4FHXA

Crystal structures of the cid1 poly (u) polymerase reveal the mechanism for utp selectivity - h336n mutant bound to mgatp
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
338
structure length
323
Chain Sequence
SHKEFTKFCYEVYNEIKISDKEFKEKRAALDTLRLCLKRISPDAELVAFGSLESGLALKNSDMDLCVLMDSRVQSDTIALQFYEELIAEGFEGKFLQRARIPIIKLTSDTKNGFGASFQCDIGFNNRLAIHNTLLLSSYTKLDARLKPMVLLVKHWAKRKQINSPYFGTLSSYGYVLMVLYYLIHVIKPPVFPNLLLSPLKQEKIVDGFDVGFDDKLEDIPPSQNYSSLGSLLHGFFRFYAYKFEPREKVVTFRRPDGYLTKQEKGWTRYILAIEDPFEISNNVGRTVSSSGLYRIRGEFMAASRLLNSRSYPIPYDSLFEEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the Cid1 poly (U) polymerase reveal the mechanism for UTP selectivity.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transferase
molecule keywords Poly(A) RNA polymerase protein cid1
total genus 106
structure length 323
sequence length 338
ec nomenclature ec 2.7.7.19: Polynucleotide adenylyltransferase.
pdb deposition date 2012-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01909 NTP_transf_2 Nucleotidyltransferase domain
A PF03828 PAP_assoc Cid1 family poly A polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.10 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain Poly(a)-polymerase, middle domain 4fhxA01
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4fhxA02
4WC3A 9ICUA 1BPXA 4XUSA 4ATBB 1XSNA 4QZCA 1ZQIA 4IQTA 2P66A 2O5AA 3HW8A 9ICRA 4PHAA 7ICKA 1XSLA 4NM1A 3UQ2A 1KNYA 1Q79A 3ISCA 4QZAA 7ICJA 3AU2A 5CB1A 5J2BA 4QZBA 4I2CA 3B0XA 3C2MA 4UBCA 4M9GA 9ICBA 4QZGA 4KLMA 3NYBA 4WC0A 8ICCA 1ZQVA 3JPNA 2PFQA 3H37A 7ICGA 8ICSA 1VFGA 2GWSA 4UB4A 4MFCA 3RJJA 7ICRA 2Q66A 4I2HA 2ZH6A 5J0RA 4F5QA 4PHPA 5IIMA 2M2VA 5J0YA 3K75D 4I2AA 1ZQJA 5HR9A 4I28A 9ICVA 9ICSA 2ZH5A 1RZTA 4IQWA 4AT9B 4S3NA 1FA0A 5J2AA 1ZQCA 1ZQAA 4AT9A 2ZHBA 7ICHA 5J0WA 5J2FA 9ICHA 4QZEA 1ZQBA 4DOCA 4M9LA 4E8FA 5DECA 4RWPA 3ISDA 4EBJA 3WFRE 4XQ8A 5HREA 4QZFA 3UQ0A 5DBCA 8ICPA 7ICNA 3JPPA 3AUOA 8ICQA 3OV7A 3AQLA 7ICLA 3JPQA 2I9GA 4M9HA 4I2GA 4RWOA 9ICOA 3H38A 4X4UA 5D49A 4K4IA 4RT3A 4FHVA 1BPZA 1MIYA 4YN4A 2FMPA 4MFAA 3JPOA 1JAJA 5J2EA 4RQ7A 7ICIA 4P4PA 2B56A 5TZVA 2ISPA 4RPZA 7ICUA 5HHHA 4K4GA 1UEUA 3AQKA 4IQUA 4KLHA 2DR8A 4WC5A 2FMSA 4NLKA 1ZQDA 7ICSA 3B0YA 5HRFA 3HJ1A 1ZQOA 1MIWA 5J2KA 7ICFA 8ICAA 4K4HA 5J0QA 5J0UA 1UEVA 5IIKA 4O9MA 7ICPA 4M2YA 3V7LA 2ZHAA 4I2EA 5J0XA 4LZDA 4NKTA 1R8CA 1ZQXA 3HWTA 4WBYA 4I29A 1MQ3A 5D4BA 3AQMA 4RQ6A 5HC9A 4X4SA 4PGYA 8ICBA 8ICGA 9ICLA 2ZH7A 3OUYB 3C66A 4YMOA 4RQ1A 4XA5A 4QZ9A 4I2BA 3HIYA 5BPCA 4X4RA 5IINA 1ZQHA 4I27A 1ZQZA 3OVAA 1BPEA 3RJGA 4PHDA 1F5AA 4FH5A 4X0BA 4RQ5A 2BPCA 5J0SA 4KLGA 8ICYA 1KDHA 3V7JA 4F5OA 5HRIA 1TFWA 4RWNA 4F5NA 4KLUA 3AU6A 5BOLA 3OVBA 4JWNA 3UXPA 9ICCA 3JYYA 9ICPA 3TFRA 5J29A 3JPSA 7ICVA 7ICEA 1ZQYA 9ICIA 4WC4A 5IIIA 8ICWA 1XSPA 4O5EA 4Z6DA 4MF8A 4RQ0A 9ICGA 3UXOA 3WFSC 8ICFA 2ISOA 4KLFA 9ICWA 4X0AA 2BE3A 2BCQA 5DB8A 3LK9A 2FMQA 4KLIA 8ICNA 5DB6A 1R8BA 5DKWA 4FH3A 1ZQEA 5EOZA 2ID1A 3H39A 4M0AA 4UB5A 2PFPA 3C5FA 8ICMA 4EBKA 4R64A 1Q78A 4F5PA 4UB3A 4DOAA 1BPBA 1ZQRA 2DR5A 2O1PA 3RJFA 5CP2A 3UPQA 3RH5A 2PFNA 2B4VA 1WOTA 4RQ3A 4QZDA 3TFSA 3MGIA 4FO6A 4NM2A 4IG8A 8ICOA 5DBBA 4R66A 4UB2A 4ATBA 8ICLA 7ICMA 1RPLA 1ZQSA 3WFQE 9ICTA 4QZIA 4KLJA 3C5GA 5J2DA 9ICAA 1HUZA 1OU5A 4TURA 3MGHA 8ICXA 4FHYA 1R89A 1V4AA 2RFFA 4PPXA 8ICKA 2ZH2A 2ZH4A 5J2JA 2BCSA 4M47A 4M9JA 5J2CA 1HUOA 4PH5A 5HRHA 3PNCA 5J2HA 9ICJA 1VJ7A 4RQ2A 5CA7A 4UBBA 4GXJA 4X4NA 4RWQA 2BPGA 2BPFA 1ZJNA 9ICNA 2M2UA 4Z6FA 4F5RA 3L9DA 5J2IA 5DEDA 4YMMA 2VANA 1YLQA 3C2KA 3ISBA 4RT2A 4I2IA 1BPYA 4GXKA 4UAZA 4LVSA 3AQNA 4M9NA 4FHPA 4O5KA 4WC2A 2NRKA 4KLOA 3WFPA 4AT7A 4E80A 3C18A 2W9MA 2M2WA 4XRHA 2IHMA 5IILA 4X4OA 4UAYA 4TUQA 4FHWA 