4FHXA

Crystal structures of the cid1 poly (u) polymerase reveal the mechanism for utp selectivity - h336n mutant bound to mgatp
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
338
structure length
323
Chain Sequence
SHKEFTKFCYEVYNEIKISDKEFKEKRAALDTLRLCLKRISPDAELVAFGSLESGLALKNSDMDLCVLMDSRVQSDTIALQFYEELIAEGFEGKFLQRARIPIIKLTSDTKNGFGASFQCDIGFNNRLAIHNTLLLSSYTKLDARLKPMVLLVKHWAKRKQINSPYFGTLSSYGYVLMVLYYLIHVIKPPVFPNLLLSPLKQEKIVDGFDVGFDDKLEDIPPSQNYSSLGSLLHGFFRFYAYKFEPREKVVTFRRPDGYLTKQEKGWTRYILAIEDPFEISNNVGRTVSSSGLYRIRGEFMAASRLLNSRSYPIPYDSLFEEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Poly(A) RNA polymerase protein cid1
publication title Crystal structures of the Cid1 poly (U) polymerase reveal the mechanism for UTP selectivity.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 106
structure length 323
sequence length 338
ec nomenclature ec 2.7.7.19: Polynucleotide adenylyltransferase.
pdb deposition date 2012-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01909 NTP_transf_2 Nucleotidyltransferase domain
A PF03828 PAP_assoc Cid1 family poly A polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.10 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain Poly(a)-polymerase, middle domain 4fhxA01
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4fhxA02
4FHWA 2BPGA 3RJIA 5CB1A 9ICSA 1V4AA 4LT6A 4AT8B 5BPCA 4DOCA 1BPDA 5HRHA 5DB9A 5IIJA 1JMSA 1ZQBA 4X4RA 3JZ0A 4PHPA 4R64A 8ICUA 3V7KA 1ZQMA 4FHYA 3H39A 1ZQQA 1MQ2A 8ICIA 2ZH7A 3JPNA 4YMOA 5HRFA 5CWRA 5HHIA 4LVSA 4KLJA 4MFFA 5J2EA 1ZQJA 4NLZA 4EBKA 4QZHA 4WC4A 1ZQDA 4PH5A 5J0OA 4UB2A 4UD5A 4WC3A 3B0YA 4GXJA 8ICWA 1ZQAA 5DEDA 4UB1A 5HC9A 4F5OA 2M2VA 9ICJA 8ICSA 5HRLA 4KLOA 4UBCA 4WC1A 3JPPA 4RQ2A 1ZJMA 9ICCA 4NM1A 4TUQA 3LQCB 4WC7A 3AQMA 3NYBA 3JPTA 7ICMA 7ICPA 2FMQA 4EBJA 5J0YA 5HRKA 2ZHAA 3RH6A 5J2HA 3C2MA 1RPLA 2BCUA 1ZJNA 1MIYA 4X4TA 4I2CA 2VANA 3C2KA 4M9GA 4PGXA 4M5DA 4LZGA 4FH5A 