNA 2HHPA 3UQ2A 7ICMA 4LVSA 4KLFA 8ICBA 7ICLA 1JAJA 5J0PA 3ER9B 5J2JA 2DR8A 5J2FA 1ZJMA 4YCXA 4WC2A 4UB5A 3C5GA 3OUYA 5J2KA 4X4NA 9ICMA 4EBKA 4E80A 1ZQOA 1R8AA 4I2DA 5J0XA 5IINA 2O5AA 4X4SA 8ICLA 8ICQA 2DVIA 1ZQGA 5HRIA 4NXUA 4UAWA 4YD1A 5HRFA 1Q79A 7ICFA 8ICHA 5J0RA 4GXKA 2ZH1A 5DB8A 3OWGA 4M9HA 4TUQA 2M2UA 2O1PA 5HRHA 4PH5A 4JLXA 9ICXA 8ICPA 2IHMA 4F5NA 7ICIA 7ICTA 5J2GA 1RZTA 3GDXA 1TVAA 4O5CA 4QZHA 4NLKA 4PHPA 7ICGA 5IIOA 2B56A 4R64A 3H3AA 2ZH5A 5DDMA 5D61A 4F5PA 4XUSA 4ATBB 3RJIA 1ZQXA 4X4RA 5D62A 5J2IA 8ICFA 4FHPA 4FH3A 4XRHA 4YMMA 8ICMA 4X4VA 4RQ5A 4KB6A 4M9NA 4KLJA 9ICWA 5CB1A 2ZHAA 2DRBA 7ICSA 1V4AA 1VJ7A 3AQKA 3ERCC 1WOTA 1ZQYA 4NXVA 1ZQLA 4M9LA 2DR5A 1ZQMA 4GXJA 4O67A 8ICYA 5B3PA 5J0QA 5HR9A 4HX0A 1TV9A 4QZCA 4KLLA 4RPZA 4KLUA 4WH5A 9ICEA 4E7XA 9ICBA 5CP2A 1JQRA 4X4TA 5CFUA 4IQTA 4FHWA 1PX5A 4WBYA 4EP7A 4K4IA 5J2BA 1NOMA 3RH6A 4R63A 4X4PA 1BPYA 5HRBA 8ICEA 3JPPA 4KLIA 9ICHA 5D46A 7ICEA 5DKWA 5BOLA 9ICSA 2BCQA 4P2HA 2ZH6A 8ICSA 3MBYA 4QZDA 3HWTA 4FO1A 4RQ8A 5B3QA 4YMNA 5CA7A 3HX0A 2B51A 4PHDA 2ZHBA 4KLOA 2FMSA 4OAHA 4TUPA 4I28A 1OU5A 5J2CA 3AU2A 4IQWA 4WOYA 1FA0A 4PHAA 1UEVA 4Z6DA 4KLGA 4X0BA 4EEBA 2Q66A 2ZH4A 2DR7A 1ZQJA 4RQ2A 9ICJA 5CR0A 8ICAA 3V7KA 4I2EA 2BCRA 4WQLA 3RJEA 4AT7A 4MF2A 3LQCB 5F2VO 8ICZA 5D49A 1F5AA 7ICUA 2PFPA 4XJEA 3WFOA 3NKUA 4X0AA 2FMPA 4UB4A 2BBJA 8ICCA 3RH5A 7ICNA 4ATBA 1TFYA 4QZGA 3PMLA 2HN1A 4K4HA 3HJ1A 1MQ2A 5IIMA 4EV6A 4FHXA 1ZQFA 3OV7A 5J0YA 2M2VA 3AUOA 1ZQIA 4JLZA 8ICXA 4WBZA 4AT7B 4K98A 4I29A 5DB7A 4UAYA 5CHEA 4LEYA 4QZ9A 3H39A 4E8FA 4O5KA 3K7DA 4F5OA 4MFFA 4KLTA 3JPRA 1UETA 2ZH7A 1HUZA 1ZQNA 4EGWA 1BPXA 4M04A 3RJGA 4EBJA 4WCWA 1KDHA 2ISPA 2P66A 5JTGA 3PHZA 4RQ7A 4WQKA 4I2JA 2BCVA 4RT2A 8ICRA 5D4BA 4RQ4A 1NO5A 4UB1A 5J2EA 1ZQTA 9ICVA 3V7JA 4I2IA 9ICCA 3OVSA 1KEJA 3H38A 4WC7A 4LZGA 4YD2A 3K75D 4QZAA 4O68A 7ICPA 1Q78A 4I2AA 4MKPA 4X4OA 5IIKA 3EF2A 8ICVA 9ICIA 2BPFA 4M2YA 4KLMA 3L9DA 9ICKA 3WFSC 9ICPA 3NWIA 9ICTA 4K9AA 4JWNA 2FMQA 5IIJA 4WC6A 4YMOA 4P4MA 4UBBA 4MFAA 1MIYA 4TURA 2BPGA 4IG8A 4R66A 3MDAA 4I2CA 5J0WA 1R8CA 3ISCA 2IHOA 3HW8A 4F5QA 5IILA 3JPQA 3C2LA 4P4PA 8ICGA 2GA9D 4AT8A 1VFGA 4RQ6A 5HHHA 4OAGA 5HHIA 5CHGA 1HUOA 4K97A 5CJ7A 1ZQWA 5DDYA 5DEDA 1MQ3A 3RJFA 1ZQKA 2PFNA 4KLQA 4AT9A 4M9JA 4DO9A 2GWSA 8ICIA 7ICQA 3MCRA 3JPNA 4KM5A 9ICRA 4P4OA 9ICGA 4NLZA 5BOMA 4S3NA 4M9GA 2DR9A 4IQUA 1ZQSA 1MIWA 5DBAA 4PGXA 4UB3A 1RPLA 9ICQA 5CFSA 5HRGA 4RWNA 2IUBA 2BCUA 2ZH8A 4RQ0A 4RWOA 3OVBA 4M0AA 4Z6FA 4LZDA 5CFTA 1JMSA 4UB2A 4AT8B 2VANA 8ICNA 2W9MA 4IQVA 1UEUA 3C5FA 4WC3A 4I27A 1ZQPA 3HJ4A 4LT6A 2PFQA 4MFCA 4AT9B 7ICKA 5DECA 8ICUA 4I2FA 9ICUA 2BCSA 4PHEA 4Z6CA 3MGIA 4K9BA 2ZH2A 4RPXA 3PMNA 1XSLA 5J29A 4RQ1A 5CWRA 3RH4A 4KLEA 3TFRA 3UPSA 4O5EA 3RJKA 1BPZA 2NRKA 4RWQA 3B0YA 4I2GA 1MIVA 9ICLA 4WC5A 4FHYA 2PXIA 1KNYA 4M5DA 5TZVA 3LK9A 4N7RA 3JPSA 3MDCA 8ICTA 2FCLA 5HREA 4Z6EA 3B0XA 4O9MA 4NKTA 4RPYA 9ICOA 3WFPA 3NVOA 3OVAA 2I9GA 3V72A 9ICAA 4UD4A 4QZ8A 4RWPA 1ZJNA 1ZQQA 4NY8A 1YLQA 4OAIZ 1R89A 4KLHA 2M2WA 3C2MA 5J0SA