3WFOA 3V72A 4I2FA 9ICKA 8ICJA 5J2GA 8ICHA 2HHPA 4M5DA 5DB7A 4EP7A 4AT7B 4UD5A 4X4PA 3PMNA 1NO5A 4X4QA 4GXIA 4WBZA 4DO9A 2BCRA 3MDAA 7ICOA 8ICTA 4UD4A 3OUYA 5IIJA 4QZHA 1ZQMA 1ZQKA 4MFFA 3RH6A 4JWMA 4FHXA 4M04A 4YCXA 5HRLA 4KLTA 4QZ8A 2ZH9A 1TFYA 3RJIA 4KLQA 5HRBA 9ICXA 2DRBA 4YD2A 9ICQA 4KLSA 3C2LA 1JN3A 3PMLA 1KEJA 1NOMA 1ZQTA 5DDYA 5J0OA 4PGQA 4DOBA 4LT6A 7ICTA 4Z6CA 3HJ4A 8ICZA 4YMNA 1JMSA 1ZQNA 5J0PA 1ZJMA 4NLNA 4P4MA 4I2DA 3MBYA 4UB1A 4R65A 2ZH8A 3JPRA 2DVIA 1R8AA 3GDXA 2PFOA 5HHIA 4X4TA 4NY8A 7ICQA 2ZH1A 4RQ4A 4XQ7A 4R63A 4NLZA 4KLDA 1ZQFA 2M2TA 4P2HA 4RPYA 1TVAA 5CJ7A 3OVSA 4O5CA 1BPDA 4RQ8A 1TV9A 2ZH3A 3MDCA 4RPXA 5HRKA 4LZGA 5HRGA 1ZQQA 9ICEA 9ICFA 2DR9A 4X4VA 1ZQPA 4PHEA 1ZQUA 9ICMA 8ICEA 5CHGA 8ICVA 1JQRA 1UETA 4PGXA 4AT8B 2DR7A 4AT8A 4NXZA 1ZQWA 5CWRA 5F2VO 4TUSA 2B51A 4E7XA 3RH4A 8ICUA 3LQCB 4WC1A 5CR0A 4IQVA 4UAWA 3JPTA 2DRAA 1ZQGA 2PBEA 3RJKA 4YD1A 3V7KA 4MF2A 4KLLA 5IIOA 3RJHA 4X5VA 4WC6A 1ZQLA 4WC7A 4WCWA 5HRDA 2BCUA 1PX5A 1MQ2A 4I2JA 4Z6EA 5D46A 5BOMA 5J0TA 4P4OA 3RJEA 3HX0A 1MIVA 4TUPA 5DDMA 4KLEA 5DB9A 8ICIA 3UXNA 3UPSA 2PXIA 3OGUA 3JZ0A 8ICRA 4NKUA 2BCVA 3H3AA 5DBAA
chains in the Genus database with same CATH superfamily
3ER9B 3ER8C 4WC3A 9ICUA 1BPXA 4XUSA 4ATBB 1XSNA 4QZCA 1ZQIA 4IQTA 2P66A 2O5AA 3HW8A 9ICRA 5D62A 4PHAA 7ICKA 1XSLA 4NM1A 3UQ2A 1KNYA 1Q79A 3ISCA 4QZAA 7ICJA 3AU2A 5CB1A 5J2BA 4K9AA 4QZBA 4I2CA 3B0XA 3C2MA 4UBCA 4M9GA 9ICBA 4QZGA 4KLMA 3NYBA 5D63A 4WC0A 8ICCA 1ZQVA 2GA9D 3JPNA 3H37A 2PFQA 7ICGA 8ICSA 1VFGA 2GWSA 4UB4A 4MFCA 3RJJA 7ICRA 2Q66A 4I2HA 2ZH6A 5J0RA 4F5QA 4PHPA 5IIMA 2M2VA 5J0YA 3K75D 4I2AA 1ZQJA 5HR9A 4I28A 9ICVA 4OAGA 9ICSA 2ZH5A 1RZTA 2BBHA 4IQWA 4AT9B 4S3NA 1FA0A 5J2AA 4O68A 1ZQCA 1ZQAA 4AT9A 4K8VA 2ZHBA 2HN2A 5J0WA 5J2FA 7ICHA 9ICHA 4QZEA 1ZQBA 4DOCA 4M9LA 4E8FA 5DECA 4RWPA 3ISDA 4EBJA 3WFRE 4XQ8A 5HREA 4QZFA 3UQ0A 5DBCA 8ICPA 7ICNA 3JPPA 3AUOA 8ICQA 3OV7A 3AQLA 7ICLA 3JPQA 2I9GA 4FO1A 4M9HA 4I2GA 4RWOA 4O69A 9ICOA 3H38A 4X4UA 5D49A 4K4IA 4RT3A 4FHVA 1BPZA 1MIYA 4YN4A 2FMPA 4MFAA 3JPOA 1JAJA 5J2EA 4RQ7A 7ICIA 4P4PA 4N7RA 2B56A 5TZVA 2ISPA 2HN1A 4RPZA 7ICUA 5HHHA 4K4GA 1UEUA 3AQKA 5CFUA 4IQUA 4KLHA 2DR8A 4WC5A 2FMSA 4NLKA 1ZQDA 2GAFD 7ICSA 3B0YA 3CK6A 5HRFA 3HJ1A 1ZQOA 1MIWA 5J2KA 7ICFA 5D61A 8ICAA 4K4HA 5J0QA 5J0UA 5CHEA 1UEVA 5IIKA 4O9MA 7ICPA 4M2YA 2ZHAA 3V7LA 4I2EA 5J0XA 4LZDA 4NKTA 1R8CA 1ZQXA 4EEDA 3HWTA 4WBYA 4I29A 1MQ3A 4WQLA 4EGWA 5D4BA 3AQMA 4RQ6A 4NXTA 5HC9A 4X4SA 4PGYA 8ICBA 8ICGA 9ICLA 2ZH7A 3C66A 3OUYB 4YMOA 4RQ1A 4XA5A 4QZ9A 4I2BA 3HIYA 5BPCA 4X4RA 4KM5A 5IINA 1ZQHA 1ZQZA 4I27A 3OVAA 1BPEA 3RJGA 4PHDA 1F5AA 4FH5A 4X0BA 4LEVA 4RQ5A 2BPCA 5J0SA 4KLGA 8ICYA 1KDHA 3V7JA 4F5OA 1GPJA 5HRIA 1TFWA 4RWNA 4F5NA 4KLUA 3EF2A 3AU6A 4MKPA 4XJEA 5BOLA 3OVBA 4JWNA 4WQKA 3UXPA 9ICCA 3JYYA 9ICPA 3TFRA 5J29A 3JPSA 7ICVA 7ICEA 1ZQYA 9ICIA 4WC4A 5IIIA 8ICWA 1XSPA 4O5EA 4K96A 4Z6DA 5CFTA 4JLXA 4RQ0A 3UXOA 4MF8A 9ICGA 3WFSC 8ICFA 2ISOA 4KLFA 9ICWA 4X0AA 2BE3A 2BCQA 5DB8A 3ERCC 3LK9A 2FMQA 4KLIA 8ICNA 5DB6A 1R8BA 5DKWA 4NXXA 4FH3A 1ZQEA 5EOZA 2ID1A 3H39A 4M0AA 4UB5A 2PFPA 3C5FA 8ICMA 4EBKA 4R64A 1Q78A 4F5PA 4UB3A 4DOAA 1BPBA 1ZQRA 2DR5A 2O1PA 3RJFA 5CP2A 3UPQA 3RH5A 2PFNA 2B4VA 1WOTA 4RQ3A 4QZDA 4O67A 3TFSA 3MGIA 4FO6A 4NM2A 4IG8A 4HX0A 8ICOA 5DBBA 4R66A 4UB2A 4ATBA 8ICLA 7ICMA 1RPLA 1ZQSA 3WFQE 9ICTA 4QZIA 4KLJA 4JLZA 3C5GA 5J2DA 9ICAA 1HUZA 4OAHA 1OU5A 4TURA 3MGHA 8ICXA 4FHYA 1R89A 1V4AA 2RFFA 4PPXA 8ICKA 2ZH2A 2ZH4A 5B3PA 5J2JA 4EEBA 2BCSA 4M47A 4M9JA 3MCRA 5J2CA 1HUOA 4PH5A 5HRHA 3PNCA 5J2HA 9ICJA 1VJ7A 4RQ2A 4X4NA 4LEWA 5CA7A 4UBBA 4GXJA 4RWQA 2BPGA 2BPFA 5CFSA 1ZJNA 9ICNA 2M2UA 4Z6FA 4F5RA 3L9DA 5J2IA 5DEDA 4YMMA 2VANA 1YLQA 3C2KA 3ISBA 4RT2A 4I2IA 1BPYA 