5DBAA 8ICJA 8ICPA 3JPRA 4RT3A 8ICXA 3K75D 1BPZA 4I2IA 4I2AA 4DOBA 4IQVA 7ICKA 1KDHA 1PX5A 1Q79A 5IINA 4M04A 2NRKA 4F5PA 1KNYA 5D46A 3TFSA 5D49A 3GDXA 1BPEA 3UXOA 4UAWA 3C5FA 4QZDA 4XUSA 7ICTA 2HHPA 4NKUA 4O9MA 4KLMA 8ICLA 4RQ8A 5IIMA 4RWQA 4M9NA 1ZQVA 4Z6CA 3AQLA 1ZQIA 4I2GA 7ICQA 3OUYB 5CR0A 2B4VA 4M2YA 3AU2A 4M9HA 4AT9A 3UXPA 5HRBA 9ICQA 4O5CA 2GWSA 1NO5A 4K4GA 1TV9A 4ATBA 3ISDA 8ICGA 5DDMA 1JQRA 4QZBA 1ZQYA 3TFRA 5CHGA 9ICNA 3HW8A 3RJEA 2BPCA 5HR9A 7ICLA 4QZFA 2ZH2A 4I2EA 3V7LA 1ZQNA 4RPZA 8ICBA 5TZVA 2BE3A 4KLFA 8ICZA 4QZIA 4K4HA 2ZH8A 2M2WA 8ICQA 4IQUA 1ZQUA 8ICKA 1TVAA 2BPFA 4NY8A 4KLEA 4F5RA 2DRBA 5HRDA 8ICHA 1ZQCA 1ZQLA 4FH3A 5J0TA 4X4OA 3ISCA 3OV7A 5DKWA 4E8FA 1UEUA 4FHXA 9ICHA 2IHMA 2PFOA 3JPQA 3H3AA 4PHAA 1FA0A 5J2FA 5J0XA 2ID1A 3MGIA 5J0QA 4RQ7A 2FMPA 3RJGA 5DBCA 1RZTA 2ZH4A 7ICEA 9ICPA 5DECA 4QZ9A 1ZQRA 1ZQEA 4O5KA 4DO9A 2DVIA 9ICUA 3UQ0A 4S3NA 2ZH5A 4UD4A 9ICIA 9ICEA 4X4NA 4UB4A 2ISOA 4P2HA 4WCWA 4E7XA 1R8AA 5HREA 9ICBA 3WFPA 2ZHBA 4O5EA 3OVBA 2ZH3A 4UBBA 4NKTA 3RJHA 3MBYA 2PFQA 4X4VA 4WC0A 4PHEA 4I2JA 4WC6A 5J0WA 4LZDA 4QZCA 4RPYA 2ISPA 4NLNA 1MIWA 8ICCA 4KLLA 3HX0A 4X4PA 3WFSC 3RH5A 4TUPA 1ZQFA 5J2GA 4QZ8A 1R8BA 4Z6EA 4M47A 1ZQTA 5J2IA 2B56A 2M2TA 4KLQA 1XSLA 2BCVA 4WBYA 2BCRA 7ICRA 1ZQZA 3B0XA 5J2DA 4RQ0A 4WBZA 5BOMA 7ICVA 3C66A 4AT9B 4M0AA 4DOAA 4TURA 4GXKA 4R65A 1ZQWA 7ICNA 3AQNA 4ATBB 5D4BA 4I29A 4P4OA 4UAZA 9ICWA 3UPQA 4GXIA 2BCQA 4JWMA 3RH4A 3OVSA 4E80A 1BPXA 4XA5A 3C5GA 4AT7A 2DR9A 4RWNA 4X0BA 4I2DA 3RJFA 4FHVA 7ICHA 4PGQA 1BPYA 3HWTA 5CP2A 5J0PA 4YN4A 4F5NA 3UXNA 4M9JA 1MIVA 1TFWA 4FHPA 4NXZA 3H38A 4TUSA 4F5QA 4I28A 3MDAA 4X5VA 4X4UA 3UPSA 5DB7A 4YD2A 1ZQGA 4K4IA 4IQWA 1KEJA 7ICIA 4MF2A 4I2FA 7ICJA 1HUOA 2PXIA 4M9LA 4KLIA 5J29A 1NOMA 7ICFA 3JPOA 5CJ7A 3WFQE 4IQTA 2Q66A 2DR8A 9ICOA 5J2CA 2O1PA 8ICVA 4R63A 4RQ1A 1JN3A 8ICRA 5IIOA 4JWNA 4I2BA 2PBEA 5EOZA 5J0RA 2O5AA 2M2UA 4Z6FA 1F5AA 1OU5A 4KLTA 4Z6DA 3LK9A 1UETA 5J0UA 5J2KA 