4FHXA

Crystal structures of the cid1 poly (u) polymerase reveal the mechanism for utp selectivity - h336n mutant bound to mgatp
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
338
structure length
323
Chain Sequence
SHKEFTKFCYEVYNEIKISDKEFKEKRAALDTLRLCLKRISPDAELVAFGSLESGLALKNSDMDLCVLMDSRVQSDTIALQFYEELIAEGFEGKFLQRARIPIIKLTSDTKNGFGASFQCDIGFNNRLAIHNTLLLSSYTKLDARLKPMVLLVKHWAKRKQINSPYFGTLSSYGYVLMVLYYLIHVIKPPVFPNLLLSPLKQEKIVDGFDVGFDDKLEDIPPSQNYSSLGSLLHGFFRFYAYKFEPREKVVTFRRPDGYLTKQEKGWTRYILAIEDPFEISNNVGRTVSSSGLYRIRGEFMAASRLLNSRSYPIPYDSLFEEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Poly(A) RNA polymerase protein cid1
publication title Crystal structures of the Cid1 poly (U) polymerase reveal the mechanism for UTP selectivity.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transferase
total genus 106
structure length 323
sequence length 338
ec nomenclature ec 2.7.7.19: Polynucleotide adenylyltransferase.
pdb deposition date 2012-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01909 NTP_transf_2 Nucleotidyltransferase domain
A PF03828 PAP_assoc Cid1 family poly A polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.10 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain Poly(a)-polymerase, middle domain 4fhxA01
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4fhxA02
9ICOA 1BPYA 3LK9A 7ICNA 1R8CA 1VFGA 3HW8A 4AT9B 4RT2A 4NKUA 3OUYB 2DR9A 5J0OA 1ZQTA 3RH5A 4RQ8A 5HRBA 5DDMA 4X4TA 2DRBA 8ICLA 4Z6DA 3RJJA 4TUSA 1KDHA 4I29A 1UEUA 5J0QA 4YD2A 1ZQPA 4PPXA 4M2YA 4AT8A 4UAWA 5HRKA 1ZQLA 4IQUA 4WC4A 1R89A 4S3NA 3UXNA 5HRIA 5BOLA 3RJIA 1XSNA 2PFQA 1V4AA 4RPZA 4KLHA 4Z6EA 4KLIA 4AT7A 9ICTA 4XQ7A 4KLFA 4O9MA 2ZHAA 4P4PA 8ICRA 3MDCA 7ICHA 4UD4A 2RFFA 5D49A 5DB7A 1OU5A 4NLKA 4KLLA 2VANA 5DBBA 1Q79A 2GWSA 4M9HA 3AQLA 4EBJA 1ZQHA 4WC3A 7ICLA 2ID1A 5J29A 2DR7A 4F5NA 5HRHA 4AT8B 4UB2A 2BE3A 1ZQYA 2ZH6A 2BPGA 5J2CA 4XUSA 4FHPA 8ICOA 1ZQGA 3V7JA 1R8AA 4QZDA 8ICMA 7ICUA 4AT7B 2B51A 3JPOA 5D4BA 1ZQZA 4EBKA 8ICBA 4RPYA 4M5DA 3V7LA 3HWTA 2FMSA 2M2VA 4RWQA 3WFOA 4K4HA 5HRGA 5DBCA 2NRKA 4I2BA 9ICLA 3MDAA 5HREA 5J2DA 4GXKA 4LVSA 1BPZA 7ICJA 4X4OA 1TVAA 4I2AA 4GXIA 4WCWA 4PGQA 7ICQA 9ICFA 4F5QA 4KLDA 4UD5A 4WC6A 2PXIA 4RQ3A 9ICMA 5J2FA 9ICJA 5CHGA 8ICEA 4X4VA 3NYBA 3H37A 5CP2A 3GDXA 4EP7A 4F5RA 4RWOA 5IIOA 4YMMA 4O5KA 9ICKA 4LT6A 1ZQFA 4MF2A 3JPPA 1ZJMA 5J2HA 3JYYA 3AQKA 4XQ8A 5CWRA 4WC7A 3UQ2A 3B0YA 4PHDA 3WFPA 4X4PA 5EOZA 4I2HA 3UQ0A 4KLUA 5D46A 2ZH3A 7ICIA 4RQ1A 8ICWA 1MIVA 4FHXA 9ICNA 1HUZA 1KEJA 2PFPA 5DB8A 4NY8A 1ZQJA 5DB6A 4I2JA 4PGYA 1ZQMA 4K4IA 4M04A 1ZJNA 1BPEA 3C18A 4RQ7A 4KLJA 1WOTA 1JMSA 4M0AA 7ICRA 5DBAA 3ISCA 1JQRA 4WC5A 4FH5A 5BOMA 3JZ0A 4KLQA 5CR0A 5J2IA 5J0RA 4FO6A 1ZQQA 1ZQIA 5J2KA 4PHPA 4KLEA 2DR5A 5HHIA 4WC2A 7ICVA 1FA0A 4RQ0A 2P66A 4XA5A 3MGHA 3UPSA 4YN4A 4MFAA 3HIYA 4QZGA 2BCVA 8ICVA 1TFYA 4DOCA 5IINA 1RZTA 8ICTA 4F5PA 3OVBA 3V72A 4QZCA 3JPRA 3RH6A 4RQ5A 2PBEA 3OVAA 4TURA 9ICRA 1RPLA 5DB9A 5HRLA 1ZQVA 8ICFA 4TUQA 3OGUA 1F5AA 5IIMA 2BPFA 9ICUA 7ICTA 4RPXA 3AU2A 1PX5A 4QZIA 4IG8A 4RWNA 2ZH7A 2M2WA 4QZ9A 2FMPA 3H38A 8ICYA 4RT3A 5HRFA 8ICNA 7ICPA 4UB3A 4K4GA 5IIKA 5TZVA 3C2MA 9ICCA 2HHPA 5IIJA 4NM2A 5IIIA 4QZAA 3PNCA 5J2AA 4UBBA 3UXOA 2DRAA 8ICAA 1VJ7A 5HRDA 4ATBA 3HX0A 3C5FA 4JWMA 9ICBA 4X0AA 4QZBA 1BPBA 4UAZA 5DDYA 3UPQA 8ICJA 4I2IA 2Q66A 4IQTA 4QZHA 2FMQA 9ICIA 3H39A 7ICKA 4KLOA 3L9DA 4KLMA 1MQ3A 3OV7A 9ICHA 5J2BA 4YD1A 4M47A 2PFNA 4M9NA 4FHYA 4X4SA 4PH5A 2IHMA 4O5CA 3RJEA 3LQCB 4YMOA 3AUOA 2BCUA 9ICVA 9ICSA 3C66A 4X4RA 4TUPA 4ATBB 4R63A 5J0XA 4QZEA 9ICAA 4IQVA 4RWPA 4NLZA 4NM1A 4LZGA 4YCXA 3MBYA 4O5EA 4NXZA 2BCSA 4WC0A 5BPCA 5HHHA 4WBZA 1ZQDA 2ISOA 3AQNA 4XRHA 4I2EA 5J0SA 4WBYA 1HUOA 