4GXKA 4UAZA 4LVSA 3AQNA 4M9NA 4FHPA 4O5KA 4WC2A 2NRKA 4KLOA 3WFPA 4AT7A 4E80A 3C18A 2EWRA 2W9MA 2M2WA 4XRHA 2IHMA 5IILA 4X4OA 4UAYA 4TUQA 4FHWA 3WFOA 3V72A 3JCFA 4I2FA 9ICKA 8ICJA 5J2GA 8ICHA 2HHPA 4M5DA 4K97A 5DB7A 5B3QA 4EP7A 4AT7B 4UD5A 2FCLA 4K99A 4X4PA 3PMNA 4WH5A 1NO5A 4X4QA 4GXIA 4WBZA 4DO9A 2BCRA 3MDAA 7ICOA 8ICTA 4UD4A 3OUYA 5IIJA 4QZHA 1ZQMA 1ZQKA 4MFFA 3RH6A 4JWMA 4FHXA 4M04A 4YCXA 5HRLA 4KLTA 4QZ8A 4I0UA 2ZH9A 3NWIA 1TFYA 3RJIA 4KLQA 5HRBA 9ICXA 2DRBA 4YD2A 9ICQA 4O6AA 4KLSA 3C2LA 1JN3A 3PMLA 1KEJA 1NOMA 2BBJA 1ZQTA 5DDYA 5J0OA 4PGQA 4DOBA 4WOYA 3PHZA 4LT6A 3NVOA 7ICTA 4Z6CA 3HJ4A 8ICZA 4YMNA 1JMSA 1ZQNA 5J0PA 1ZJMA 4NLNA 3K7DA 4P4MA 4I2DA 3MBYA 4UB1A 4R65A 2ZH8A 3JPRA 2DVIA 4NXWA 1R8AA 3GDXA 2PFOA 4K98A 3NKUA 4X4TA 5HHIA 4NY8A 7ICQA 2ZH1A 4RQ4A 4XQ7A 4R63A 4NLZA 4KLDA 2IHOA 1ZQFA 2M2TA 4P2HA 4RPYA 1TVAA 2IUBA 5CJ7A 3OVSA 4OAFA 4O5CA 1BPDA 4RQ8A 1TV9A 2ZH3A 3MDCA 4RPXA 5HRKA 4LZGA 5HRGA 1ZQQA 9ICEA 9ICFA 2DR9A 4X4VA 1ZQPA 4PHEA 1ZQUA 4K9BA 9ICMA 8ICEA 5CHGA 8ICVA 1JQRA 1UETA 4PGXA 4AT8B 2DR7A 4AT8A 4NXZA 1ZQWA 5CWRA 5F2VO 4TUSA 4KB6A 2B51A 4E7XA 3RH4A 8ICUA 3LQCB 4WC1A 5CR0A 5JTGA 4IQVA 4UAWA 3JPTA 2DRAA 1ZQGA 2PBEA 4EV6A 4NXVA 3RJKA 3OWGA 4YD1A 3V7KA 4MF2A 4KLLA 4LEZA 5IIOA 3RJHA 4X5VA 4WC6A 1ZQLA 4WC7A 4WCWA 5HRDA 2BCUA 1PX5A 1MQ2A 4I2JA 4Z6EA 4NXUA 5D46A 5BOMA 5J0TA 4P4OA 3RJEA 3HX0A 1MIVA 4TUPA 5DDMA 4KLEA 5DB9A 8ICIA 3UXNA 3UPSA 2PXIA 4OAIZ 3OGUA 3JZ0A 8ICRA 4NKUA 2BCVA 4LEYA 3H3AA 5DBAA
chains in the Genus database with same CATH topology
4WC3A 9ICUA 1BPXA 4XUSA 4ATBB 1XSNA 4QZCA 1ZQIA 4IQTA 2P66A 2O5AA 3HW8A 9ICRA 4PHAA 7ICKA 1XSLA 4NM1A 3UQ2A 1KNYA 1Q79A 3ISCA 4QZAA 7ICJA 3AU2A 5CB1A 5J2BA 4K9AA 4QZBA 4I2CA 3B0XA 3C2MA 4UBCA 4M9GA 9ICBA 4QZGA 4KLMA 3NYBA 4WC0A 8ICCA 1ZQVA 3JPNA 2PFQA 3H37A 7ICGA 8ICSA 1VFGA 2GWSA 4UB4A 4MFCA 3RJJA 7ICRA 2Q66A 4I2HA 2ZH6A 5J0RA 4F5QA 4PHPA 5IIMA 2M2VA 5J0YA 3K75D 4I2AA 1ZQJA 5HR9A 4I28A 9ICVA 4OAGA 9ICSA 2ZH5A 1RZTA 4IQWA 4AT9B 4S3NA 1FA0A 5J2AA 4O68A 1ZQCA 1ZQAA 4AT9A 4K8VA 2ZHBA 7ICHA 5J0WA 5J2FA 9ICHA 4QZEA 1ZQBA 4DOCA 4M9LA 4E8FA 5DECA 4RWPA 3ISDA 4EBJA 3WFRE 4XQ8A 5HREA 4QZFA 3UQ0A 5DBCA 8ICPA 7ICNA 3JPPA 3AUOA 8ICQA 3OV7A 3AQLA 7ICLA 3JPQA 2I9GA 4M9HA 4I2GA 4RWOA 4O69A 9ICOA 3H38A 4X4UA 5D49A 4K4IA 4RT3A 4FHVA 1BPZA 1MIYA 4YN4A 2FMPA 4MFAA 3JPOA 1JAJA 5J2EA 4RQ7A 7ICIA 4P4PA 2B56A 5TZVA 2ISPA 4RPZA 7ICUA 5HHHA 4K4GA 1UEUA 3AQKA 4IQUA 4KLHA 2DR8A 4WC5A 2FMSA 4NLKA 1ZQDA 7ICSA 3B0YA 5HRFA 3HJ1A 1ZQOA 1MIWA 5J2KA 7ICFA 8ICAA 4K4HA 5J0QA 5J0UA 1UEVA 5IIKA 4O9MA 7ICPA 4M2YA 2ZHAA 3V7LA 4I2EA 5J0XA 4LZDA 4NKTA 1R8CA 1ZQXA 3HWTA 4WBYA 4I29A 1MQ3A 5D4BA 3AQMA 4RQ6A 4NXTA 5HC9A 4X4SA 4PGYA 8ICBA 8ICGA 9ICLA 2ZH7A 3C66A 3OUYB 4YMOA 4RQ1A 4XA5A 4QZ9A 4I2BA 3HIYA 5BPCA 4X4RA 4KM5A 5IINA 1ZQHA 1ZQZA 4I27A 3OVAA 1BPEA 3RJGA 4PHDA 1F5AA 4FH5A 4X0BA 4LEVA 4RQ5A 2BPCA 5J0SA 4KLGA 8ICYA 1KDHA 3V7JA 4F5OA 5HRIA 1TFWA 4RWNA 4F5NA 4KLUA 3AU6A 4MKPA 5BOLA 3OVBA 4JWNA 3UXPA 9ICCA 3JYYA 9ICPA 3TFRA 5J29A 3JPSA 7ICVA 7ICEA 1ZQYA 9ICIA 4WC4A 5IIIA 8ICWA 1XSPA 4O5EA 4K96A 4Z6DA 4MF8A 4JLXA 4RQ0A 3UXOA 9ICGA 3WFSC 8ICFA 2ISOA 4KLFA 9ICWA 4X0AA 2BE3A 2BCQA 5DB8A 3LK9A 2FMQA 4KLIA 8ICNA 5DB6A 1R8BA 5DKWA 4NXXA 4FH3A 1ZQEA 5EOZA 2ID1A 3H39A 4M0AA 4UB5A 2PFPA 3C5FA 8ICMA 4EBKA 4R64A 1Q78A 4F5PA 4UB3A 4DOAA 1BPBA 1ZQRA 2DR5A 2O1PA 3RJFA 5CP2A 3UPQA 3RH5A 2PFNA 2B4VA 1WOTA 4RQ3A 4QZDA 4O67A 3TFSA 3MGIA 4FO6A 4NM2A 4IG8A 8ICOA 5DBBA 4R66A 4UB2A 4ATBA 8ICLA 7ICMA 1RPLA 1ZQSA 3WFQE 9ICTA 4QZIA 4KLJA 4JLZA 3C5GA 5J2DA 9ICAA 1HUZA 4OAHA 1OU5A 4TURA 3MGHA 8ICXA 4FHYA 1R89A 1V4AA 2RFFA 4PPXA 8ICKA 2ZH2A 2ZH4A 5J2JA 2BCSA 4M47A 4M9JA 5J2CA 1HUOA 4PH5A 5HRHA 3PNCA 5J2HA 9ICJA 1VJ7A 4RQ2A 