3HJ4A 3PMLA 3JYYA 5J2JA 4RQ4A 7ICUA 8ICMA 4RQ6A 7ICOA 5J0SA 8ICAA 4KLUA 4UB5A 4AT8A 1VJ7A 1R8CA 9ICVA 3AU6A 9ICRA 4UAYA 2ZH1A 8ICEA 5J2AA 1HUZA 5DB6A 5CA7A 4X4QA 2BCSA 3RJJA 4YMMA 9ICMA 3WFOA 4RQ3A 4R66A 1ZQXA 4KLDA 1Q78A 2ZH9A 9ICAA 4KLSA 8ICOA 4RT2A 4XQ8A 2ZH6A 9ICXA 2I9GA 3UQ2A 5HRIA 1ZQKA 4QZAA 3JPSA 7ICGA 3V7JA 1BPBA 1XSPA 5BOLA 8ICTA 4I27A 9ICGA 3AUOA 4RWPA 4KLGA 5J2BA 4EP7A 5IILA 1ZQPA 8ICNA 4MF8A 3OGUA 1WOTA 2W9MA 1TFYA 3C18A 4AT7B 2RFFA 2DR7A 3WFRE 4QZGA 5HHHA 3PNCA 3HIYA 2DRAA 4IG8A 1JAJA 3C2LA 3V72A 4RWOA 4X0AA 9ICTA 4PPXA 4I2HA 3OVAA 2P66A 1ZQSA 3MDCA 4PGYA 4XQ7A 4YD1A 1MQ3A 3MGHA 3RJKA 3PMNA 4P4MA 4P4PA 4FO6A 9ICLA 7ICSA 5DBBA 4PHDA 5F2VO 1ZQOA 5DDYA 4MFCA 2B51A 4NLKA 2FMSA 3HJ1A 4QZEA 1UEVA 4MFAA 4RQ5A 2PFPA 4KLHA 3L9DA 1VFGA 2PFNA 4WC5A 3H37A 4YMNA 3ISBA 4WC2A 2DR5A 3AQKA 5DB8A 1R89A 5IIKA 1XSNA 1ZQHA 1YLQA 4NM2A 4X4SA 8ICFA 9ICFA 5IIIA 5HRGA 4YCXA 9ICKA 8ICYA 4RPXA 3OUYA 4UB3A 4XRHA
chains in the Genus database with same CATH superfamily
4FHWA 2BPGA 3RJIA 5CB1A 9ICSA 1V4AA 4LT6A 4AT8B 5BPCA 3ER8C 4DOCA 1BPDA 5HRHA 5DB9A 5D61A 5IIJA 1JMSA 1ZQBA 4X4RA 3JZ0A 4PHPA 4R64A 8ICUA 3V7KA 1ZQMA 4FHYA 3H39A 3PHZA 1ZQQA 4OAHA 1MQ2A 3NVOA 8ICIA 2ZH7A 3JPNA 4KB6A 4YMOA 5HRFA 5CWRA 5HHIA 4LVSA 4KLJA 4MFFA 5J2EA 1ZQJA 4NLZA 4EBKA 4QZHA 4WC4A 1ZQDA 4PH5A 5J0OA 4UB2A 4UD5A 4EEBA 3B0YA 4WC3A 4GXJA 4NXVA 8ICWA 1ZQAA 4LEVA 5DEDA 4UB1A 5HC9A 4F5OA 2M2VA 9ICJA 8ICSA 5HRLA 4KLOA 4UBCA 4WC1A 3JPPA 4RQ2A 1ZJMA 9ICCA 4NM1A 4TUQA 3LQCB 4WC7A 3AQMA 3NYBA 3JPTA 7ICMA 7ICPA 2FMQA 5D63A 4EBJA 5J0YA 2ZHAA 5HRKA 3RH6A 5J2HA 3C2MA 1RPLA 2BCUA 1ZJNA 4NXXA 1MIYA 4X4TA 4I2CA 2VANA 3C2KA 4M9GA 4PGXA 4M5DA 4LZGA 4FH5A 5DBAA 8ICJA 3K7DA 8ICPA 3JPRA 4RT3A 8ICXA 3K75D 1BPZA 4EV6A 4I2IA 4I2AA 4DOBA 4IQVA 7ICKA 1KDHA 1PX5A 1Q79A 5IINA 4M04A 5B3QA 2NRKA 4F5PA 1KNYA 5D46A 3TFSA 5D49A 3JCFA 3GDXA 5B3PA 1BPEA 3UXOA 3ER9B 4UAWA 3C5FA 4K97A 4N7RA 4QZDA 4XUSA 7ICTA 2HHPA 4NKUA 4O9MA 