5J2EA 3HJ1A 2ZHBA 3K75D 5DKWA 4RQ4A 3RJFA 1XSLA 8ICZA 5IILA 8ICSA 8ICHA 8ICXA 8ICIA 4UB5A 4M9JA 1YLQA 3C5GA 4M9GA 1KNYA 1ZQSA 9ICEA 5J0WA 2M2TA 3C2KA 4I28A 3JPNA 1BPDA 3OVSA 4DOAA 3WFRE 4PGXA 4MF8A 2ZH2A 1Q78A 1ZQXA 5F2VO 9ICWA 4P4OA 4UAYA 3TFSA 4UBCA 4R65A 4UB1A 4PHAA 3V7KA 7ICMA 8ICPA 8ICKA 4FHWA 4E7XA 2W9MA 1MIWA 4WC1A 3RJHA 9ICQA 5J2JA 4MFFA 5J0YA 4MFCA 1ZQKA 9ICPA 1ZQAA 5CJ7A 5J2GA 3AQMA 5CB1A 4JWNA 3UXPA 1MIYA 4R64A 4KLGA 4KLTA 4X4UA 4FH3A 9ICGA 3C2LA 4X5VA 2O5AA 1UETA 5HR9A 9ICXA 4X4QA 7ICFA 4RQ6A 8ICGA 5J0TA 1JAJA 2ZH8A 1ZQNA 1ZQOA 1NOMA 2I9GA 2B4VA 4I2DA 4KLSA 1ZQCA 4F5OA 8ICCA 5DECA 1UEVA 4PHEA 2BCQA 2ISPA 3RJGA 4R66A 2ZH1A 4X0BA 2ZH9A 4P4MA 3WFQE 4IQWA 4E8FA 1ZQRA 4I2FA 3AU6A 3ISDA 1ZQWA 4QZFA 3H3AA 2BCRA 2ZH4A 4YMNA 3ISBA 3MGIA 3B0XA 4Z6CA 2DR8A 7ICGA 5DEDA 4LZDA 2M2UA 1MQ2A 3PMLA 2DVIA 1ZQUA 1BPXA 4P2HA 8ICQA 5J0UA 3WFSC 1R8BA 4QZ8A 2ZH5A 3JPQA 4DOBA 7ICEA 3JPSA 4AT9A 3PMNA 5J0PA 2O1PA 4UB4A 3OUYA 3TFRA 2B56A 5CA7A 4DO9A 1NO5A 4M9LA 4I2CA 1XSPA 1TFWA 1ZQEA 7ICOA 4X4NA 8ICUA 3JPTA 4E80A 4I2GA 4NLNA 3RH4A 4Z6FA 2BPCA 1ZQBA 2PFOA 1TV9A 7ICSA 4FHVA 4I27A 4RQ2A 4GXJA 1JN3A 5HC9A 3HJ4A 4NKTA 3RJKA
chains in the Genus database with same CATH superfamily
9ICOA 1BPYA 3LK9A 7ICNA 1R8CA 1VFGA 3HW8A 4AT9B 4RT2A 4NKUA 3OUYB 2DR9A 5CFTA 5J0OA 1ZQTA 3RH5A 4RQ8A 5HRBA 4K9BA 4X4TA 2DRBA 5DDMA 8ICLA 3NWIA 4Z6DA 3RJJA 4TUSA 1KDHA 4I29A 1UEUA 5J0QA 4YD2A 5D62A 1ZQPA 4PPXA 4M2YA 4AT8A 4UAWA 5HRKA 1ZQLA 4IQUA 4WC4A 1R89A 4S3NA 5D63A 3UXNA 5HRIA 5BOLA 3RJIA 1XSNA 2PFQA 1V4AA 4RPZA 4KLHA 4Z6EA 4KLIA 4AT7A 9ICTA 4XQ7A 4MKPA 4KLFA 4O9MA 2ZHAA 3ER9B 4P4PA 8ICRA 3MDCA 7ICHA 4UD4A 2RFFA 5D49A 5DB7A 1OU5A 4NLKA 4KLLA 2VANA 5DBBA 1Q79A 2GWSA 4M9HA 3AQLA 4EBJA 1ZQHA 4WC3A 7ICLA 2ID1A 5J29A 2DR7A 4F5NA 5HRHA 4AT8B 4UB2A 2BE3A 1ZQYA 4LEWA 2ZH6A 2BPGA 5J2CA 4XUSA 4FHPA 1GPJA 8ICOA 1ZQGA 3V7JA 1R8AA 4QZDA 8ICMA 7ICUA 4AT7B 2B51A 3JPOA 5D4BA 1ZQZA 4EBKA 8ICBA 4RPYA 4M5DA 3V7LA 3HWTA 2FMSA 4WQKA 2M2VA 4RWQA 3WFOA 4K4HA 4NXTA 5HRGA 5DBCA 2NRKA 4I2BA 4HX0A 9ICLA 3MDAA 5HREA 5J2DA 4GXKA 4LVSA 1BPZA 7ICJA 4X4OA 1TVAA 4I2AA 4GXIA 3EF2A 4WCWA 4PGQA 4LEVA 7ICQA 9ICFA 4F5QA 4KLDA 4UD5A 4WC6A 2PXIA 4EEBA 4RQ3A 4K98A 9ICMA 5J2FA 3JCFA 9ICJA 5CHGA 4JLZA 4X4VA 8ICEA 3NYBA 3H37A 5CP2A 3GDXA 4EP7A 4F5RA 4RWOA 5IIOA 4YMMA 4O5KA 9ICKA 4LT6A 5JTGA 1ZQFA 4MF2A 3JPPA 1ZJMA 5J2HA 3JYYA 3AQKA 4XQ8A 5CWRA 4WC7A 3UQ2A 3B0YA 4PHDA 3WFPA 4X4PA 5EOZA 4I2HA 3UQ0A 4KLUA 5D46A 2ZH3A 4WQLA 7ICIA 4RQ1A 8ICWA 1MIVA 4FHXA 5CFSA 9ICNA 1HUZA 1KEJA 2PFPA 5DB8A 4EV6A 4NY8A 1ZQJA 5DB6A 4I2JA 4K97A 4PGYA 1ZQMA 4K4IA 4M04A 1ZJNA 1BPEA 3C18A 4RQ7A 4KLJA 1WOTA 1JMSA 3CK6A 4M0AA 7ICRA 5DBAA 3ISCA 1JQRA 4WC5A 4FH5A 5BOMA 3JZ0A 4KLQA 5CR0A 5J2IA 5J0RA 4FO6A 1ZQQA 1ZQIA 5J2KA 4PHPA 4KLEA 4NXVA 2DR5A 5HHIA 4WC2A 7ICVA 2HN1A 1FA0A 4K9AA 4RQ0A 4XA5A 2P66A 3MGHA 3UPSA 4YN4A 4MFAA 3HIYA 4K96A 4QZGA 2BCVA 8ICVA 1TFYA 4DOCA 5IINA 1RZTA 8ICTA 3OVBA 4F5PA 3V72A 4OAHA 4QZCA 3JPRA 3RH6A 5B3PA 4RQ5A 3OVAA 2PBEA 4TURA 9ICRA 1RPLA 5DB9A 5HRLA 1ZQVA 8ICFA 2FCLA 4K99A 1F5AA 4TUQA 3OGUA 3K7DA 5IIMA 2BPFA 7ICTA 9ICUA 4I0UA 4RPXA 3AU2A 1PX5A 4IG8A 4RWNA 4QZIA 2ZH7A 2M2WA 4QZ9A 2FMPA 4FO1A 3H38A 8ICYA 4NXWA 4RT3A 5HRFA 8ICNA 3OWGA 7ICPA 4UB3A 4K4GA 5IIKA 5TZVA 3PHZA 3C2MA 4O67A 9ICCA 2HHPA 5IIJA 4NM2A 5IIIA 5B3QA 4QZAA 3PNCA 5J2AA 3MCRA 4UBBA 3UXOA 2DRAA 8ICAA 4LEYA 1VJ7A 5HRDA 3ER8C 4ATBA 3HX0A 3C5FA 4JWMA 2GA9D 4X0AA 9ICBA 4QZBA 1BPBA 4UAZA 5DDYA 3UPQA 8ICJA 3NKUA 2HN2A 4I2IA 2Q66A 4IQTA 4QZHA 2FMQA 9ICIA 3H39A 7ICKA 4OAGA 4KLOA 3L9DA 4KLMA 1MQ3A 2BBJA 3OV7A 9ICHA 5J2BA 4YD1A 4M47A 2PFNA 4M9NA 4FHYA 4X4SA 4PH5A 2IHMA 4O5CA 3RJEA 3LQCB 4YMOA 3AUOA 2BCUA 9ICVA 9ICSA 3C66A 4X4RA 4TUPA 4ATBB 