4X4NA 4LEWA 5CA7A 4UBBA 4GXJA 4RWQA 2BPGA 2BPFA 1ZJNA 9ICNA 2M2UA 4Z6FA 4F5RA 3L9DA 5J2IA 5DEDA 4YMMA 2VANA 1YLQA 3C2KA 3ISBA 4RT2A 4I2IA 1BPYA 4GXKA 4UAZA 4LVSA 3AQNA 4M9NA 4FHPA 4O5KA 4WC2A 2NRKA 4KLOA 3WFPA 4AT7A 4E80A 3C18A 2W9MA 2M2WA 4XRHA 2IHMA 5IILA 4X4OA 4UAYA 4TUQA 4FHWA 3WFOA 3V72A 4I2FA 9ICKA 8ICJA 5J2GA 8ICHA 2HHPA 4M5DA 4K97A 5DB7A 4EP7A 4AT7B 4UD5A 4K99A 4X4PA 3PMNA 1NO5A 4X4QA 4GXIA 4WBZA 4DO9A 2BCRA 3MDAA 7ICOA 8ICTA 4UD4A 3OUYA 5IIJA 4QZHA 1ZQMA 1ZQKA 4MFFA 3RH6A 4JWMA 4FHXA 4M04A 4YCXA 5HRLA 4KLTA 4QZ8A 2ZH9A 1TFYA 3RJIA 4KLQA 5HRBA 9ICXA 2DRBA 4YD2A 9ICQA 4O6AA 4KLSA 3C2LA 1JN3A 3PMLA 1KEJA 1NOMA 1ZQTA 5DDYA 5J0OA 4PGQA 4DOBA 4WOYA 4LT6A 7ICTA 4Z6CA 3HJ4A 8ICZA 4YMNA 1JMSA 1ZQNA 5J0PA 1ZJMA 4NLNA 4P4MA 4I2DA 3MBYA 4UB1A 4R65A 2ZH8A 3JPRA 2DVIA 4NXWA 1R8AA 3GDXA 2PFOA 4K98A 4X4TA 5HHIA 4NY8A 7ICQA 2ZH1A 4RQ4A 4XQ7A 4R63A 4NLZA 4KLDA 1ZQFA 2M2TA 4P2HA 4RPYA 1TVAA 5CJ7A 3OVSA 4OAFA 4O5CA 1BPDA 4RQ8A 1TV9A 2ZH3A 3MDCA 4RPXA 5HRKA 4LZGA 5HRGA 1ZQQA 9ICEA 9ICFA 2DR9A 4X4VA 1ZQPA 4PHEA 1ZQUA 4K9BA 9ICMA 8ICEA 5CHGA 8ICVA 1JQRA 1UETA 4PGXA 4AT8B 2DR7A 4AT8A 4NXZA 1ZQWA 5CWRA 5F2VO 4TUSA 4KB6A 2B51A 4E7XA 3RH4A 8ICUA 3LQCB 4WC1A 5CR0A 4IQVA 4UAWA 3JPTA 2DRAA 1ZQGA 2PBEA 4NXVA 3RJKA 4YD1A 3V7KA 4MF2A 4KLLA 4LEZA 5IIOA 3RJHA 4X5VA 4WC6A 1ZQLA 4WC7A 4WCWA 5HRDA 2BCUA 1PX5A 1MQ2A 4I2JA 4Z6EA 4NXUA 5D46A 5BOMA 5J0TA 4P4OA 3RJEA 3HX0A 1MIVA 4TUPA 5DDMA 4KLEA 5DB9A 8ICIA 3UXNA 3UPSA 2PXIA 4OAIZ 3OGUA 3JZ0A 8ICRA 4NKUA 2BCVA 4LEYA 3H3AA 5DBAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WC3 A;  9ICU A;  1BPX A;  4XUS A;  4ATB B;  1XSN A;  4QZC A;  1ZQI A;  4IQT A;  2P66 A;  2O5A A;  3HW8 A;  9ICR A;  4PHA A;  7ICK A;  1XSL A;  4NM1 A;  3UQ2 A;  1KNY A;  1Q79 A;  3ISC A;  4QZA A;  7ICJ A;  3AU2 A;  5CB1 A;  5J2B A;  4QZB A;  4I2C A;  3B0X A;  3C2M A;  4UBC A;  4M9G A;  9ICB A;  4QZG A;  4KLM A;  3NYB A;  4WC0 A;  8ICC A;  1ZQV A;  3JPN A;  2PFQ A;  3H37 A;  7ICG A;  8ICS A;  1VFG A;  2GWS A;  4UB4 A;  4MFC A;  3RJJ A;  7ICR A;  2Q66 A;  4I2H A;  2ZH6 A;  5J0R A;  4F5Q A;  4PHP A;  5IIM A;  2M2V A;  5J0Y A;  3K75 D;  4I2A A;  1ZQJ A;  5HR9 A;  4I28 A;  9ICV A;  9ICS A;  2ZH5 A;  1RZT A;  4IQW A;  4AT9 B;  4S3N A;  1FA0 A;  5J2A A;  1ZQC A;  1ZQA A;  4AT9 A;  2ZHB A;  7ICH A;  5J0W A;  5J2F A;  9ICH A;  4QZE A;  1ZQB A;  4DOC A;  4M9L A;  4E8F A;  5DEC A;  4RWP A;  3ISD A;  4EBJ A;  3WFR E;  4XQ8 A;  5HRE A;  4QZF A;  3UQ0 A;  5DBC A;  8ICP A;  7ICN A;  3JPP A;  3AUO A;  8ICQ A;  3OV7 A;  3AQL A;  7ICL A;  3JPQ A;  2I9G A;  4M9H A;  4I2G A;  4RWO A;  9ICO A;  3H38 A;  4X4U A;  5D49 A;  4K4I A;  4RT3 A;  4FHV A;  1BPZ A;  1MIY A;  4YN4 A;  2FMP A;  4MFA A;  3JPO A;  1JAJ A;  5J2E A;  4RQ7 A;  7ICI A;  4P4P A;  2B56 A;  5TZV A;  2ISP A;  4RPZ A;  7ICU A;  5HHH A;  4K4G A;  1UEU A;  3AQK A;  4IQU A;  4KLH A;  2DR8 A;  4WC5 A;  2FMS A;  4NLK A;  1ZQD A;  7ICS A;  3B0Y A;  5HRF A;  3HJ1 A;  1ZQO A;  1MIW A;  5J2K A;  7ICF A;  8ICA A;  4K4H A;  5J0Q A;  5J0U A;  1UEV A;  5IIK A;  4O9M A;  7ICP A;  4M2Y A;  3V7L A;  2ZHA A;  4I2E A;  5J0X A;  4LZD A;  4NKT A;  1R8C A;  1ZQX A;  3HWT A;  4WBY A;  4I29 A;  1MQ3 A;  5D4B A;  3AQM A;  4RQ6 A;  5HC9 A;  4X4S A;  4PGY A;  8ICB A;  8ICG A;  9ICL A;  2ZH7 A;  3OUY B;  3C66 A;  4YMO A;  4RQ1 A;  4XA5 A;  4QZ9 A;  4I2B A;  3HIY A;  5BPC A;  4X4R A;  5IIN A;  1ZQH A;  4I27 A;  1ZQZ A;  3OVA A;  1BPE A;  3RJG A;  4PHD A;  1F5A A;  4FH5 A;  4X0B A;  4RQ5 A;  2BPC A;  5J0S A;  4KLG A;  8ICY A;  1KDH A;  3V7J A;  4F5O A;  5HRI A;  1TFW A;  4RWN A;  4F5N A;  4KLU A;  3AU6 A;  5BOL A;  3OVB A;  4JWN A;  3UXP A;  9ICC A;  3JYY A;  9ICP A;  3TFR A;  5J29 A;  3JPS A;  7ICV