chains in the Genus database with same CATH topology
5DB9A 4PPXA 4NXZA 8ICKA 1ZQHA 4WC1A 7ICVA 1ZQBA 8ICWA 4FH5A 3WFQE 2ISOA 4FO6A 4YN4A 5HC9A 3NYBA 5IIIA 5J2HA 3RJHA 4I2BA 5J2AA 4PGQA 1ZQVA 3H37A 9ICNA 5J2DA 4MF8A 3TFSA 4RQ3A 3AQLA 4KLDA 5HRLA 2PBEA 1ZQUA 1XSNA 4QZBA 4NM1A 8ICOA 4X4QA 3OUYB 3JPOA 4NM2A 4X4UA 4I2HA 7ICHA 7ICRA 4F5RA 3MGHA 2RFFA 3C18A 4NKUA 2DRAA 5HRKA 2PFOA 3JPTA 3UXOA 4QZEA 5DBCA 4NLNA 3HIYA 1BPEA 3UPQA 4TUSA 4GXIA 4K4GA 4DOCA 5HRDA 4XQ7A 4RT3A 2ZH9A 4WC0A 3V7LA 1ZQDA 5BPCA 4KLSA 4UD5A 4PGYA 2ZH3A 7ICOA 3UQ0A 4R65A 2ID1A 3ISDA 5EOZA 4QZFA 4M47A 3WFRE 1ZQAA 5DBBA 3C2KA 3OGUA 1ZQZA 4QZIA 3UXPA 3AU6A 5DB6A 1XSPA 3PNCA 3JZ0A 4XA5A 3C66A 4UBCA 3UXNA 4XQ8A 4DOAA 4UAZA 3JYYA 2M2TA 4X5VA 1R8BA 1BPDA 1ZQRA 4FHVA 3RJJA 2BPCA 3ISBA 7ICJA 1ZQEA 1JN3A 2BE3A 4WC4A 9ICFA 1BPBA 1TFWA 5J0UA 5J0OA 1ZQCA 8ICJA 5J0TA 3AQMA 4DOBA 4JWMA 3AQNA 2HHPA 3UQ2A 7ICMA 4LVSA 4KLFA 8ICBA 7ICLA 1JAJA 5J0PA 5J2JA 2DR8A 5J2FA 1ZJMA 4YCXA 4WC2A 4UB5A 3C5GA 3OUYA 5J2KA 4X4NA 9ICMA 4EBKA 4E80A 1ZQOA 1R8AA 4I2DA 5J0XA 5IINA 2O5AA 4X4SA 8ICLA 8ICQA 2DVIA 1ZQGA 5HRIA 4UAWA 4YD1A 5HRFA 1Q79A 7ICFA 8ICHA 5J0RA 4GXKA 2ZH1A 5DB8A 4M9HA 4TUQA 2M2UA 2O1PA 5HRHA 4PH5A 9ICXA 8ICPA 2IHMA 4F5NA 7ICIA 7ICTA 5J2GA 1RZTA 3GDXA 1TVAA 4O5CA 4QZHA 4NLKA 4PHPA 7ICGA 5IIOA 4R64A 3H3AA 2ZH5A 5DDMA 4F5PA 4XUSA 4ATBB 3RJIA 1ZQXA 4X4RA 5J2IA 8ICFA 4FHPA 4FH3A 4XRHA 4YMMA 8ICMA 4X4VA 4RQ5A 4M9NA 4KLJA 9ICWA 5CB1A 2ZHAA 2DRBA 7ICSA 1V4AA 1VJ7A 3AQKA 1WOTA 1ZQYA 1ZQLA 4M9LA 2DR5A 1ZQMA 4GXJA 8ICYA 5J0QA 5HR9A 1TV9A 4QZCA 4KLLA 4RPZA 4KLUA 9ICEA 4E7XA 9ICBA 5CP2A 1JQRA 4X4TA 4IQTA 4FHWA 1PX5A 4WBYA 4EP7A 4K4IA 5J2BA 1NOMA 3RH6A 4R63A 4X4PA 1BPYA 5HRBA 8ICEA 3JPPA 4KLIA 9ICHA 5D46A 7ICEA 5DKWA 5BOLA 9ICSA 2BCQA 4P2HA 2ZH6A 8ICSA 3MBYA 4QZDA 3HWTA 4RQ8A 4YMNA 5CA7A 3HX0A 4PHDA 2ZHBA 4KLOA 2FMSA 4TUPA 4I28A 1OU5A 5J2CA 3AU2A 4IQWA 1FA0A 4PHAA 1UEVA 4Z6DA 4KLGA 4X0BA 2Q66A 2ZH4A 2DR7A 1ZQJA 4RQ2A 9ICJA 5CR0A 8ICAA 3V7KA 4I2EA 2BCRA 4AT7A 3RJEA 4MF2A 3LQCB 5F2VO 8ICZA 5D49A 1F5AA 7ICUA 2PFPA 3WFOA 4X0AA 2FMPA 4UB4A 8ICCA 3RH5A 7ICNA 4ATBA 1TFYA 4QZGA 3PMLA 4K4HA 3HJ1A 1MQ2A 5IIMA 4FHXA 1ZQFA 3OV7A 5J0YA 2M2VA 3AUOA 1ZQIA 8ICXA 4WBZA 4AT7B 4I29A 5DB7A 4UAYA 4QZ9A 3H39A 4E8FA 4O5KA 4F5OA 4MFFA 4KLTA 3JPRA 1UETA 2ZH7A 1HUZA 1ZQNA 1BPXA 4M04A 3RJGA 4EBJA 4WCWA 1KDHA 2ISPA 2P66A 4RQ7A 4I2JA 2BCVA 4RT2A 8ICRA 5D4BA 4RQ4A 1NO5A 4UB1A 5J2EA 1ZQTA 9ICVA 3V7JA 4I2IA 9ICCA 3OVSA 1KEJA 3H38A 4WC7A 4LZGA 4YD2A 3K75D 4QZAA 7ICPA 1Q78A 4I2AA 4X4OA 5IIKA 8ICVA 9ICIA 2BPFA 4M2YA 4KLMA 3L9DA 9ICKA 3WFSC 9ICPA 9ICTA 4JWNA 2FMQA 5IIJA 4WC6A 4YMOA 4P4MA 4UBBA 4MFAA 1MIYA 4TURA 2BPGA 4IG8A 4R66A 3MDAA 4I2CA 5J0WA 1R8CA 3ISCA 3HW8A 4F5QA 5IILA 3JPQA 3C2LA 4P4PA 8ICGA 4AT8A 1VFGA 4RQ6A 5HHHA 5HHIA 5CHGA 1HUOA 5CJ7A 1ZQWA 