4R63A 5J0XA 4QZEA 9ICAA 4WH5A 4IQVA 4RWPA 4NLZA 4NM1A 4LZGA 4YCXA 3MBYA 4O5EA 4NXZA 2BCSA 4WC0A 5BPCA 5HHHA 4WBZA 1ZQDA 2ISOA 4KB6A 3AQNA 4XRHA 4I2EA 5J0SA 4WBYA 1HUOA 5J2EA 3HJ1A 2ZHBA 3NVOA 3K75D 5DKWA 4RQ4A 3RJFA 1XSLA 8ICZA 4OAFA 5IILA 8ICSA 8ICHA 8ICXA 8ICIA 4UB5A 4M9JA 1YLQA 3C5GA 4M9GA 1KNYA 1ZQSA 9ICEA 5J0WA 4O68A 2M2TA 3C2KA 4I28A 3JPNA 3OVSA 1BPDA 4DOAA 3WFRE 2BBHA 4PGXA 4OAIZ 4MF8A 2ZH2A 1Q78A 1ZQXA 5F2VO 9ICWA 4P4OA 4UAYA 3TFSA 4UBCA 4O6AA 4R65A 4PHAA 4UB1A 3V7KA 7ICMA 8ICPA 5CHEA 8ICKA 4FHWA 4E7XA 2W9MA 1MIWA 4WC1A 3RJHA 9ICQA 5J2JA 4MFFA 5J0YA 4LEZA 4MFCA 1ZQKA 4KM5A 9ICPA 1ZQAA 3ERCC 5CJ7A 5J2GA 3AQMA 5CB1A 4JWNA 3UXPA 1MIYA 4R64A 4KLGA 4KLTA 4X4UA 4FH3A 9ICGA 3C2LA 4NXUA 4X5VA 2O5AA 1UETA 5HR9A 9ICXA 4X4QA 7ICFA 4RQ6A 8ICGA 5J0TA 1JAJA 2ZH8A 1ZQNA 1ZQOA 1NOMA 2I9GA 2B4VA 4I2DA 4KLSA 1ZQCA 4F5OA 8ICCA 4NXXA 5DECA 1UEVA 2IHOA 4PHEA 2BCQA 2ISPA 3RJGA 4R66A 2ZH1A 4X0BA 2ZH9A 4N7RA 4P4MA 3WFQE 4IQWA 4E8FA 1ZQRA 4I2FA 3AU6A 3ISDA 1ZQWA 4QZFA 4EGWA 3H3AA 2BCRA 2ZH4A 4YMNA 3ISBA 3MGIA 3B0XA 4Z6CA 2DR8A 7ICGA 5DEDA 4LZDA 2M2UA 1MQ2A 3PMLA 2DVIA 1ZQUA 1BPXA 4P2HA 8ICQA 5J0UA 3WFSC 5D61A 4WOYA 1R8BA 4QZ8A 2ZH5A 3JPQA 4DOBA 7ICEA 3JPSA 4AT9A 2EWRA 5CFUA 3PMNA 5J0PA 2O1PA 4UB4A 3OUYA 3TFRA 4EEDA 2B56A 5CA7A 4DO9A 1NO5A 4M9LA 4I2CA 1TFWA 1XSPA 1ZQEA 4O69A 7ICOA 4X4NA 8ICUA 3JPTA 4E80A 4I2GA 4NLNA 3RH4A 4Z6FA 2BPCA 4XJEA 1ZQBA 2GAFD 1TV9A 2PFOA 7ICSA 4FHVA 4I27A 4JLXA 4RQ2A 4GXJA 1JN3A 5HC9A 3HJ4A 4NKTA 4K8VA 3RJKA 2IUBA
chains in the Genus database with same CATH topology
9ICOA 1BPYA 3LK9A 7ICNA 1R8CA 1VFGA 3HW8A 4AT9B 4RT2A 4NKUA 3OUYB 2DR9A 5J0OA 1ZQTA 3RH5A 4RQ8A 5HRBA 4K9BA 4X4TA 2DRBA 5DDMA 8ICLA 4Z6DA 3RJJA 4TUSA 1KDHA 4I29A 1UEUA 5J0QA 4YD2A 1ZQPA 4PPXA 4M2YA 4AT8A 4UAWA 5HRKA 1ZQLA 4IQUA 4WC4A 1R89A 4S3NA 3UXNA 5HRIA 5BOLA 3RJIA 1XSNA 2PFQA 1V4AA 4RPZA 4KLHA 4Z6EA 4KLIA 4AT7A 9ICTA 4XQ7A 4MKPA 4KLFA 4O9MA 2ZHAA 4P4PA 8ICRA 3MDCA 7ICHA 4UD4A 2RFFA 5D49A 5DB7A 1OU5A 4NLKA 4KLLA 2VANA 5DBBA 1Q79A 2GWSA 4M9HA 3AQLA 4EBJA 1ZQHA 4WC3A 7ICLA 2ID1A 5J29A 2DR7A 4F5NA 5HRHA 4AT8B 4UB2A 2BE3A 1ZQYA 4LEWA 2ZH6A 2BPGA 5J2CA 4XUSA 4FHPA 8ICOA 1ZQGA 3V7JA 1R8AA 4QZDA 8ICMA 7ICUA 4AT7B 2B51A 3JPOA 5D4BA 1ZQZA 4EBKA 8ICBA 4RPYA 4M5DA 3V7LA 3HWTA 2FMSA 2M2VA 4RWQA 3WFOA 4K4HA 4NXTA 5HRGA 5DBCA 2NRKA 4I2BA 9ICLA 3MDAA 5HREA 5J2DA 4GXKA 4LVSA 1BPZA 7ICJA 4X4OA 1TVAA 4I2AA 4GXIA 4WCWA 4PGQA 4LEVA 7ICQA 9ICFA 4F5QA 4KLDA 4UD5A 4WC6A 2PXIA 4RQ3A 4K98A 9ICMA 5J2FA 9ICJA 5CHGA 4JLZA 4X4VA 8ICEA 3NYBA 3H37A 5CP2A 3GDXA 4EP7A 4F5RA 4RWOA 5IIOA 4YMMA 4O5KA 9ICKA 4LT6A 1ZQFA 4MF2A 3JPPA 1ZJMA 5J2HA 3JYYA 3AQKA 4XQ8A 5CWRA 4WC7A 3UQ2A 3B0YA 4PHDA 3WFPA 4X4PA 5EOZA 4I2HA 3UQ0A 4KLUA 5D46A 2ZH3A 7ICIA 4RQ1A 8ICWA 1MIVA 4FHXA 9ICNA 1HUZA 1KEJA 2PFPA 5DB8A 4NY8A 1ZQJA 5DB6A 4I2JA 4K97A 4PGYA 1ZQMA 4K4IA 4M04A 1ZJNA 1BPEA 3C18A 4RQ7A 4KLJA 1WOTA 1JMSA 4M0AA 7ICRA 5DBAA 3ISCA 1JQRA 4WC5A 4FH5A 5BOMA 3JZ0A 4KLQA 5CR0A 5J2IA 5J0RA 4FO6A 1ZQQA 1ZQIA 5J2KA 4PHPA 4KLEA 4NXVA 2DR5A 5HHIA 4WC2A 7ICVA 1FA0A 4K9AA 4RQ0A 4XA5A 2P66A 3MGHA 3UPSA 4YN4A 4MFAA 3HIYA 4K96A 4QZGA 2BCVA 8ICVA 1TFYA 4DOCA 5IINA 1RZTA 8ICTA 3OVBA 4F5PA 3V72A 4OAHA 4QZCA 3JPRA 3RH6A 4RQ5A 3OVAA 2PBEA 4TURA 9ICRA 1RPLA 5DB9A 5HRLA 1ZQVA 8ICFA 4TUQA 4K99A 1F5AA 3OGUA 5IIMA 2BPFA 9ICUA 7ICTA 4RPXA 3AU2A 1PX5A 4QZIA 4IG8A 4RWNA 2ZH7A 2M2WA 4QZ9A 2FMPA 3H38A 8ICYA 4NXWA 4RT3A 5HRFA 8ICNA 7ICPA 4UB3A 4K4GA 5IIKA 5TZVA 3C2MA 4O67A 9ICCA 2HHPA 5IIJA 4NM2A 5IIIA 4QZAA 3PNCA 5J2AA 4UBBA 3UXOA 2DRAA 8ICAA 4LEYA 1VJ7A 5HRDA 4ATBA 3HX0A 3C5FA 4JWMA 9ICBA 4X0AA 4QZBA 1BPBA 4UAZA 5DDYA 3UPQA 8ICJA 4I2IA 2Q66A 4IQTA 4QZHA 2FMQA 9ICIA 3H39A 7ICKA 4OAGA 4KLOA 3L9DA 4KLMA 1MQ3A 3OV7A 9ICHA 