A;  7ICE A;  1ZQY A;  9ICI A;  4WC4 A;  5III A;  8ICW A;  1XSP A;  4O5E A;  4Z6D A;  4MF8 A;  4RQ0 A;  9ICG A;  3UXO A;  3WFS C;  8ICF A;  2ISO A;  4KLF A;  9ICW A;  4X0A A;  2BE3 A;  2BCQ A;  5DB8 A;  3LK9 A;  2FMQ A;  4KLI A;  8ICN A;  5DB6 A;  1R8B A;  5DKW A;  4FH3 A;  1ZQE A;  5EOZ A;  2ID1 A;  3H39 A;  4M0A A;  4UB5 A;  2PFP A;  3C5F A;  8ICM A;  4EBK A;  4R64 A;  1Q78 A;  4F5P A;  4UB3 A;  4DOA A;  1BPB A;  1ZQR A;  2DR5 A;  2O1P A;  3RJF A;  5CP2 A;  3UPQ A;  3RH5 A;  2PFN A;  2B4V A;  1WOT A;  4RQ3 A;  4QZD A;  3TFS A;  3MGI A;  4FO6 A;  4NM2 A;  4IG8 A;  8ICO A;  5DBB A;  4R66 A;  4UB2 A;  4ATB A;  8ICL A;  7ICM A;  1RPL A;  1ZQS A;  3WFQ E;  9ICT A;  4QZI A;  4KLJ A;  3C5G A;  5J2D A;  9ICA A;  1HUZ A;  1OU5 A;  4TUR A;  3MGH A;  8ICX A;  4FHY A;  1R89 A;  1V4A A;  2RFF A;  4PPX A;  8ICK A;  2ZH2 A;  2ZH4 A;  5J2J A;  2BCS A;  4M47 A;  4M9J A;  5J2C A;  1HUO A;  4PH5 A;  5HRH A;  3PNC A;  5J2H A;  9ICJ A;  1VJ7 A;  4RQ2 A;  5CA7 A;  4UBB A;  4GXJ A;  4X4N A;  4RWQ A;  2BPG A;  2BPF A;  1ZJN A;  9ICN A;  2M2U A;  4Z6F A;  4F5R A;  3L9D A;  5J2I A;  5DED A;  4YMM A;  2VAN A;  1YLQ A;  3C2K A;  3ISB A;  4RT2 A;  4I2I A;  1BPY A;  4GXK A;  4UAZ A;  4LVS A;  3AQN A;  4M9N A;  4FHP A;  4O5K A;  4WC2 A;  2NRK A;  4KLO A;  3WFP A;  4AT7 A;  4E80 A;  3C18 A;  2W9M A;  2M2W A;  4XRH A;  2IHM A;  5IIL A;  4X4O A;  4UAY A;  4TUQ A;  4FHW A;  3WFO A;  3V72 A;  4I2F A;  9ICK A;  8ICJ A;  5J2G A;  8ICH A;  2HHP A;  4M5D A;  5DB7 A;  4EP7 A;  4AT7 B;  4UD5 A;  4X4P A;  3PMN A;  1NO5 A;  4X4Q A;  4GXI A;  4WBZ A;  4DO9 A;  2BCR A;  3MDA A;  7ICO A;  8ICT A;  4UD4 A;  3OUY A;  5IIJ A;  4QZH A;  1ZQM A;  1ZQK A;  4MFF A;  3RH6 A;  4JWM A;  4FHX A;  4M04 A;  4YCX A;  5HRL A;  4KLT A;  4QZ8 A;  2ZH9 A;  1TFY A;  3RJI A;  4KLQ A;  5HRB A;  9ICX A;  2DRB A;  4YD2 A;  9ICQ A;  4KLS A;  3C2L A;  1JN3 A;  3PML A;  1KEJ A;  1NOM A;  1ZQT A;  5DDY A;  5J0O A;  4PGQ A;  4DOB A;  4LT6 A;  7ICT A;  4Z6C A;  3HJ4 A;  8ICZ A;  4YMN A;  1JMS A;  1ZQN A;  5J0P A;  1ZJM A;  4NLN A;  4P4M A;  4I2D A;  3MBY A;  4UB1 A;  4R65 A;  2ZH8 A;  3JPR A;  2DVI A;  1R8A A;  3GDX A;  2PFO A;  5HHI A;  4X4T A;  4NY8 A;  7ICQ A;  2ZH1 A;  4RQ4 A;  4XQ7 A;  4R63 A;  4NLZ A;  4KLD A;  1ZQF A;  2M2T A;  4P2H A;  4RPY A;  1TVA A;  5CJ7 A;  3OVS A;  4O5C A;  1BPD A;  4RQ8 A;  1TV9 A;  2ZH3 A;  3MDC A;  4RPX A;  5HRK A;  4LZG A;  5HRG A;  1ZQQ A;  9ICE A;  9ICF A;  2DR9 A;  4X4V A;  1ZQP A;  4PHE A;  1ZQU A;  9ICM A;  8ICE A;  5CHG A;  8ICV A;  1JQR A;  1UET A;  4PGX A;  4AT8 B;  2DR7 A;  4AT8 A;  4NXZ A;  1ZQW A;  5CWR A;  5F2V O;  4TUS A;  2B51 A;  4E7X A;  3RH4 A;  8ICU A;  3LQC B;  4WC1 A;  5CR0 A;  4IQV A;  4UAW A;  3JPT A;  2DRA A;  1ZQG A;  2PBE A;  3RJK A;  4YD1 A;  3V7K A;  4MF2 A;  4KLL A;  5IIO A;  3RJH A;  4X5V A;  4WC6 A;  1ZQL A;  4WC7 A;  4WCW A;  5HRD A;  2BCU A;  1PX5 A;  1MQ2 A;  4I2J A;  4Z6E A;  5D46 A;  5BOM A;  5J0T A;  4P4O A;  3RJE A;  3HX0 A;  1MIV A;  4TUP A;  5DDM A;  4KLE A;  5DB9 A;  8ICI A;  3UXN A;  3UPS A;  2PXI A;  3OGU A;  3JZ0 A;  8ICR A;  4NKU A;  2BCV A;  3H3A A;  5DBA A; 
#chains in the Genus database with same CATH topology