4KLMA 8ICLA 2HN2A 4RQ8A 5IIMA 4RWQA 4M9NA 1ZQVA 4Z6CA 3AQLA 1ZQIA 4I2GA 7ICQA 3OUYB 5CR0A 2B4VA 4M2YA 3AU2A 4M9HA 4AT9A 3UXPA 5HRBA 9ICQA 4O5CA 2GWSA 1NO5A 4K4GA 1TV9A 4ATBA 3ISDA 8ICGA 5DDMA 1JQRA 4QZBA 1ZQYA 2GAFD 3TFRA 5CHGA 9ICNA 3HW8A 3RJEA 4MKPA 2BPCA 5HR9A 7ICLA 4QZFA 2ZH2A 4I2EA 3V7LA 1ZQNA 4RPZA 4O68A 4K96A 8ICBA 5TZVA 2BE3A 4KLFA 8ICZA 4QZIA 4K4HA 2ZH8A 2M2WA 8ICQA 4IQUA 1ZQUA 8ICKA 1TVAA 2BPFA 4NY8A 4KLEA 4K99A 4F5RA 2DRBA 5HRDA 8ICHA 1ZQCA 1ZQLA 4FH3A 5J0TA 3CK6A 4X4OA 3ISCA 3OV7A 5DKWA 4E8FA 1UEUA 4FHXA 9ICHA 2IHMA 2PFOA 3JPQA 3H3AA 4PHAA 1FA0A 5J2FA 5J0XA 2ID1A 3MGIA 5J0QA 4RQ7A 2FMPA 3RJGA 5DBCA 1RZTA 2ZH4A 7ICEA 9ICPA 5DECA 4QZ9A 1ZQRA 2BBHA 1ZQEA 4O5KA 4DO9A 2BBJA 2DVIA 9ICUA 3UQ0A 4S3NA 2ZH5A 4UD4A 9ICIA 9ICEA 4X4NA 4UB4A 2ISOA 4P2HA 4WCWA 4E7XA 1R8AA 5HREA 9ICBA 3WFPA 2ZHBA 4O5EA 3OVBA 2ZH3A 4K8VA 4UBBA 4NKTA 3RJHA 3MBYA 2PFQA 4X4VA 4WC0A 4PHEA 4I2JA 4WC6A 5J0WA 5CFSA 4LZDA 3NKUA 4QZCA 4RPYA 2ISPA 4NLNA 1MIWA 8ICCA 4KLLA 5D62A 3HX0A 3NWIA 4X4PA 2IHOA 3WFSC 3RH5A 4TUPA 1ZQFA 5J2GA 4QZ8A 1R8BA 4Z6EA 4M47A 4OAIZ 1ZQTA 5J2IA 2B56A 2M2TA 4KLQA 1XSLA 2BCVA 4WBYA 2BCRA 7ICRA 5CFTA 1ZQZA 3B0XA 5J2DA 4RQ0A 4WBZA 5BOMA 7ICVA 3C66A 4AT9B 4M0AA 4DOAA 4TURA 4GXKA 4R65A 1ZQWA 7ICNA 4ATBB 3AQNA 5D4BA 1GPJA 4I29A 4P4OA 4UAZA 9ICWA 3UPQA 4GXIA 2BCQA 4JWMA 3RH4A 3OVSA 5JTGA 4E80A 1BPXA 4I0UA 4XA5A 3C5GA 4AT7A 2DR9A 4RWNA 4X0BA 4JLZA 4I2DA 4FO1A 2FCLA 4K9BA 3RJFA 4FHVA 4WOYA 7ICHA 4LEYA 4PGQA 1BPYA 4NXWA 3HWTA 5CP2A 5J0PA 4YN4A 4F5NA 3UXNA 4M9JA 4K9AA 1MIVA 1TFWA 4FHPA 4NXZA 3H38A 4TUSA 4F5QA 4I28A 3MDAA 4X5VA 4X4UA 3UPSA 5DB7A 4YD2A 1ZQGA 4K4IA 4IQWA 1KEJA 7ICIA 4MF2A 4I2FA 7ICJA 1HUOA 2PXIA 3MCRA 4M9LA 4KLIA 5J29A 1NOMA 7ICFA 3JPOA 5CJ7A 3WFQE 4IQTA 2Q66A 2DR8A 9ICOA 4OAFA 5J2CA 2O1PA 8ICVA 4R63A 4O69A 4RQ1A 1JN3A 8ICRA 5IIOA 4JWNA 4I2BA 2PBEA 5EOZA 5J0RA 4O67A 2O5AA 5CHEA 2M2UA 4Z6FA 1F5AA 3ERCC 1OU5A 4KLTA 4Z6DA 3LK9A 1UETA 5J0UA 4O6AA 5J2KA 3HJ4A 