5DDYA 5DEDA 1MQ3A 3RJFA 1ZQKA 2PFNA 4KLQA 4AT9A 4M9JA 4DO9A 2GWSA 8ICIA 7ICQA 3JPNA 9ICRA 4P4OA 9ICGA 4NLZA 5BOMA 4S3NA 4M9GA 2DR9A 4IQUA 1ZQSA 1MIWA 5DBAA 4PGXA 4UB3A 1RPLA 9ICQA 5HRGA 4RWNA 2BCUA 2ZH8A 4RQ0A 4RWOA 3OVBA 4M0AA 4Z6FA 4LZDA 1JMSA 4UB2A 4AT8B 2VANA 8ICNA 2W9MA 4IQVA 1UEUA 3C5FA 4WC3A 4I27A 1ZQPA 3HJ4A 4LT6A 2PFQA 4MFCA 4AT9B 7ICKA 5DECA 8ICUA 4I2FA 9ICUA 2BCSA 4PHEA 4Z6CA 3MGIA 2ZH2A 4RPXA 3PMNA 1XSLA 5J29A 4RQ1A 5CWRA 3RH4A 4KLEA 3TFRA 3UPSA 4O5EA 3RJKA 1BPZA 2NRKA 4RWQA 3B0YA 4I2GA 1MIVA 9ICLA 4WC5A 4FHYA 2PXIA 1KNYA 4M5DA 5TZVA 3LK9A 3JPSA 3MDCA 8ICTA 5HREA 4Z6EA 3B0XA 4O9MA 4NKTA 4RPYA 9ICOA 3WFPA 3OVAA 2I9GA 3V72A 9ICAA 4UD4A 4QZ8A 4RWPA 1ZJNA 1ZQQA 4NY8A 1YLQA 1R89A 4KLHA 2M2WA 3C2MA 5J0SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DB9 A;  4PPX A;  4NXZ A;  8ICK A;  1ZQH A;  4WC1 A;  7ICV A;  1ZQB A;  8ICW A;  4FH5 A;  3WFQ E;  2ISO A;  4FO6 A;  4YN4 A;  5HC9 A;  3NYB A;  5III A;  5J2H A;  3RJH A;  4I2B A;  5J2A A;  4PGQ A;  1ZQV A;  3H37 A;  9ICN A;  5J2D A;  4MF8 A;  3TFS A;  4RQ3 A;  3AQL A;  4KLD A;  5HRL A;  2PBE A;  1ZQU A;  1XSN A;  4QZB A;  4NM1 A;  8ICO A;  4X4Q A;  3OUY B;  3JPO A;  4NM2 A;  4X4U A;  4I2H A;  7ICH A;  7ICR A;  4F5R A;  3MGH A;  2RFF A;  3C18 A;  4NKU A;  2DRA A;  5HRK A;  2PFO A;  3JPT A;  3UXO A;  4QZE A;  5DBC A;  4NLN A;  3HIY A;  1BPE A;  3UPQ A;  4TUS A;  4GXI A;  4K4G A;  4DOC A;  5HRD A;  4XQ7 A;  4RT3 A;  2ZH9 A;  4WC0 A;  3V7L A;  1ZQD A;  5BPC A;  4KLS A;  4UD5 A;  4PGY A;  2ZH3 A;  7ICO A;  3UQ0 A;  4R65 A;  2ID1 A;  3ISD A;  5EOZ A;  4QZF A;  4M47 A;  3WFR E;  1ZQA A;  5DBB A;  3C2K A;  3OGU A;  1ZQZ A;  4QZI A;  3UXP A;  3AU6 A;  5DB6 A;  1XSP A;  3PNC A;  3JZ0 A;  4XA5 A;  3C66 A;  4UBC A;  3UXN A;  4XQ8 A;  4DOA A;  4UAZ A;  3JYY A;  2M2T A;  4X5V A;  1R8B A;  1BPD A;  1ZQR A;  4FHV A;  3RJJ A;  2BPC A;  3ISB A;  7ICJ A;  1ZQE A;  1JN3 A;  2BE3 A;  4WC4 A;  9ICF A;  1BPB A;  1TFW A;  5J0U A;  5J0O A;  1ZQC A;  8ICJ A;  5J0T A;  3AQM A;  4DOB A;  4JWM A;  3AQN A;  2HHP A;  3UQ2 A;  7ICM A;  4LVS A;  4KLF A;  8ICB A;  7ICL A;  1JAJ A;  5J0P A;  5J2J A;  2DR8 A;  5J2F A;  1ZJM A;  4YCX A;  4WC2 A;  4UB5 A;  3C5G A;  3OUY A;  5J2K A;  4X4N A;  9ICM A;  4EBK A;  4E80 A;  1ZQO A;  1R8A A;  4I2D A;  5J0X A;  5IIN A;  2O5A A;  4X4S A;  8ICL A;  8ICQ A;  2DVI A;  1ZQG A;  5HRI A;  4UAW A;  4YD1 A;  5HRF A;  1Q79 A;  7ICF A;  8ICH A;  5J0R A;  4GXK A;  2ZH1 A;  5DB8 A;  4M9H A;  4TUQ A;  2M2U A;  2O1P A;  5HRH A;  4PH5 A;  9ICX A;  8ICP A;  2IHM A;  4F5N A;  7ICI A;  7ICT A;  5J2G A;  1RZT A;  3GDX A;  1TVA A;  4O5C A;  4QZH A;  4NLK A;  4PHP A;  7ICG A;  5IIO A;  4R64 A;  3H3A A;  2ZH5 A;  5DDM A;  4F5P A;  4XUS A;  4ATB B;  3RJI A;  1ZQX A;  4X4R A;  5J2I A;  8ICF A;  4FHP A;  4FH3 A;  4XRH A;  4YMM A;  8ICM A;  4X4V A;  4RQ5 A;  4M9N A;  4KLJ A;  9ICW A;  5CB1 A;  2ZHA A;  2DRB A;  