 3ER9 B;  3ER8 C;  4WC3 A;  9ICU A;  1BPX A;  4XUS A;  4ATB B;  1XSN A;  4QZC A;  1ZQI A;  4IQT A;  2P66 A;  2O5A A;  3HW8 A;  9ICR A;  5D62 A;  4PHA A;  7ICK A;  1XSL A;  4NM1 A;  3UQ2 A;  1KNY A;  1Q79 A;  3ISC A;  4QZA A;  7ICJ A;  3AU2 A;  5CB1 A;  5J2B A;  4K9A A;  4QZB A;  4I2C A;  3B0X A;  3C2M A;  4UBC A;  4M9G A;  9ICB A;  4QZG A;  4KLM A;  3NYB A;  5D63 A;  4WC0 A;  8ICC A;  1ZQV A;  2GA9 D;  3JPN A;  3H37 A;  2PFQ A;  7ICG A;  8ICS A;  1VFG A;  2GWS A;  4UB4 A;  4MFC A;  3RJJ A;  7ICR A;  2Q66 A;  4I2H A;  2ZH6 A;  5J0R A;  4F5Q A;  4PHP A;  5IIM A;  2M2V A;  5J0Y A;  3K75 D;  4I2A A;  1ZQJ A;  5HR9 A;  4I28 A;  9ICV A;  4OAG A;  9ICS A;  2ZH5 A;  1RZT A;  2BBH A;  4IQW A;  4AT9 B;  4S3N A;  1FA0 A;  5J2A A;  4O68 A;  1ZQC A;  1ZQA A;  4AT9 A;  4K8V A;  2ZHB A;  2HN2 A;  5J0W A;  5J2F A;  7ICH A;  9ICH A;  4QZE A;  1ZQB A;  4DOC A;  4M9L A;  4E8F A;  5DEC A;  4RWP A;  3ISD A;  4EBJ A;  3WFR E;  4XQ8 A;  5HRE A;  4QZF A;  3UQ0 A;  5DBC A;  8ICP A;  7ICN A;  3JPP A;  3AUO A;  8ICQ A;  3OV7 A;  3AQL A;  7ICL A;  3JPQ A;  2I9G A;  4FO1 A;  4M9H A;  4I2G A;  4RWO A;  4O69 A;  9ICO A;  3H38 A;  4X4U A;  5D49 A;  4K4I A;  4RT3 A;  4FHV A;  1BPZ A;  1MIY A;  4YN4 A;  2FMP A;  4MFA A;  3JPO A;  1JAJ A;  5J2E A;  4RQ7 A;  7ICI A;  4P4P A;  4N7R A;  2B56 A;  5TZV A;  2ISP A;  2HN1 A;  4RPZ A;  7ICU A;  5HHH A;  4K4G A;  1UEU A;  3AQK A;  5CFU A;  4IQU A;  4KLH A;  2DR8 A;  4WC5 A;  2FMS A;  4NLK A;  1ZQD A;  2GAF D;  7ICS A;  3B0Y A;  3CK6 A;  5HRF A;  3HJ1 A;  1ZQO A;  1MIW A;  5J2K A;  7ICF A;  5D61 A;  8ICA A;  4K4H A;  5J0Q A;  5J0U A;  5CHE A;  1UEV A;  5IIK A;  4O9M A;  7ICP A;  4M2Y A;  2ZHA A;  3V7L A;  4I2E A;  5J0X A;  4LZD A;  4NKT A;  1R8C A;  1ZQX A;  4EED A;  3HWT A;  4WBY A;  4I29 A;  1MQ3 A;  4WQL A;  4EGW A;  5D4B A;  3AQM A;  4RQ6 A;  4NXT A;  5HC9 A;  4X4S A;  4PGY A;  8ICB A;  8ICG A;  9ICL A;  2ZH7 A;  3C66 A;  3OUY B;  4YMO A;  4RQ1 A;  4XA5 A;  4QZ9 A;  4I2B A;  3HIY A;  5BPC A;  4X4R A;  4KM5 A;  5IIN A;  1ZQH A;  1ZQZ A;  4I27 A;  3OVA A;  1BPE A;  3RJG A;  4PHD A;  1F5A A;  4FH5 A;  4X0B A;  4LEV A;  4RQ5 A;  2BPC A;  5J0S A;  4KLG A;  8ICY A;  1KDH A;  3V7J A;  4F5O A;  1GPJ A;  5HRI A;  1TFW A;  4RWN A;  4F5N A;  4KLU A;  3EF2 A;  3AU6 A;  4MKP A;  4XJE A;  5BOL A;  3OVB A;  4JWN A;  4WQK A;  3UXP A;  9ICC A;  3JYY A;  9ICP A;  3TFR A;  5J29 A;  3JPS A;  7ICV A;  7ICE A;  1ZQY A;  9ICI A;  4WC4 A;  5III A;  8ICW A;  1XSP A;  4O5E A;  4K96 A;  4Z6D A;  5CFT A;  4JLX A;  4RQ0 A;  3UXO A;  4MF8 A;  9ICG A;  3WFS C;  8ICF A;  2ISO A;  4KLF A;  9ICW A;  4X0A A;  2BE3 A;  2BCQ A;  5DB8 A;  3ERC C;  3LK9 A;  2FMQ A;  4KLI A;  8ICN A;  5DB6 A;  1R8B A;  5DKW A;  4NXX A;  4FH3 A;  1ZQE A;  5EOZ A;  2ID1 A;  3H39 A;  4M0A A;  4UB5 A;  2PFP A;  3C5F A;  8ICM A;  4EBK A;  4R64 A;  1Q78 A;  4F5P A;  4UB3 A;  4DOA A;  1BPB A;  1ZQR A;  2DR5 A;  2O1P A;  3RJF A;  5CP2 A;  3UPQ A;  3RH5 A;  2PFN A;  2B4V A;  1WOT A;  4RQ3 A;  4QZD A;  4O67 A;  3TFS A;  3MGI A;  4FO6 A;  4NM2 A;  4IG8 A;  4HX0 A;  8ICO A;  5DBB A;  4R66 A;  4UB2 A;  4ATB A;  8ICL A;  7ICM A;  1RPL A;  1ZQS A;  3WFQ E;  9ICT A;  4QZI A;  4KLJ A;  4JLZ A;  3C5G A;  5J2D A;  9ICA A;  1HUZ A;  4OAH A;  1OU5 A;  4TUR A;  3MGH A;  8ICX A;  4FHY A;  1R89 A;  1V4A A;  2RFF A;  4PPX A;  8ICK A;  2ZH2 A;  2ZH4 A;  5B3P A;  5J2J A;  4EEB A;  2BCS A;  4M47 A;  4M9J A;  3MCR A;  5J2C A;  1HUO A;  4PH5 A;  5HRH A;  3PNC A;  5J2H A;  9ICJ A;  1VJ7 A;  4RQ2 A;  4X4N A;  4LEW A;  5CA7 A;  4UBB A;  4GXJ A;  4RWQ A;  2BPG A;  2BPF A;  5CFS A;  1ZJN A;  9ICN A;  2M2U A;  4Z6F A;  4F5R A;  3L9D A;  5J2I A;  5DED A;  4YMM A;  2VAN A;  1YLQ A;  3C2K A;  3ISB A;  4RT2 A;  4I2I A;  1BPY A;  4GXK A;  4UAZ A;  4LVS A;  3AQN A;  4M9N A;  4FHP A;  4O5K A;  4WC2 A;  2NRK A;  4KLO A;  3WFP A;  4AT7 A;  4E80 A;  3C18 A;  2EWR A;  2W9M A;  2M2W A;  4XRH A;  2IHM A;  5IIL A;  4X4O A;  4UAY A;  4TUQ A;  4FHW A;  3WFO A;  3V72 A;  3JCF A;  4I2F A;  9ICK A;  8ICJ A;  5J2G A;  8ICH A;  2HHP A;  4M5D A;  4K97 A;  5DB7 A;  5B3Q A;  4EP7 A;  4AT7 B;  4UD5 A;  2FCL A;  4K99 A;  4X4P A;  3PMN A;  4WH5 A;  1NO5 A;  4X4Q A;  4GXI A;  4WBZ A;  4DO9 A;  