5J2BA 4YD1A 4M47A 2PFNA 4M9NA 4FHYA 4X4SA 4PH5A 2IHMA 4O5CA 3RJEA 3LQCB 4YMOA 3AUOA 2BCUA 9ICVA 9ICSA 3C66A 4X4RA 4TUPA 4ATBB 4R63A 5J0XA 4QZEA 9ICAA 4IQVA 4RWPA 4NLZA 4NM1A 4LZGA 4YCXA 3MBYA 4O5EA 4NXZA 2BCSA 4WC0A 5BPCA 5HHHA 4WBZA 1ZQDA 2ISOA 4KB6A 3AQNA 4XRHA 4I2EA 5J0SA 4WBYA 1HUOA 5J2EA 3HJ1A 2ZHBA 3K75D 5DKWA 4RQ4A 3RJFA 1XSLA 8ICZA 4OAFA 5IILA 8ICSA 8ICHA 8ICXA 8ICIA 4UB5A 4M9JA 1YLQA 3C5GA 4M9GA 1KNYA 1ZQSA 9ICEA 5J0WA 4O68A 2M2TA 3C2KA 4I28A 3JPNA 3OVSA 1BPDA 4DOAA 3WFRE 4PGXA 4OAIZ 4MF8A 2ZH2A 1Q78A 1ZQXA 5F2VO 9ICWA 4P4OA 4UAYA 3TFSA 4UBCA 4O6AA 4R65A 4PHAA 4UB1A 3V7KA 7ICMA 8ICPA 8ICKA 4FHWA 4E7XA 2W9MA 1MIWA 4WC1A 3RJHA 9ICQA 5J2JA 4MFFA 5J0YA 4LEZA 4MFCA 1ZQKA 4KM5A 9ICPA 1ZQAA 5CJ7A 5J2GA 3AQMA 5CB1A 4JWNA 3UXPA 1MIYA 4R64A 4KLGA 4KLTA 4X4UA 4FH3A 9ICGA 3C2LA 4NXUA 4X5VA 2O5AA 1UETA 5HR9A 9ICXA 4X4QA 7ICFA 4RQ6A 8ICGA 5J0TA 1JAJA 2ZH8A 1ZQNA 1ZQOA 1NOMA 2I9GA 2B4VA 4I2DA 4KLSA 1ZQCA 4F5OA 8ICCA 4NXXA 5DECA 1UEVA 4PHEA 2BCQA 2ISPA 3RJGA 4R66A 2ZH1A 4X0BA 2ZH9A 4P4MA 3WFQE 4IQWA 4E8FA 1ZQRA 4I2FA 3AU6A 3ISDA 1ZQWA 4QZFA 3H3AA 2BCRA 2ZH4A 4YMNA 3ISBA 3MGIA 3B0XA 4Z6CA 2DR8A 7ICGA 5DEDA 4LZDA 2M2UA 1MQ2A 3PMLA 2DVIA 1ZQUA 1BPXA 4P2HA 8ICQA 5J0UA 3WFSC 4WOYA 1R8BA 4QZ8A 2ZH5A 3JPQA 4DOBA 7ICEA 3JPSA 4AT9A 3PMNA 5J0PA 2O1PA 4UB4A 3OUYA 3TFRA 2B56A 5CA7A 4DO9A 1NO5A 4M9LA 4I2CA 1TFWA 1XSPA 1ZQEA 4O69A 7ICOA 4X4NA 8ICUA 3JPTA 4E80A 4I2GA 4NLNA 3RH4A 4Z6FA 2BPCA 1ZQBA 2PFOA 1TV9A 7ICSA 4FHVA 4I27A 4JLXA 4RQ2A 4GXJA 1JN3A 5HC9A 3HJ4A 4NKTA 4K8VA 3RJKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 9ICO A;  1BPY A;  3LK9 A;  7ICN A;  1R8C A;  1VFG A;  3HW8 A;  4AT9 B;  4RT2 A;  4NKU A;  3OUY B;  2DR9 A;  5J0O A;  1ZQT A;  3RH5 A;  4RQ8 A;  5HRB A;  5DDM A;  4X4T A;  2DRB A;  8ICL A;  4Z6D A;  3RJJ A;  4TUS A;  1KDH A;  4I29 A;  1UEU A;  5J0Q A;  4YD2 A;  1ZQP A;  4PPX A;  4M2Y A;  4AT8 A;  4UAW A;  5HRK A;  1ZQL A;  4IQU A;  4WC4 A;  1R89 A;  4S3N A;  3UXN A;  5HRI A;  5BOL A;  3RJI A;  1XSN A;  2PFQ A;  1V4A A;  4RPZ A;  4KLH A;  4Z6E A;  4KLI A;  4AT7 A;  9ICT A;  4XQ7 A;  4KLF A;  4O9M A;  2ZHA A;  4P4P A;  8ICR A;  3MDC A;  7ICH A;  4UD4 A;  2RFF A;  5D49 A;  5DB7 A;  1OU5 A;  4NLK A;  4KLL A;  2VAN A;  5DBB A;  1Q79 A;  2GWS A;  4M9H A;  3AQL A;  4EBJ A;  1ZQH A;  4WC3 A;  7ICL A;  2ID1 A;  5J29 A;  2DR7 A;  4F5N A;  5HRH A;  4AT8 B;  4UB2 A;  2BE3 A;  1ZQY A;  2ZH6 A;  2BPG A;  5J2C A;  4XUS A;  4FHP A;  8ICO A;  1ZQG A;  3V7J A;  1R8A A;  4QZD A;  8ICM A;  7ICU A;  4AT7 B;  2B51 A;  3JPO A;  5D4B A;  1ZQZ A;  4EBK A;  8ICB A;  4RPY A;  4M5D A;  3V7L A;  3HWT A;  2FMS A;  2M2V A;  4RWQ A;  3WFO A;  4K4H A;  5HRG A;  5DBC A;  2NRK A;  4I2B A;  9ICL A;  3MDA A;  5HRE A;  5J2D A;  4GXK A;  4LVS A;  1BPZ A;  7ICJ A;  4X4O A;  1TVA A;  4I2A A;  4GXI A;  4WCW A;  4PGQ A;  7ICQ A;  9ICF A;  4F5Q A;  4KLD A;  4UD5 A;  4WC6 A;  2PXI A;  4RQ3 A;  9ICM A;  5J2F A;  9ICJ A;  5CHG A;  8ICE A;  4X4V A;  3NYB A;  3H37 A;  5CP2 A;  3GDX A;  4EP7 A;  4F5R A;  4RWO A;  5IIO A;  4YMM A;  4O5K A;  9ICK A;  4LT6 A;  1ZQF A;  4MF2 A;  3JPP A;  1ZJM A;  5J2H A;  3JYY A;  3AQK A;  4XQ8 A;  5CWR A;  4WC7 A;  3UQ2 A;  3B0Y A;  4PHD A;  3WFP A;  4X4P A;  5EOZ A;  4I2H A;  3UQ0 A;  4KLU A;  5D46 A;  2ZH3 A;  7ICI A;  4RQ1 A;  8ICW A;  1MIV A;  4FHX A;  9ICN A;  1HUZ A;  1KEJ A;  2PFP A;  5DB8 A;  4NY8 A;  1ZQJ A;  5DB6 A;  4I2J A;  4PGY A;  1ZQM A;  4K4I A;  4M04 A;  1ZJN A;  1BPE A;  3C18 A;  4RQ7 A;  4KLJ A;  1WOT A;  1JMS A;  4M0A A;  7ICR A;  5DBA A;  3ISC A;  1JQR A;  4WC5 A;  4FH5 A;  5BOM A;  3JZ0 A;  4KLQ A;  5CR0 A;  5J2I A;  5J0R A;  4FO6 A;  1ZQQ A;  1ZQI A;  5J2K A;  4PHP A;  4KLE A;  2DR5 A;  5HHI A;  4WC2 A;  7ICV A;  1FA0 A;  4RQ0 A;  2P66 A;  4XA5 A;  3MGH A;  3UPS A;  4YN4 A;  4MFA A;  3HIY A;  4QZG A;  2BCV A;  8ICV A;  1TFY A;  4DOC A;  5IIN A;  1RZT A;  8ICT A;  4F5P A;  3OVB A;  3V72 A;  4QZC A;  3JPR A;  3RH6 A;  4RQ5 A;  2PBE A;  3OVA A;  4TUR A;  9ICR A;  1RPL A;  5DB9 A;  5HRL A;  1ZQV A;  8ICF A;  4TUQ A;  3OGU A;  1F5A A;  5IIM A;  2BPF A;  9ICU A;  7ICT A;  4RPX A;  3AU2 A;  1PX5 A;  4QZI A;  4IG8 A;  4RWN A;  2ZH7 A;  2M2W A;  4QZ9 A;  2FMP A;  3H38 A;  8ICY A;  4RT3 A;  5HRF A;  8ICN A;  7ICP A;  4UB3 A;  4K4G A;  5IIK A;  5TZV A;  3C2M A;  9ICC A;  2HHP A;  5IIJ A;  4NM2 A;  5III A;  4QZA A;  3PNC A;  5J2A A;  4UBB A;  3UXO A;  2DRA A;  8ICA A;  1VJ7 A;  5HRD A;  4ATB A;  3HX0 A;  3C5F A;  4JWM A;  9ICB A;  4X0A A;  4QZB A;  1BPB A;  4UAZ A;  5DDY A;  3UPQ A;  8ICJ A;  4I2I A;  2Q66 A;  4IQT A;  4QZH A;  2FMQ A;  9ICI A;  3H39 A;  7ICK A;  4KLO A;  3L9D A;  4KLM A;  1MQ3 A;  3OV7 A;  9ICH A;  5J2B A;  4YD1 A;  4M47 A;  2PFN A;  4M9N A;  4FHY A;  4X4S A;  4PH5 A;  2IHM A;  4O5C A;  3RJE A;  3LQC B;  4YMO A;  3AUO A;  2BCU A;  9ICV A;  9ICS A;  3C66 A;  4X4R A;  4TUP A;  4ATB B;  4R63 A;  5J0X A;  4QZE A;  9ICA A;  4IQV A;  4RWP A;  4NLZ A;  4NM1 A;  4LZG A;  4YCX A;  3MBY A;  4O5E A;  4NXZ A;  2BCS A;  4WC0 A;  5BPC A;  5HHH A;  4WBZ A;  1ZQD A;  2ISO A;  3AQN A;  4XRH A;  4I2E A;  5J0S A;  4WBY A;  1HUO A;  5J2E A;  3HJ1 A;  2ZHB A;  3K75 D;  5DKW A;  4RQ4 A;  3RJF A;  1XSL A;  8ICZ A;  5IIL A;  8ICS A;  8ICH A;  8ICX A;  8ICI A;  4UB5 A;  4M9J A;  1YLQ A;  3C5G A;  4M9G A;  1KNY A;  1ZQS A;  9ICE A;  5J0W A;  2M2T A;  3C2K A;  4I28 A;  3JPN A;  1BPD A;  3OVS A;  4DOA A;  3WFR E;  4PGX A;  4MF8 A;  2ZH2 A;  1Q78 A;  1ZQX A;  5F2V O;  9ICW A;  4P4O A;  4UAY A;  3TFS A;  4UBC A;  4R65 A;  4UB1 A;  4PHA A;  3V7K A;  7ICM A;  8ICP A;  8ICK A;  4FHW A;  4E7X A;  2W9M A;  1MIW A;  4WC1 A;  3RJH A;  9ICQ A;  5J2J A;  4MFF A;  5J0Y A;  4MFC A;  1ZQK A;  9ICP A;  1ZQA A;  5CJ7 A;  5J2G A;  3AQM A;  5CB1 A;  4JWN A;  3UXP A;  1MIY A;  4R64 A;  4KLG A;  4KLT A;  4X4U A;  4FH3 A;  9ICG A;  3C2L A;  4X5V A;  2O5A A;  1UET A;  5HR9 A;  9ICX A;  4X4Q A;  7ICF A;  4RQ6 A;  8ICG A;  5J0T A;  1JAJ A;  2ZH8 A;  1ZQN A;  1ZQO A;  1NOM A;  2I9G A;  2B4V A;  4I2D A;  4KLS A;  1ZQC A;  4F5O A;  8ICC A;  5DEC A;  1UEV A;  4PHE A;  2BCQ A;  2ISP A;  3RJG A;  4R66 A;  2ZH1 A;  4X0B A;  2ZH9 A;  4P4M A;  3WFQ E;  4IQW A;  4E8F A;  1ZQR A;  4I2F A;  3AU6 A;  3ISD A;  1ZQW A;  4QZF A;  3H3A A;  2BCR A;  2ZH4 A;  4YMN A;  3ISB A;  3MGI A;  3B0X A;  4Z6C A;  2DR8 A;  7ICG A;  5DED A;  4LZD A;  2M2U A;  1MQ2 A;  3PML A;  2DVI A;  1ZQU A;  1BPX A;  4P2H A;  8ICQ A;  5J0U A;  3WFS C;  1R8B A;  4QZ8 A;  2ZH5 A;  3JPQ A;  4DOB A;  7ICE A;  3JPS A;  4AT9 A;  3PMN A;  5J0P A;  2O1P A;  4UB4 A;  3OUY A;  3TFR A;  2B56 A;  5CA7 A;  4DO9 A;  1NO5 A;  4M9L A;  4I2C A;  1XSP A;  1TFW A;  1ZQE A;  7ICO A;  4X4N A;  8ICU A;  3JPT A;  4E80 A;  4I2G A;  4NLN A;  3RH4 A;  4Z6F A;  2BPC A;  1ZQB A;  2PFO A;  1TV9 A;  7ICS A;  4FHV A;  4I27 A;  4RQ2 A;  4GXJ A;  1JN3 A;  5HC9 A;  3HJ4 A;  4NKT A;  3RJK A; 
#chains in the Genus database with same CATH topology