7ICS A;  1V4A A;  1VJ7 A;  3AQK A;  1WOT A;  1ZQY A;  1ZQL A;  4M9L A;  2DR5 A;  1ZQM A;  4GXJ A;  8ICY A;  5J0Q A;  5HR9 A;  1TV9 A;  4QZC A;  4KLL A;  4RPZ A;  4KLU A;  9ICE A;  4E7X A;  9ICB A;  5CP2 A;  1JQR A;  4X4T A;  4IQT A;  4FHW A;  1PX5 A;  4WBY A;  4EP7 A;  4K4I A;  5J2B A;  1NOM A;  3RH6 A;  4R63 A;  4X4P A;  1BPY A;  5HRB A;  8ICE A;  3JPP A;  4KLI A;  9ICH A;  5D46 A;  7ICE A;  5DKW A;  5BOL A;  9ICS A;  2BCQ A;  4P2H A;  2ZH6 A;  8ICS A;  3MBY A;  4QZD A;  3HWT A;  4RQ8 A;  4YMN A;  5CA7 A;  3HX0 A;  4PHD A;  2ZHB A;  4KLO A;  2FMS A;  4TUP A;  4I28 A;  1OU5 A;  5J2C A;  3AU2 A;  4IQW A;  1FA0 A;  4PHA A;  1UEV A;  4Z6D A;  4KLG A;  4X0B A;  2Q66 A;  2ZH4 A;  2DR7 A;  1ZQJ A;  4RQ2 A;  9ICJ A;  5CR0 A;  8ICA A;  3V7K A;  4I2E A;  2BCR A;  4AT7 A;  3RJE A;  4MF2 A;  3LQC B;  5F2V O;  8ICZ A;  5D49 A;  1F5A A;  7ICU A;  2PFP A;  3WFO A;  4X0A A;  2FMP A;  4UB4 A;  8ICC A;  3RH5 A;  7ICN A;  4ATB A;  1TFY A;  4QZG A;  3PML A;  4K4H A;  3HJ1 A;  1MQ2 A;  5IIM A;  4FHX A;  1ZQF A;  3OV7 A;  5J0Y A;  2M2V A;  3AUO A;  1ZQI A;  8ICX A;  4WBZ A;  4AT7 B;  4I29 A;  5DB7 A;  4UAY A;  4QZ9 A;  3H39 A;  4E8F A;  4O5K A;  4F5O A;  4MFF A;  4KLT A;  3JPR A;  1UET A;  2ZH7 A;  1HUZ A;  1ZQN A;  1BPX A;  4M04 A;  3RJG A;  4EBJ A;  4WCW A;  1KDH A;  2ISP A;  2P66 A;  4RQ7 A;  4I2J A;  2BCV A;  4RT2 A;  8ICR A;  5D4B A;  4RQ4 A;  1NO5 A;  4UB1 A;  5J2E A;  1ZQT A;  9ICV A;  3V7J A;  4I2I A;  9ICC A;  3OVS A;  1KEJ A;  3H38 A;  4WC7 A;  4LZG A;  4YD2 A;  3K75 D;  4QZA A;  7ICP A;  1Q78 A;  4I2A A;  4X4O A;  5IIK A;  8ICV A;  9ICI A;  2BPF A;  4M2Y A;  4KLM A;  3L9D A;  9ICK A;  3WFS C;  9ICP A;  9ICT A;  4JWN A;  2FMQ A;  5IIJ A;  4WC6 A;  4YMO A;  4P4M A;  4UBB A;  4MFA A;  1MIY A;  4TUR A;  2BPG A;  4IG8 A;  4R66 A;  3MDA A;  4I2C A;  5J0W A;  1R8C A;  3ISC A;  3HW8 A;  4F5Q A;  5IIL A;  3JPQ A;  3C2L A;  4P4P A;  8ICG A;  4AT8 A;  1VFG A;  4RQ6 A;  5HHH A;  5HHI A;  5CHG A;  1HUO A;  5CJ7 A;  1ZQW A;  5DDY A;  5DED A;  1MQ3 A;  3RJF A;  1ZQK A;  2PFN A;  4KLQ A;  4AT9 A;  4M9J A;  4DO9 A;  2GWS A;  8ICI A;  7ICQ A;  3JPN A;  9ICR A;  4P4O A;  9ICG A;  4NLZ A;  5BOM A;  4S3N A;  4M9G A;  2DR9 A;  4IQU A;  1ZQS A;  1MIW A;  5DBA A;  4PGX A;  4UB3 A;  1RPL A;  9ICQ A;  5HRG A;  4RWN A;  2BCU A;  2ZH8 A;  4RQ0 A;  4RWO A;  3OVB A;  4M0A A;  4Z6F A;  4LZD A;  1JMS A;  4UB2 A;  4AT8 B;  2VAN A;  8ICN A;  2W9M A;  4IQV A;  1UEU A;  3C5F A;  4WC3 A;  4I27 A;  1ZQP A;  3HJ4 A;  4LT6 A;  2PFQ A;  4MFC A;  4AT9 B;  7ICK A;  5DEC A;  8ICU A;  4I2F A;  9ICU A;  2BCS A;  4PHE A;  4Z6C A;  3MGI A;  2ZH2 A;  4RPX A;  3PMN A;  1XSL A;  5J29 A;  4RQ1 A;  5CWR A;  3RH4 A;  4KLE A;  3TFR A;  3UPS A;  4O5E A;  3RJK A;  1BPZ A;  2NRK A;  4RWQ A;  3B0Y A;  4I2G A;  1MIV A;  9ICL A;  4WC5 A;  4FHY A;  2PXI A;  1KNY A;  4M5D A;  5TZV A;  3LK9 A;  3JPS A;  3MDC A;  8ICT A;  5HRE A;  4Z6E A;  3B0X A;  4O9M A;  4NKT A;  4RPY A;  9ICO A;  3WFP A;  3OVA A;  2I9G A;  3V72 A;  9ICA A;  4UD4 A;  4QZ8 A;  4RWP A;  1ZJN A;  1ZQQ A;  4NY8 A;  1YLQ A;  1R89 A;  4KLH A;  2M2W A;  3C2M A;  5J0S A; 