2BCR A;  3MDA A;  7ICO A;  8ICT A;  4UD4 A;  3OUY A;  5IIJ A;  4QZH A;  1ZQM A;  1ZQK A;  4MFF A;  3RH6 A;  4JWM A;  4FHX A;  4M04 A;  4YCX A;  5HRL A;  4KLT A;  4QZ8 A;  4I0U A;  2ZH9 A;  3NWI A;  1TFY A;  3RJI A;  4KLQ A;  5HRB A;  9ICX A;  2DRB A;  4YD2 A;  9ICQ A;  4O6A A;  4KLS A;  3C2L A;  1JN3 A;  3PML A;  1KEJ A;  1NOM A;  2BBJ A;  1ZQT A;  5DDY A;  5J0O A;  4PGQ A;  4DOB A;  4WOY A;  3PHZ A;  4LT6 A;  3NVO A;  7ICT A;  4Z6C A;  3HJ4 A;  8ICZ A;  4YMN A;  1JMS A;  1ZQN A;  5J0P A;  1ZJM A;  4NLN A;  3K7D A;  4P4M A;  4I2D A;  3MBY A;  4UB1 A;  4R65 A;  2ZH8 A;  3JPR A;  2DVI A;  4NXW A;  1R8A A;  3GDX A;  2PFO A;  4K98 A;  3NKU A;  4X4T A;  5HHI A;  4NY8 A;  7ICQ A;  2ZH1 A;  4RQ4 A;  4XQ7 A;  4R63 A;  4NLZ A;  4KLD A;  2IHO A;  1ZQF A;  2M2T A;  4P2H A;  4RPY A;  1TVA A;  2IUB A;  5CJ7 A;  3OVS A;  4OAF A;  4O5C A;  1BPD A;  4RQ8 A;  1TV9 A;  2ZH3 A;  3MDC A;  4RPX A;  5HRK A;  4LZG A;  5HRG A;  1ZQQ A;  9ICE A;  9ICF A;  2DR9 A;  4X4V A;  1ZQP A;  4PHE A;  1ZQU A;  4K9B A;  9ICM A;  8ICE A;  5CHG A;  8ICV A;  1JQR A;  1UET A;  4PGX A;  4AT8 B;  2DR7 A;  4AT8 A;  4NXZ A;  1ZQW A;  5CWR A;  5F2V O;  4TUS A;  4KB6 A;  2B51 A;  4E7X A;  3RH4 A;  8ICU A;  3LQC B;  4WC1 A;  5CR0 A;  5JTG A;  4IQV A;  4UAW A;  3JPT A;  2DRA A;  1ZQG A;  2PBE A;  4EV6 A;  4NXV A;  3RJK A;  3OWG A;  4YD1 A;  3V7K A;  4MF2 A;  4KLL A;  4LEZ A;  5IIO A;  3RJH A;  4X5V A;  4WC6 A;  1ZQL A;  4WC7 A;  4WCW A;  5HRD A;  2BCU A;  1PX5 A;  1MQ2 A;  4I2J A;  4Z6E A;  4NXU A;  5D46 A;  5BOM A;  5J0T A;  4P4O A;  3RJE A;  3HX0 A;  1MIV A;  4TUP A;  5DDM A;  4KLE A;  5DB9 A;  8ICI A;  3UXN A;  3UPS A;  2PXI A;  4OAI Z;  3OGU A;  3JZ0 A;  8ICR A;  4NKU A;  2BCV A;  4LEY A;  3H3A A;  5DBA A; 
#chains in the Genus database with same CATH homology
 4WC3 A;  9ICU A;  1BPX A;  4XUS A;  4ATB B;  1XSN A;  4QZC A;  1ZQI A;  4IQT A;  2P66 A;  2O5A A;  3HW8 A;  9ICR A;  4PHA A;  7ICK A;  1XSL A;  4NM1 A;  3UQ2 A;  1KNY A;  1Q79 A;  3ISC A;  4QZA A;  7ICJ A;  3AU2 A;  5CB1 A;  5J2B A;  4K9A A;  4QZB A;  4I2C A;  3B0X A;  3C2M A;  4UBC A;  4M9G A;  9ICB A;  4QZG A;  4KLM A;  3NYB A;  4WC0 A;  8ICC A;  1ZQV A;  3JPN A;  2PFQ A;  3H37 A;  7ICG A;  8ICS A;  1VFG A;  2GWS A;  4UB4 A;  4MFC A;  3RJJ A;  7ICR A;  2Q66 A;  4I2H A;  2ZH6 A;  5J0R A;  4F5Q A;  4PHP A;  5IIM A;  2M2V A;  5J0Y A;  3K75 D;  4I2A A;  1ZQJ A;  5HR9 A;  4I28 A;  9ICV A;  4OAG A;  9ICS A;  2ZH5 A;  1RZT A;  4IQW A;  4AT9 B;  4S3N A;  1FA0 A;  5J2A A;  4O68 A;  1ZQC A;  1ZQA A;  4AT9 A;  4K8V A;  2ZHB A;  7ICH A;  5J0W A;  5J2F A;  9ICH A;  4QZE A;  1ZQB A;  4DOC A;  4M9L A;  4E8F A;  5DEC A;  4RWP A;  3ISD A;  4EBJ A;  3WFR E;  4XQ8 A;  5HRE A;  4QZF A;  3UQ0 A;  5DBC A;  8ICP A;  7ICN A;  3JPP A;  3AUO A;  8ICQ A;  3OV7 A;  3AQL A;  7ICL A;  3JPQ A;  2I9G A;  4M9H A;  4I2G A;  4RWO A;  4O69 A;  9ICO A;  3H38 A;  4X4U A;  5D49 A;  4K4I A;  4RT3 A;  4FHV A;  1BPZ A;  1MIY A;  4YN4 A;  2FMP A;  4MFA A;  3JPO A;  1JAJ A;  5J2E A;  4RQ7 A;  7ICI A;  4P4P A;  2B56 A;  5TZV A;  2ISP A;  4RPZ A;  7ICU A;  5HHH A;  4K4G A;  1UEU A;  3AQK A;  4IQU A;  4KLH A;  2DR8 A;  4WC5 A;  2FMS A;  4NLK A;  1ZQD A;  7ICS A;  3B0Y A;  5HRF A;  3HJ1 A;  1ZQO A;  1MIW A;  5J2K A;  7ICF A;  8ICA A;  4K4H A;  5J0Q A;  5J0U A;  1UEV A;  5IIK A;  4O9M A;  7ICP A;  4M2Y A;  2ZHA A;  3V7L A;  4I2E A;  5J0X A;  4LZD A;  4NKT A;  1R8C A;  1ZQX A;  3HWT A;  4WBY A;  4I29 A;  1MQ3 A;  5D4B A;  3AQM A;  4RQ6 A;  4NXT A;  5HC9 A;  4X4S A;  4PGY A;  8ICB A;  8ICG A;  9ICL A;  2ZH7 A;  3C66 A;  3OUY B;  4YMO A;  4RQ1 A;  4XA5 A;  4QZ9 A;  4I2B A;  3HIY A;  5BPC A;  4X4R A;  4KM5 A;  5IIN A;  1ZQH A;  1ZQZ A;  