 9ICO A;  1BPY A;  3LK9 A;  7ICN A;  1R8C A;  1VFG A;  3HW8 A;  4AT9 B;  4RT2 A;  4NKU A;  3OUY B;  2DR9 A;  5CFT A;  5J0O A;  1ZQT A;  3RH5 A;  4RQ8 A;  5HRB A;  4K9B A;  4X4T A;  2DRB A;  5DDM A;  8ICL A;  3NWI A;  4Z6D A;  3RJJ A;  4TUS A;  1KDH A;  4I29 A;  1UEU A;  5J0Q A;  4YD2 A;  5D62 A;  1ZQP A;  4PPX A;  4M2Y A;  4AT8 A;  4UAW A;  5HRK A;  1ZQL A;  4IQU A;  4WC4 A;  1R89 A;  4S3N A;  5D63 A;  3UXN A;  5HRI A;  5BOL A;  3RJI A;  1XSN A;  2PFQ A;  1V4A A;  4RPZ A;  4KLH A;  4Z6E A;  4KLI A;  4AT7 A;  9ICT A;  4XQ7 A;  4MKP A;  4KLF A;  4O9M A;  2ZHA A;  3ER9 B;  4P4P A;  8ICR A;  3MDC A;  7ICH A;  4UD4 A;  2RFF A;  5D49 A;  5DB7 A;  1OU5 A;  4NLK A;  4KLL A;  2VAN A;  5DBB A;  1Q79 A;  2GWS A;  4M9H A;  3AQL A;  4EBJ A;  1ZQH A;  4WC3 A;  7ICL A;  2ID1 A;  5J29 A;  2DR7 A;  4F5N A;  5HRH A;  4AT8 B;  4UB2 A;  2BE3 A;  1ZQY A;  4LEW A;  2ZH6 A;  2BPG A;  5J2C A;  4XUS A;  4FHP A;  1GPJ A;  8ICO A;  1ZQG A;  3V7J A;  1R8A A;  4QZD A;  8ICM A;  7ICU A;  4AT7 B;  2B51 A;  3JPO A;  5D4B A;  1ZQZ A;  4EBK A;  8ICB A;  4RPY A;  4M5D A;  3V7L A;  3HWT A;  2FMS A;  4WQK A;  2M2V A;  4RWQ A;  3WFO A;  4K4H A;  4NXT A;  5HRG A;  5DBC A;  2NRK A;  4I2B A;  4HX0 A;  9ICL A;  3MDA A;  5HRE A;  5J2D A;  4GXK A;  4LVS A;  1BPZ A;  7ICJ A;  4X4O A;  1TVA A;  4I2A A;  4GXI A;  3EF2 A;  4WCW A;  4PGQ A;  4LEV A;  7ICQ A;  9ICF A;  4F5Q A;  4KLD A;  4UD5 A;  4WC6 A;  2PXI A;  4EEB A;  4RQ3 A;  4K98 A;  9ICM A;  5J2F A;  3JCF A;  9ICJ A;  5CHG A;  4JLZ A;  4X4V A;  8ICE A;  3NYB A;  3H37 A;  5CP2 A;  3GDX A;  4EP7 A;  4F5R A;  4RWO A;  5IIO A;  4YMM A;  4O5K A;  9ICK A;  4LT6 A;  5JTG A;  1ZQF A;  4MF2 A;  3JPP A;  1ZJM A;  5J2H A;  3JYY A;  3AQK A;  4XQ8 A;  5CWR A;  4WC7 A;  3UQ2 A;  3B0Y A;  4PHD A;  3WFP A;  4X4P A;  5EOZ A;  4I2H A;  3UQ0 A;  4KLU A;  5D46 A;  2ZH3 A;  4WQL A;  7ICI A;  4RQ1 A;  8ICW A;  1MIV A;  4FHX A;  5CFS A;  9ICN A;  1HUZ A;  1KEJ A;  2PFP A;  5DB8 A;  4EV6 A;  4NY8 A;  1ZQJ A;  5DB6 A;  4I2J A;  4K97 A;  4PGY A;  1ZQM A;  4K4I A;  4M04 A;  1ZJN A;  1BPE A;  3C18 A;  4RQ7 A;  4KLJ A;  1WOT A;  1JMS A;  3CK6 A;  4M0A A;  7ICR A;  5DBA A;  3ISC A;  1JQR A;  4WC5 A;  4FH5 A;  5BOM A;  3JZ0 A;  4KLQ A;  5CR0 A;  5J2I A;  5J0R A;  4FO6 A;  1ZQQ A;  1ZQI A;  5J2K A;  4PHP A;  4KLE A;  4NXV A;  2DR5 A;  5HHI A;  4WC2 A;  7ICV A;  2HN1 A;  1FA0 A;  4K9A A;  4RQ0 A;  4XA5 A;  2P66 A;  3MGH A;  3UPS A;  4YN4 A;  4MFA A;  3HIY A;  4K96 A;  4QZG A;  2BCV A;  8ICV A;  1TFY A;  4DOC A;  5IIN A;  1RZT A;  8ICT A;  3OVB A;  4F5P A;  3V72 A;  4OAH A;  4QZC A;  3JPR A;  3RH6 A;  5B3P A;  4RQ5 A;  3OVA A;  2PBE A;  4TUR A;  9ICR A;  1RPL A;  5DB9 A;  5HRL A;  1ZQV A;  8ICF A;  2FCL A;  4K99 A;  1F5A A;  4TUQ A;  3OGU A;  3K7D A;  5IIM A;  2BPF A;  7ICT A;  9ICU A;  4I0U A;  4RPX A;  3AU2 A;  1PX5 A;  4IG8 A;  4RWN A;  4QZI A;  2ZH7 A;  2M2W A;  4QZ9 A;  2FMP A;  4FO1 A;  3H38 A;  8ICY A;  4NXW A;  4RT3 A;  5HRF A;  8ICN A;  3OWG A;  7ICP A;  4UB3 A;  4K4G A;  5IIK A;  5TZV A;  3PHZ A;  3C2M A;  4O67 A;  9ICC A;  2HHP A;  5IIJ A;  4NM2 A;  5III A;  5B3Q A;  4QZA A;  3PNC A;  5J2A A;  3MCR A;  4UBB A;  3UXO A;  2DRA A;  8ICA A;  4LEY A;  1VJ7 A;  5HRD A;  3ER8 C;  4ATB A;  3HX0 A;  3C5F A;  4JWM A;  2GA9 D;  4X0A A;  9ICB A;  4QZB A;  1BPB A;  4UAZ A;  5DDY A;  3UPQ A;  8ICJ A;  3NKU A;  2HN2 A;  4I2I A;  2Q66 A;  4IQT A;  4QZH A;  2FMQ A;  9ICI A;  3H39 A;  7ICK A;  4OAG A;  4KLO A;  3L9D A;  4KLM A;  1MQ3 A;  2BBJ A;  3OV7 A;  9ICH A;  5J2B A;  4YD1 A;  4M47 A;  2PFN A;  4M9N A;  4FHY A;  4X4S A;  4PH5 A;  2IHM A;  4O5C A;  3RJE A;  3LQC B;  4YMO A;  3AUO A;  2BCU A;  9ICV A;  9ICS A;  3C66 A;  4X4R A;  4TUP A;  4ATB B;  4R63 A;  5J0X A;  4QZE A;  9ICA A;  4WH5 A;  4IQV A;  4RWP A;  4NLZ A;  4NM1 A;  4LZG A;  4YCX A;  3MBY A;  4O5E A;  4NXZ A;  2BCS A;  4WC0 A;  5BPC A;  5HHH A;  4WBZ A;  1ZQD A;  2ISO A;  4KB6 A;  3AQN A;  4XRH A;  4I2E A;  5J0S A;  4WBY A;  1HUO A;  5J2E A;  3HJ1 A;  2ZHB A;  3NVO A;  3K75 D;  5DKW A;  4RQ4 A;  3RJF A;  1XSL A;  8ICZ A;  4OAF A;  5IIL A;  8ICS A;  8ICH A;  8ICX A;  8ICI A;  4UB5 A;  4M9J A;  1YLQ A;  3C5G A;  4M9G A;  1KNY A;  1ZQS A;  9ICE A;  5J0W