#chains in the Genus database with same CATH topology
 5DB9 A;  4PPX A;  4NXZ A;  8ICK A;  1ZQH A;  4NXX A;  4WC1 A;  7ICV A;  4I0U A;  1ZQB A;  8ICW A;  4FH5 A;  5D63 A;  3WFQ E;  2ISO A;  4K96 A;  4FO6 A;  4YN4 A;  5HC9 A;  3NYB A;  5III A;  5J2H A;  3RJH A;  4I2B A;  5J2A A;  4PGQ A;  2BBH A;  2HN2 A;  1ZQV A;  3H37 A;  9ICN A;  4K8V A;  5J2D A;  4MF8 A;  3TFS A;  4RQ3 A;  3AQL A;  4KLD A;  5HRL A;  2PBE A;  1ZQU A;  1XSN A;  4QZB A;  4NM1 A;  8ICO A;  4X4Q A;  3OUY B;  3JPO A;  4NM2 A;  4O69 A;  4X4U A;  4I2H A;  7ICH A;  7ICR A;  3JCF A;  4F5R A;  3MGH A;  2RFF A;  3C18 A;  4NKU A;  4O6A A;  5HRK A;  2DRA A;  2PFO A;  3JPT A;  3UXO A;  4QZE A;  5DBC A;  4NLN A;  2EWR A;  3HIY A;  1BPE A;  2GAF D;  3UPQ A;  4TUS A;  4GXI A;  4K4G A;  4DOC A;  4K99 A;  5HRD A;  4LEW A;  4OAF A;  3ER8 C;  4XQ7 A;  4RT3 A;  2ZH9 A;  4WC0 A;  3V7L A;  1ZQD A;  5BPC A;  4LEV A;  4KLS A;  4UD5 A;  4PGY A;  2ZH3 A;  7ICO A;  3UQ0 A;  4R65 A;  2ID1 A;  3ISD A;  5EOZ A;  4QZF A;  4M47 A;  4LEZ A;  3WFR E;  1ZQA A;  5DBB A;  3C2K A;  3OGU A;  1GPJ A;  1ZQZ A;  4QZI A;  3UXP A;  3AU6 A;  5DB6 A;  3CK6 A;  1XSP A;  3PNC A;  3JZ0 A;  4NXW A;  4XA5 A;  3C66 A;  4UBC A;  3UXN A;  4XQ8 A;  4DOA A;  2B4V A;  4UAZ A;  4NXT A;  3JYY A;  4EED A;  2M2T A;  4X5V A;  1R8B A;  1BPD A;  1ZQR A;  4FHV A;  3RJJ A;  2BPC A;  3ISB A;  7ICJ A;  1ZQE A;  1JN3 A;  2BE3 A;  4WC4 A;  9ICF A;  1BPB A;  1TFW A;  5J0U A;  5J0O A;  1ZQC A;  8ICJ A;  5J0T A;  3AQM A;  4DOB A;  4JWM A;  3AQN A;  2HHP A;  3UQ2 A;  7ICM A;  4LVS A;  4KLF A;  8ICB A;  7ICL A;  1JAJ A;  5J0P A;  3ER9 B;  5J2J A;  2DR8 A;  5J2F A;  1ZJM A;  4YCX A;  4WC2 A;  4UB5 A;  3C5G A;  3OUY A;  5J2K A;  4X4N A;  9ICM A;  4EBK A;  4E80 A;  1ZQO A;  1R8A A;  4I2D A;  5J0X A;  5IIN A;  2O5A A;  4X4S A;  8ICL A;  8ICQ A;  2DVI A;  1ZQG A;  5HRI A;  4NXU A;  4UAW A;  4YD1 A;  5HRF A;  1Q79 A;  7ICF A;  8ICH A;  5J0R A;  4GXK A;  2ZH1 A;  5DB8 A;  3OWG A;  4M9H A;  4TUQ A;  2M2U A;  2O1P A;  5HRH A;  4PH5 A;  4JLX A;  9ICX A;  8ICP A;  2IHM A;  4F5N A;  7ICI A;  7ICT A;  5J2G A;  1RZT A;  3GDX A;  1TVA A;  4O5C A;  4QZH A;  4NLK A;  4PHP A;  7ICG A;  5IIO A;  2B56 A;  4R64 A;  3H3A A;  2ZH5 A;  5DDM A;  5D61 A;  4F5P A;  4XUS A;  4ATB B;  3RJI A;  1ZQX A;  4X4R A;  5D62 A;  5J2I A;  8ICF A;  4FHP A;  4FH3 A;  4XRH A;  4YMM A;  8ICM A;  4X4V A;  4RQ5 A;  4KB6 A;  4M9N A;  4KLJ A;  9ICW A;  5CB1 A;  2ZHA A;  2DRB A;  7ICS A;  1V4A A;  1VJ7 A;  3AQK A;  3ERC C;  1WOT A;  1ZQY A;  4NXV A;  1ZQL A;  4M9L A;  2DR5 A;  1ZQM A;  4GXJ A;  4O67 A;  8ICY A;  5B3P A;  5J0Q A;  5HR9 A;  4HX0 A;  1TV9 A;  4QZC A;  4KLL A;  4RPZ A;  4KLU A;  4WH5 A;  9ICE A;  4E7X A;  9ICB A;  5CP2 A;  1JQR A;  4X4T A;  5CFU A;  4IQT A;  4FHW A;  1PX5 A;  4WBY A;  4EP7 A;  4K4I A;  5J2B A;  1NOM A;  3RH6 A;  4R63 A;  4X4P A;  1BPY A;  5HRB A;  8ICE A;  3JPP A;  4KLI A;  9ICH A;  5D46 A;  7ICE A;  5DKW A;  5BOL A;  9ICS A;  2BCQ A;  4P2H A;  2ZH6 A;  8ICS A;  3MBY A;  4QZD A;  3HWT A;  4FO1 A;  4RQ8 A;  5B3Q A;  4YMN A;  5CA7 A;  3HX0 A;  2B51 A;  4PHD A;  2ZHB A;  4KLO A;  2FMS A;  4OAH A;  4TUP A;  4I28 A;  1OU5 A;  5J2C A;  3AU2 A;  4IQW A;  4WOY A;  1FA0 A;  4PHA A;  1UEV A;  4Z6D A;  4KLG A;  4X0B A;  4EEB A;  2Q66 A;  2ZH4 A;  2DR7 A;  1ZQJ A;  4RQ2 A;  9ICJ A;  5CR0 A;  8ICA A;  3V7K A;  4I2E A;  2BCR A;  4WQL A;  3RJE A;  4AT7 A;  4MF2 A;  3LQC B;  5F2V O;  8ICZ A;  5D49 A;  1F5A A;  7ICU A;  2PFP A;  4XJE A;  3WFO A;  3NKU A;  4X0A A;  2FMP A;  4UB4 A;  2BBJ A;  8ICC A;  3RH5 A;  7ICN A;  4ATB A;  1TFY A;  4QZG A;  3PML A;  2HN1 A;  4K4H A;  3HJ1 A;  1MQ2 A;  5IIM A;  4EV6 A;  4FHX A;  1ZQF A;  3OV7 A;  5J0Y A;  2M2V A;  3AUO A;  1ZQI A;  4JLZ A;  8ICX A;  4WBZ A;  4AT7 B;  4K98 A;  4I29 A;  5DB7 A;  4UAY A;  5CHE A;  4LEY A;  4QZ9 A;  3H39 A;  4E8F A;  4O5K A;  3K7D A;  4F5O A;  4MFF A;  4KLT A;  3JPR A;  1UET A;  2ZH7 A;  1HUZ A;  1ZQN A;  4EGW A;  1BPX A;  4M04 A;  3RJG A;  4EBJ A;  4WCW A;  1KDH A;  2ISP A;  2P66 A;  5JTG A;  3PHZ A;  4RQ7 A;  4WQK A;  4I2J A;  2BCV A;  4RT2 A;  8ICR A;  5D4B A;  4RQ4 A;  1NO5 A;  4UB1 A;  5J2E A;  1ZQT A;  9ICV A;  3V7J A;  4I2I A;  9ICC A;  3OVS A;  1KEJ A;  3H38 A;  4WC7 A;  4LZG A;  4YD2 A;  3K75 D;  4QZA A;  4O68 A;  7ICP A;  1Q78 A;  4I2A A;  4MKP A;  4X4O A;  5IIK A;  3EF2 A;  8ICV A;  9ICI A;  2BPF A;  4M2Y A;  4KLM A;  3L9D A;  9ICK A;  3WFS C;  9ICP A;  3NWI A;  9ICT A;  4K9A A;  4JWN A;  2FMQ A;  5IIJ A;  4WC6 A;  4YMO A;  4P4M A;  4UBB A;  4MFA A;  1MIY A;  4TUR A;  2BPG A;  4IG8 A;  4R66 A;  3MDA A;  4I2C A;  5J0W A;  1R8C A;  3ISC A;  2IHO A;  3HW8 A;  4F5Q A;  5IIL A;  3JPQ A;  3C2L A;  4P4P A;  8ICG A;  2GA9 D;  4AT8 A;  1VFG A;  4RQ6 A;  5HHH A;  4OAG A;  5HHI A;  5CHG A;  1HUO A;  4K97 A;  5CJ7 A;  1ZQW A;  5DDY A;  5DED A;  1MQ3 A;  3RJF A;  1ZQK A;  2PFN A;  4KLQ A;  4AT9 A;  4M9J A;  4DO9 A;  2GWS A;  8ICI A;  7ICQ A;  3MCR A;  3JPN A;  4KM5 A;  9ICR A;  4P4O A;  9ICG A;  4NLZ A;  5BOM A;  4S3N A;  4M9G A;  2DR9 A;  4IQU A;  1ZQS A;  1MIW A;  5DBA A;  4PGX A;  4UB3 A;  1RPL A;  9ICQ A;  5CFS A;  5HRG A;  4RWN A;  2IUB A;  2BCU A;  2ZH8 A;  4RQ0 A;  4RWO A;  3OVB A;  4M0A A;  4Z6F A;  4LZD A;  5CFT A;  1JMS A;  4UB2 A;  4AT8 B;  2VAN A;  8ICN A;  2W9M A;  4IQV A;  1UEU A;  3C5F A;  4WC3 A;  4I27 A;  1ZQP A;  3HJ4 A;  4LT6 A;  2PFQ A;  4MFC A;  4AT9 B;  7ICK A;  5DEC A;  8ICU A;  4I2F A;  9ICU A;  2BCS A;  4PHE A;  4Z6C A;  3MGI A;  4K9B A;  2ZH2 A;  4RPX A;  3PMN A;  1XSL A;  5J29 A;  4RQ1 A;  5CWR A;  3RH4 A;  4KLE A;  