4I27 A;  3OVA A;  1BPE A;  3RJG A;  4PHD A;  1F5A A;  4FH5 A;  4X0B A;  4LEV A;  4RQ5 A;  2BPC A;  5J0S A;  4KLG A;  8ICY A;  1KDH A;  3V7J A;  4F5O A;  5HRI A;  1TFW A;  4RWN A;  4F5N A;  4KLU A;  3AU6 A;  4MKP A;  5BOL A;  3OVB A;  4JWN A;  3UXP A;  9ICC A;  3JYY A;  9ICP A;  3TFR A;  5J29 A;  3JPS A;  7ICV A;  7ICE A;  1ZQY A;  9ICI A;  4WC4 A;  5III A;  8ICW A;  1XSP A;  4O5E A;  4K96 A;  4Z6D A;  4MF8 A;  4JLX A;  4RQ0 A;  3UXO A;  9ICG A;  3WFS C;  8ICF A;  2ISO A;  4KLF A;  9ICW A;  4X0A A;  2BE3 A;  2BCQ A;  5DB8 A;  3LK9 A;  2FMQ A;  4KLI A;  8ICN A;  5DB6 A;  1R8B A;  5DKW A;  4NXX A;  4FH3 A;  1ZQE A;  5EOZ A;  2ID1 A;  3H39 A;  4M0A A;  4UB5 A;  2PFP A;  3C5F A;  8ICM A;  4EBK A;  4R64 A;  1Q78 A;  4F5P A;  4UB3 A;  4DOA A;  1BPB A;  1ZQR A;  2DR5 A;  2O1P A;  3RJF A;  5CP2 A;  3UPQ A;  3RH5 A;  2PFN A;  2B4V A;  1WOT A;  4RQ3 A;  4QZD A;  4O67 A;  3TFS A;  3MGI A;  4FO6 A;  4NM2 A;  4IG8 A;  8ICO A;  5DBB A;  4R66 A;  4UB2 A;  4ATB A;  8ICL A;  7ICM A;  1RPL A;  1ZQS A;  3WFQ E;  9ICT A;  4QZI A;  4KLJ A;  4JLZ A;  3C5G A;  5J2D A;  9ICA A;  1HUZ A;  4OAH A;  1OU5 A;  4TUR A;  3MGH A;  8ICX A;  4FHY A;  1R89 A;  1V4A A;  2RFF A;  4PPX A;  8ICK A;  2ZH2 A;  2ZH4 A;  5J2J A;  2BCS A;  4M47 A;  4M9J A;  5J2C A;  1HUO A;  4PH5 A;  5HRH A;  3PNC A;  5J2H A;  9ICJ A;  1VJ7 A;  4RQ2 A;  4X4N A;  4LEW A;  5CA7 A;  4UBB A;  4GXJ A;  4RWQ A;  2BPG A;  2BPF A;  1ZJN A;  9ICN A;  2M2U A;  4Z6F A;  4F5R A;  3L9D A;  5J2I A;  5DED A;  4YMM A;  2VAN A;  1YLQ A;  3C2K A;  3ISB A;  4RT2 A;  4I2I A;  1BPY A;  4GXK A;  4UAZ A;  4LVS A;  3AQN A;  4M9N A;  4FHP A;  4O5K A;  4WC2 A;  2NRK A;  4KLO A;  3WFP A;  4AT7 A;  4E80 A;  3C18 A;  2W9M A;  2M2W A;  4XRH A;  2IHM A;  5IIL A;  4X4O A;  4UAY A;  4TUQ A;  4FHW A;  3WFO A;  3V72 A;  4I2F A;  9ICK A;  8ICJ A;  5J2G A;  8ICH A;  2HHP A;  4M5D A;  4K97 A;  5DB7 A;  4EP7 A;  4AT7 B;  4UD5 A;  4K99 A;  4X4P A;  3PMN A;  1NO5 A;  4X4Q A;  4GXI A;  4WBZ A;  4DO9 A;  2BCR A;  3MDA A;  7ICO A;  8ICT A;  4UD4 A;  3OUY A;  5IIJ A;  4QZH A;  1ZQM A;  1ZQK A;  4MFF A;  3RH6 A;  4JWM A;  4FHX A;  4M04 A;  4YCX A;  5HRL A;  4KLT A;  4QZ8 A;  2ZH9 A;  1TFY A;  3RJI A;  4KLQ A;  5HRB A;  9ICX A;  2DRB A;  4YD2 A;  9ICQ A;  4O6A A;  4KLS A;  3C2L A;  1JN3 A;  3PML A;  1KEJ A;  1NOM A;  1ZQT A;  5DDY A;  5J0O A;  4PGQ A;  4DOB A;  4WOY A;  4LT6 A;  7ICT A;  4Z6C A;  3HJ4 A;  8ICZ A;  4YMN A;  1JMS A;  1ZQN A;  5J0P A;  1ZJM A;  4NLN A;  4P4M A;  4I2D A;  3MBY A;  4UB1 A;  4R65 A;  2ZH8 A;  3JPR A;  2DVI A;  4NXW A;  1R8A A;  3GDX A;  2PFO A;  4K98 A;  4X4T A;  5HHI A;  4NY8 A;  7ICQ A;  2ZH1 A;  4RQ4 A;  4XQ7 A;  4R63 A;  4NLZ A;  4KLD A;  1ZQF A;  2M2T A;  4P2H A;  4RPY A;  1TVA A;  5CJ7 A;  3OVS A;  4OAF A;  4O5C A;  1BPD A;  4RQ8 A;  1TV9 A;  2ZH3 A;  3MDC A;  4RPX A;  5HRK A;  4LZG A;  5HRG A;  1ZQQ A;  9ICE A;  9ICF A;  2DR9 A;  4X4V A;  1ZQP A;  4PHE A;  1ZQU A;  4K9B A;  9ICM A;  8ICE A;  5CHG A;  8ICV A;  1JQR A;  1UET A;  4PGX A;  4AT8 B;  2DR7 A;  4AT8 A;  4NXZ A;  1ZQW A;  5CWR A;  5F2V O;  4TUS A;  4KB6 A;  2B51 A;  4E7X A;  3RH4 A;  8ICU A;  3LQC B;  4WC1 A;  5CR0 A;  4IQV A;  4UAW A;  3JPT A;  2DRA A;  1ZQG A;  2PBE A;  4NXV A;  3RJK A;  4YD1 A;  3V7K A;  4MF2 A;  4KLL A;  4LEZ A;  5IIO A;  3RJH A;  4X5V A;  4WC6 A;  1ZQL A;  4WC7 A;  4WCW A;  5HRD A;  2BCU A;  1PX5 A;  1MQ2 A;  4I2J A;  4Z6E A;  4NXU A;  5D46 A;  5BOM A;  5J0T A;  4P4O A;  3RJE A;  3HX0 A;  1MIV A;  4TUP A;  5DDM A;  4KLE A;  5DB9 A;  8ICI A;  3UXN A;  3UPS A;  2PXI A;  4OAI Z;  3OGU A;  3JZ0 A;  8ICR A;  4NKU A;  2BCV A;  4LEY A;  3H3A A;  5DBA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...