A;  4O68 A;  2M2T A;  3C2K A;  4I28 A;  3JPN A;  3OVS A;  1BPD A;  4DOA A;  3WFR E;  2BBH A;  4PGX A;  4OAI Z;  4MF8 A;  2ZH2 A;  1Q78 A;  1ZQX A;  5F2V O;  9ICW A;  4P4O A;  4UAY A;  3TFS A;  4UBC A;  4O6A A;  4R65 A;  4PHA A;  4UB1 A;  3V7K A;  7ICM A;  8ICP A;  5CHE A;  8ICK A;  4FHW A;  4E7X A;  2W9M A;  1MIW A;  4WC1 A;  3RJH A;  9ICQ A;  5J2J A;  4MFF A;  5J0Y A;  4LEZ A;  4MFC A;  1ZQK A;  4KM5 A;  9ICP A;  1ZQA A;  3ERC C;  5CJ7 A;  5J2G A;  3AQM A;  5CB1 A;  4JWN A;  3UXP A;  1MIY A;  4R64 A;  4KLG A;  4KLT A;  4X4U A;  4FH3 A;  9ICG A;  3C2L A;  4NXU A;  4X5V A;  2O5A A;  1UET A;  5HR9 A;  9ICX A;  4X4Q A;  7ICF A;  4RQ6 A;  8ICG A;  5J0T A;  1JAJ A;  2ZH8 A;  1ZQN A;  1ZQO A;  1NOM A;  2I9G A;  2B4V A;  4I2D A;  4KLS A;  1ZQC A;  4F5O A;  8ICC A;  4NXX A;  5DEC A;  1UEV A;  2IHO A;  4PHE A;  2BCQ A;  2ISP A;  3RJG A;  4R66 A;  2ZH1 A;  4X0B A;  2ZH9 A;  4N7R A;  4P4M A;  3WFQ E;  4IQW A;  4E8F A;  1ZQR A;  4I2F A;  3AU6 A;  3ISD A;  1ZQW A;  4QZF A;  4EGW A;  3H3A A;  2BCR A;  2ZH4 A;  4YMN A;  3ISB A;  3MGI A;  3B0X A;  4Z6C A;  2DR8 A;  7ICG A;  5DED A;  4LZD A;  2M2U A;  1MQ2 A;  3PML A;  2DVI A;  1ZQU A;  1BPX A;  4P2H A;  8ICQ A;  5J0U A;  3WFS C;  5D61 A;  4WOY A;  1R8B A;  4QZ8 A;  2ZH5 A;  3JPQ A;  4DOB A;  7ICE A;  3JPS A;  4AT9 A;  2EWR A;  5CFU A;  3PMN A;  5J0P A;  2O1P A;  4UB4 A;  3OUY A;  3TFR A;  4EED A;  2B56 A;  5CA7 A;  4DO9 A;  1NO5 A;  4M9L A;  4I2C A;  1TFW A;  1XSP A;  1ZQE A;  4O69 A;  7ICO A;  4X4N A;  8ICU A;  3JPT A;  4E80 A;  4I2G A;  4NLN A;  3RH4 A;  4Z6F A;  2BPC A;  4XJE A;  1ZQB A;  2GAF D;  1TV9 A;  2PFO A;  7ICS A;  4FHV A;  4I27 A;  4JLX A;  4RQ2 A;  4GXJ A;  1JN3 A;  5HC9 A;  3HJ4 A;  4NKT A;  4K8V A;  3RJK A;  2IUB A; 
#chains in the Genus database with same CATH homology
 9ICO A;  1BPY A;  3LK9 A;  7ICN A;  1R8C A;  1VFG A;  3HW8 A;  4AT9 B;  4RT2 A;  4NKU A;  3OUY B;  2DR9 A;  5J0O A;  1ZQT A;  3RH5 A;  4RQ8 A;  5HRB A;  4K9B A;  4X4T A;  2DRB A;  5DDM A;  8ICL A;  4Z6D A;  3RJJ A;  4TUS A;  1KDH A;  4I29 A;  1UEU A;  5J0Q A;  4YD2 A;  1ZQP A;  4PPX A;  4M2Y A;  4AT8 A;  4UAW A;  5HRK A;  1ZQL A;  4IQU A;  4WC4 A;  1R89 A;  4S3N A;  3UXN A;  5HRI A;  5BOL A;  3RJI A;  1XSN A;  2PFQ A;  1V4A A;  4RPZ A;  4KLH A;  4Z6E A;  4KLI A;  4AT7 A;  9ICT A;  4XQ7 A;  4MKP A;  4KLF A;  4O9M A;  2ZHA A;  4P4P A;  8ICR A;  3MDC A;  7ICH A;  4UD4 A;  2RFF A;  5D49 A;  5DB7 A;  1OU5 A;  4NLK A;  4KLL A;  2VAN A;  5DBB A;  1Q79 A;  2GWS A;  4M9H A;  3AQL A;  4EBJ A;  1ZQH A;  4WC3 A;  7ICL A;  2ID1 A;  5J29 A;  2DR7 A;  4F5N A;  5HRH A;  4AT8 B;  4UB2 A;  2BE3 A;  1ZQY A;  4LEW A;  2ZH6 A;  2BPG A;  5J2C A;  4XUS A;  4FHP A;  8ICO A;  1ZQG A;  3V7J A;  1R8A A;  4QZD A;  8ICM A;  7ICU A;  4AT7 B;  2B51 A;  3JPO A;  5D4B A;  1ZQZ A;  4EBK A;  8ICB A;  4RPY A;  4M5D A;  3V7L A;  3HWT A;  2FMS A;  2M2V A;  4RWQ A;  3WFO A;  4K4H A;  4NXT A;  5HRG A;  5DBC A;  2NRK A;  4I2B A;  9ICL A;  3MDA A;  5HRE A;  5J2D A;  4GXK A;  4LVS A;  1BPZ A;  7ICJ A;  4X4O A;  1TVA A;  4I2A A;  4GXI A;  4WCW A;  4PGQ A;  4LEV A;  7ICQ A;  9ICF A;  4F5Q A;  4KLD A;  4UD5 A;  4WC6 A;  2PXI A;  4RQ3 A;  4K98 A;  9ICM A;  5J2F A;  9ICJ A;  5CHG A;  4JLZ A;  4X4V A;  8ICE A;  3NYB A;  3H37 A;  5CP2 A;  3GDX A;  4EP7 A;  4F5R A;  4RWO A;  5IIO A;  4YMM A;  4O5K A;  9ICK A;  4LT6 A;  1ZQF A;  4MF2 A;  3JPP A;  1ZJM A;  5J2H A;  3JYY A;  3AQK A;  4XQ8 A;  5CWR A;  4WC7 A;  3UQ2 A;  3B0Y A;  4PHD A;  3WFP A;  4X4P A;  5EOZ A;  4I2H A;  3UQ0 A;  4KLU A;  5D46 A;  2ZH3 A;  7ICI A;  4RQ1 A;  8ICW A;  1MIV A;  4FHX A;  9ICN A;  1HUZ A;  1KEJ A;  2PFP A;  5DB8 A;  4NY8 A;  1ZQJ A;  5DB6 A;  4I2J A;  4K97 A;  