3TFR A;  3UPS A;  4O5E A;  3RJK A;  1BPZ A;  2NRK A;  4RWQ A;  3B0Y A;  4I2G A;  1MIV A;  9ICL A;  4WC5 A;  4FHY A;  2PXI A;  1KNY A;  4M5D A;  5TZV A;  3LK9 A;  4N7R A;  3JPS A;  3MDC A;  8ICT A;  2FCL A;  5HRE A;  4Z6E A;  3B0X A;  4O9M A;  4NKT A;  4RPY A;  9ICO A;  3WFP A;  3NVO A;  3OVA A;  2I9G A;  3V72 A;  9ICA A;  4UD4 A;  4QZ8 A;  4RWP A;  1ZJN A;  1ZQQ A;  4NY8 A;  1YLQ A;  4OAI Z;  1R89 A;  4KLH A;  2M2W A;  3C2M A;  5J0S A; 
#chains in the Genus database with same CATH homology
 5DB9 A;  4PPX A;  4NXZ A;  8ICK A;  1ZQH A;  4WC1 A;  7ICV A;  1ZQB A;  8ICW A;  4FH5 A;  3WFQ E;  2ISO A;  4FO6 A;  4YN4 A;  5HC9 A;  3NYB A;  5III A;  5J2H A;  3RJH A;  4I2B A;  5J2A A;  4PGQ A;  1ZQV A;  3H37 A;  9ICN A;  5J2D A;  4MF8 A;  3TFS A;  4RQ3 A;  3AQL A;  4KLD A;  5HRL A;  2PBE A;  1ZQU A;  1XSN A;  4QZB A;  4NM1 A;  8ICO A;  4X4Q A;  3OUY B;  3JPO A;  4NM2 A;  4X4U A;  4I2H A;  7ICH A;  7ICR A;  4F5R A;  3MGH A;  2RFF A;  3C18 A;  4NKU A;  2DRA A;  5HRK A;  2PFO A;  3JPT A;  3UXO A;  4QZE A;  5DBC A;  4NLN A;  3HIY A;  1BPE A;  3UPQ A;  4TUS A;  4GXI A;  4K4G A;  4DOC A;  5HRD A;  4XQ7 A;  4RT3 A;  2ZH9 A;  4WC0 A;  3V7L A;  1ZQD A;  5BPC A;  4KLS A;  4UD5 A;  4PGY A;  2ZH3 A;  7ICO A;  3UQ0 A;  4R65 A;  2ID1 A;  3ISD A;  5EOZ A;  4QZF A;  4M47 A;  3WFR E;  1ZQA A;  5DBB A;  3C2K A;  3OGU A;  1ZQZ A;  4QZI A;  3UXP A;  3AU6 A;  5DB6 A;  1XSP A;  3PNC A;  3JZ0 A;  4XA5 A;  3C66 A;  4UBC A;  3UXN A;  4XQ8 A;  4DOA A;  4UAZ A;  3JYY A;  2M2T A;  4X5V A;  1R8B A;  1BPD A;  1ZQR A;  4FHV A;  3RJJ A;  2BPC A;  3ISB A;  7ICJ A;  1ZQE A;  1JN3 A;  2BE3 A;  4WC4 A;  9ICF A;  1BPB A;  1TFW A;  5J0U A;  5J0O A;  1ZQC A;  8ICJ A;  5J0T A;  3AQM A;  4DOB A;  4JWM A;  3AQN A;  2HHP A;  3UQ2 A;  7ICM A;  4LVS A;  4KLF A;  8ICB A;  7ICL A;  1JAJ A;  5J0P A;  5J2J A;  2DR8 A;  5J2F A;  1ZJM A;  4YCX A;  4WC2 A;  4UB5 A;  3C5G A;  3OUY A;  5J2K A;  4X4N A;  9ICM A;  4EBK A;  4E80 A;  1ZQO A;  1R8A A;  4I2D A;  5J0X A;  5IIN A;  2O5A A;  4X4S A;  8ICL A;  8ICQ A;  2DVI A;  1ZQG A;  5HRI A;  4UAW A;  4YD1 A;  5HRF A;  1Q79 A;  7ICF A;  8ICH A;  5J0R A;  4GXK A;  2ZH1 A;  5DB8 A;  4M9H A;  4TUQ A;  2M2U A;  2O1P A;  5HRH A;  4PH5 A;  9ICX A;  8ICP A;  2IHM A;  4F5N A;  7ICI A;  7ICT A;  5J2G A;  1RZT A;  3GDX A;  1TVA A;  4O5C A;  4QZH A;  4NLK A;  4PHP A;  7ICG A;  5IIO A;  4R64 A;  3H3A A;  2ZH5 A;  5DDM A;  4F5P A;  4XUS A;  4ATB B;  3RJI A;  1ZQX A;  4X4R A;  5J2I A;  8ICF A;  4FHP A;  4FH3 A;  4XRH A;  4YMM A;  8ICM A;  4X4V A;  4RQ5 A;  4M9N A;  4KLJ A;  9ICW A;  5CB1 A;  2ZHA A;  2DRB A;  7ICS A;  1V4A A;  1VJ7 A;  3AQK A;  1WOT A;  1ZQY A;  1ZQL A;  4M9L A;  2DR5 A;  1ZQM A;  4GXJ A;  8ICY A;  5J0Q A;  5HR9 A;  1TV9 A;  4QZC A;  4KLL A;  4RPZ A;  4KLU A;  9ICE A;  4E7X A;  9ICB A;  5CP2 A;  1JQR A;  4X4T A;  4IQT A;  4FHW A;  1PX5 A;  4WBY A;  4EP7 A;  4K4I A;  5J2B A;  1NOM A;  3RH6 A;  4R63 A;  4X4P A;  1BPY A;  5HRB A;  8ICE A;  3JPP A;  4KLI A;  9ICH A;  5D46 A;  7ICE A;  5DKW A;  5BOL A;  9ICS A;  2BCQ A;  4P2H A;  2ZH6 A;  8ICS A;  3MBY A;  4QZD A;  3HWT A;  4RQ8 A;  4YMN A;  5CA7 A;  3HX0 A;  4PHD A;  2ZHB A;  4KLO A;  2FMS A;  4TUP A;  4I28 A;  1OU5 A;  5J2C A;  3AU2 A;  4IQW A;  1FA0 A;  4PHA A;  1UEV A;  4Z6D A;  4KLG A;  4X0B A;  2Q66 A;  2ZH4 A;  2DR7 A;  1ZQJ A;  4RQ2 A;  9ICJ A;  5CR0 A;  8ICA A;  3V7K A;  4I2E A;  2BCR A;  4AT7 A;  3RJE A;  4MF2 A;  3LQC B;  5F2V O;  8ICZ A;  5D49 A;  1F5A A;  7ICU A;  2PFP A;  3WFO A;  4X0A A;  2FMP A;  4UB4 A;  8ICC A;  3RH5 A;  7ICN A;  4ATB A;  1TFY A;  4QZG A;  3PML A;  4K4H A;  3HJ1 A;  1MQ2 A;  5IIM A;  4FHX A;  1ZQF A;  3OV7 A;  5J0Y A;  2M2V A;  3AUO A;  1ZQI A;  8ICX A;  4WBZ A;  4AT7 B;  4I29 A;  5DB7 A;  4UAY A;  4QZ9 A;  3H39 A;  4E8F A;  4O5K A;  4F5O A;  4MFF A;  4KLT A;  3JPR A;  1UET A;  2ZH7 A;  1HUZ A;  1ZQN A;  1BPX A;  4M04 A;  3RJG A;  4EBJ A;  4WCW A;  1KDH A;  2ISP A;  2P66 A;  4RQ7 A;  4I2J A;  2BCV A;  4RT2 A;  8ICR A;  5D4B A;  4RQ4 A;  1NO5 A;  4UB1 A;  5J2E A;  1ZQT A;  9ICV A;  3V7J A;  4I2I A;  9ICC A;  3OVS A;  1KEJ A;  3H38 A;  4WC7 A;  4LZG A;  4YD2 A;  3K75 D;  4QZA A;  7ICP A;  1Q78 A;  4I2A A;  4X4O A;  5IIK A;  8ICV A;  9ICI A;  2BPF A;  4M2Y A;  4KLM A;  3L9D A;  9ICK A;  3WFS C;  9ICP A;  9ICT A;  4JWN A;  2FMQ A;  5IIJ A;  4WC6 A;  4YMO A;  4P4M A;  4UBB A;  4MFA A;  1MIY A;  4TUR A;  2BPG A;  4IG8 A;  4R66 A;  3MDA A;  4I2C A;  5J0W A;  1R8C A;  3ISC A;  3HW8 A;  4F5Q A;  5IIL A;  3JPQ A;  3C2L A;  4P4P A;  8ICG A;  4AT8 A;  1VFG A;  4RQ6 A;  5HHH A;  5HHI A;  5CHG A;  1HUO A;  5CJ7 A;  1ZQW A;  5DDY A;  5DED A;  1MQ3 A;  3RJF A;  1ZQK A;  2PFN A;  4KLQ A;  4AT9 A;  4M9J A;  4DO9 A;  2GWS A;  8ICI A;  7ICQ A;  3JPN A;  9ICR A;  4P4O A;  9ICG A;  4NLZ A;  5BOM A;  4S3N A;  4M9G A;  2DR9 A;  4IQU A;  1ZQS A;  1MIW A;  5DBA A;  4PGX A;  4UB3 A;  1RPL A;  9ICQ A;  5HRG A;  4RWN A;  2BCU A;  2ZH8 A;  4RQ0 A;  4RWO A;  3OVB A;  4M0A A;  4Z6F A;  4LZD A;  1JMS A;  4UB2 A;  4AT8 B;  2VAN A;  8ICN A;  2W9M A;  4IQV A;  1UEU A;  3C5F A;  4WC3 A;  4I27 A;  1ZQP A;  3HJ4 A;  4LT6 A;  2PFQ A;  4MFC A;  4AT9 B;  7ICK A;  5DEC A;  8ICU A;  4I2F A;  9ICU A;  2BCS A;  4PHE A;  4Z6C A;  3MGI A;  2ZH2 A;  4RPX A;  3PMN A;  1XSL A;  5J29 A;  4RQ1 A;  5CWR A;  3RH4 A;  4KLE A;  3TFR A;  3UPS A;  4O5E A;  3RJK A;  1BPZ A;  2NRK A;  4RWQ A;  3B0Y A;  4I2G A;  1MIV A;  9ICL A;  4WC5 A;  4FHY A;  2PXI A;  1KNY A;  4M5D A;  5TZV A;  3LK9 A;  3JPS A;  3MDC A;  8ICT A;  5HRE A;  4Z6E A;  3B0X A;  4O9M A;  4NKT A;  4RPY A;  9ICO A;  3WFP A;  3OVA A;  2I9G A;  3V72 A;  9ICA A;  4UD4 A;  4QZ8 A;  4RWP A;  1ZJN A;  1ZQQ A;  4NY8 A;  1YLQ A;  1R89 A;  4KLH A;  2M2W A;  3C2M A;  5J0S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...