4PGY A;  1ZQM A;  4K4I A;  4M04 A;  1ZJN A;  1BPE A;  3C18 A;  4RQ7 A;  4KLJ A;  1WOT A;  1JMS A;  4M0A A;  7ICR A;  5DBA A;  3ISC A;  1JQR A;  4WC5 A;  4FH5 A;  5BOM A;  3JZ0 A;  4KLQ A;  5CR0 A;  5J2I A;  5J0R A;  4FO6 A;  1ZQQ A;  1ZQI A;  5J2K A;  4PHP A;  4KLE A;  4NXV A;  2DR5 A;  5HHI A;  4WC2 A;  7ICV A;  1FA0 A;  4K9A A;  4RQ0 A;  4XA5 A;  2P66 A;  3MGH A;  3UPS A;  4YN4 A;  4MFA A;  3HIY A;  4K96 A;  4QZG A;  2BCV A;  8ICV A;  1TFY A;  4DOC A;  5IIN A;  1RZT A;  8ICT A;  3OVB A;  4F5P A;  3V72 A;  4OAH A;  4QZC A;  3JPR A;  3RH6 A;  4RQ5 A;  3OVA A;  2PBE A;  4TUR A;  9ICR A;  1RPL A;  5DB9 A;  5HRL A;  1ZQV A;  8ICF A;  4TUQ A;  4K99 A;  1F5A A;  3OGU A;  5IIM A;  2BPF A;  9ICU A;  7ICT A;  4RPX A;  3AU2 A;  1PX5 A;  4QZI A;  4IG8 A;  4RWN A;  2ZH7 A;  2M2W A;  4QZ9 A;  2FMP A;  3H38 A;  8ICY A;  4NXW A;  4RT3 A;  5HRF A;  8ICN A;  7ICP A;  4UB3 A;  4K4G A;  5IIK A;  5TZV A;  3C2M A;  4O67 A;  9ICC A;  2HHP A;  5IIJ A;  4NM2 A;  5III A;  4QZA A;  3PNC A;  5J2A A;  4UBB A;  3UXO A;  2DRA A;  8ICA A;  4LEY A;  1VJ7 A;  5HRD A;  4ATB A;  3HX0 A;  3C5F A;  4JWM A;  9ICB A;  4X0A A;  4QZB A;  1BPB A;  4UAZ A;  5DDY A;  3UPQ A;  8ICJ A;  4I2I A;  2Q66 A;  4IQT A;  4QZH A;  2FMQ A;  9ICI A;  3H39 A;  7ICK A;  4OAG A;  4KLO A;  3L9D A;  4KLM A;  1MQ3 A;  3OV7 A;  9ICH A;  5J2B A;  4YD1 A;  4M47 A;  2PFN A;  4M9N A;  4FHY A;  4X4S A;  4PH5 A;  2IHM A;  4O5C A;  3RJE A;  3LQC B;  4YMO A;  3AUO A;  2BCU A;  9ICV A;  9ICS A;  3C66 A;  4X4R A;  4TUP A;  4ATB B;  4R63 A;  5J0X A;  4QZE A;  9ICA A;  4IQV A;  4RWP A;  4NLZ A;  4NM1 A;  4LZG A;  4YCX A;  3MBY A;  4O5E A;  4NXZ A;  2BCS A;  4WC0 A;  5BPC A;  5HHH A;  4WBZ A;  1ZQD A;  2ISO A;  4KB6 A;  3AQN A;  4XRH A;  4I2E A;  5J0S A;  4WBY A;  1HUO A;  5J2E A;  3HJ1 A;  2ZHB A;  3K75 D;  5DKW A;  4RQ4 A;  3RJF A;  1XSL A;  8ICZ A;  4OAF A;  5IIL A;  8ICS A;  8ICH A;  8ICX A;  8ICI A;  4UB5 A;  4M9J A;  1YLQ A;  3C5G A;  4M9G A;  1KNY A;  1ZQS A;  9ICE A;  5J0W A;  4O68 A;  2M2T A;  3C2K A;  4I28 A;  3JPN A;  3OVS A;  1BPD A;  4DOA A;  3WFR E;  4PGX A;  4OAI Z;  4MF8 A;  2ZH2 A;  1Q78 A;  1ZQX A;  5F2V O;  9ICW A;  4P4O A;  4UAY A;  3TFS A;  4UBC A;  4O6A A;  4R65 A;  4PHA A;  4UB1 A;  3V7K A;  7ICM A;  8ICP A;  8ICK A;  4FHW A;  4E7X A;  2W9M A;  1MIW A;  4WC1 A;  3RJH A;  9ICQ A;  5J2J A;  4MFF A;  5J0Y A;  4LEZ A;  4MFC A;  1ZQK A;  4KM5 A;  9ICP A;  1ZQA A;  5CJ7 A;  5J2G A;  3AQM A;  5CB1 A;  4JWN A;  3UXP A;  1MIY A;  4R64 A;  4KLG A;  4KLT A;  4X4U A;  4FH3 A;  9ICG A;  3C2L A;  4NXU A;  4X5V A;  2O5A A;  1UET A;  5HR9 A;  9ICX A;  4X4Q A;  7ICF A;  4RQ6 A;  8ICG A;  5J0T A;  1JAJ A;  2ZH8 A;  1ZQN A;  1ZQO A;  1NOM A;  2I9G A;  2B4V A;  4I2D A;  4KLS A;  1ZQC A;  4F5O A;  8ICC A;  4NXX A;  5DEC A;  1UEV A;  4PHE A;  2BCQ A;  2ISP A;  3RJG A;  4R66 A;  2ZH1 A;  4X0B A;  2ZH9 A;  4P4M A;  3WFQ E;  4IQW A;  4E8F A;  1ZQR A;  4I2F A;  3AU6 A;  3ISD A;  1ZQW A;  4QZF A;  3H3A A;  2BCR A;  2ZH4 A;  4YMN A;  3ISB A;  3MGI A;  3B0X A;  4Z6C A;  2DR8 A;  7ICG A;  5DED A;  4LZD A;  2M2U A;  1MQ2 A;  3PML A;  2DVI A;  1ZQU A;  1BPX A;  4P2H A;  8ICQ A;  5J0U A;  3WFS C;  4WOY A;  1R8B A;  4QZ8 A;  2ZH5 A;  3JPQ A;  4DOB A;  7ICE A;  3JPS A;  4AT9 A;  3PMN A;  5J0P A;  2O1P A;  4UB4 A;  3OUY A;  3TFR A;  2B56 A;  5CA7 A;  4DO9 A;  1NO5 A;  4M9L A;  4I2C A;  1TFW A;  1XSP A;  1ZQE A;  4O69 A;  7ICO A;  4X4N A;  8ICU A;  3JPT A;  4E80 A;  4I2G A;  4NLN A;  3RH4 A;  4Z6F A;  2BPC A;  1ZQB A;  2PFO A;  1TV9 A;  7ICS A;  4FHV A;  4I27 A;  4JLX A;  4RQ2 A;  4GXJ A;  1JN3 A;  5HC9 A;  3HJ4 A;  4NKT A;  4K8V A;  3RJK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...