3PMLA 3JYYA 5J2JA 4RQ4A 7ICUA 8ICMA 4RQ6A 7ICOA 5J0SA 4JLXA 8ICAA 4KLUA 4AT8A 4UB5A 1VJ7A 1R8CA 9ICVA 3AU6A 9ICRA 4UAYA 2ZH1A 8ICEA 4EGWA 5J2AA 2EWRA 1HUZA 5DB6A 4X4QA 5CA7A 2BCSA 4NXUA 3RJJA 4WQLA 4YMMA 9ICMA 3EF2A 3WFOA 4RQ3A 4R66A 1ZQXA 4KLDA 1Q78A 2ZH9A 4XJEA 4LEWA 9ICAA 4KLSA 8ICOA 4KM5A 4RT2A 4XQ8A 2ZH6A 9ICXA 2I9GA 4WH5A 3OWGA 3UQ2A 5HRIA 1ZQKA 4QZAA 4LEZA 3JPSA 7ICGA 3V7JA 1BPBA 1XSPA 5BOLA 8ICTA 4I27A 9ICGA 2GA9D 3AUOA 4RWPA 4KLGA 5J2BA 4EP7A 5IILA 1ZQPA 8ICNA 4MF8A 3OGUA 1WOTA 2W9MA 4K98A 1TFYA 3C18A 4AT7B 2RFFA 2DR7A 3WFRE 4QZGA 5HHHA 3PNCA 3HIYA 2DRAA 4IG8A 1JAJA 3C2LA 3V72A 4RWOA 4X0AA 9ICTA 4PPXA 4I2HA 3OVAA 2P66A 1ZQSA 3MDCA 4PGYA 4XQ7A 4YD1A 1MQ3A 3MGHA 3RJKA 3PMNA 4P4MA 4P4PA 4FO6A 9ICLA 7ICSA 5DBBA 4PHDA 5F2VO 1ZQOA 5DDYA 4MFCA 2B51A 4NLKA 2FMSA 3HJ1A 4QZEA 1UEVA 4MFAA 4RQ5A 2PFPA 4KLHA 3L9DA 4EEDA 1VFGA 2PFNA 2HN1A 4HX0A 4WC5A 4OAGA 3H37A 4YMNA 2DR5A 4WC2A 3ISBA 3AQKA 5DB8A 1R89A 5IIKA 1XSNA 1ZQHA 1YLQA 4NXTA 4X4SA 4NM2A 8ICFA 9ICFA 5IIIA 5CFUA 4YCXA 5HRGA 9ICKA 8ICYA 2IUBA 4WQKA 4RPXA 3OUYA 4UB3A 4XRHA
chains in the Genus database with same CATH topology
4FHWA 2BPGA 3RJIA 5CB1A 9ICSA 1V4AA 4LT6A 4AT8B 5BPCA 4DOCA 1BPDA 5HRHA 5DB9A 5IIJA 1JMSA 1ZQBA 4X4RA 3JZ0A 4PHPA 4R64A 8ICUA 3V7KA 1ZQMA 4FHYA 3H39A 1ZQQA 4OAHA 1MQ2A 8ICIA 2ZH7A 3JPNA 4KB6A 4YMOA 5HRFA 5CWRA 5HHIA 4LVSA 4KLJA 4MFFA 5J2EA 1ZQJA 4NLZA 4EBKA 4QZHA 4WC4A 1ZQDA 4PH5A 5J0OA 4UB2A 4UD5A 4WC3A 3B0YA 4GXJA 4NXVA 8ICWA 1ZQAA 4LEVA 5DEDA 4UB1A 5HC9A 4F5OA 2M2VA 9ICJA 8ICSA 5HRLA 4KLOA 4UBCA 4WC1A 3JPPA 4RQ2A 1ZJMA 9ICCA 4NM1A 4TUQA 3LQCB 4WC7A 3AQMA 3NYBA 3JPTA 7ICMA 7ICPA 2FMQA 4EBJA 5J0YA 2ZHAA 5HRKA 3RH6A 5J2HA 3C2MA 1RPLA 2BCUA 1ZJNA 4NXXA 1MIYA 4X4TA 4I2CA 2VANA 3C2KA 4M9GA 4PGXA 4M5DA 4LZGA 4FH5A 5DBAA 8ICJA 8ICPA 3JPRA 4RT3A 8ICXA 3K75D 1BPZA 4I2IA 4I2AA 4DOBA 4IQVA 7ICKA 1KDHA 1PX5A 1Q79A 5IINA 4M04A 2NRKA 4F5PA 1KNYA 5D46A 3TFSA 5D49A 3GDXA 1BPEA 3UXOA 4UAWA 3C5FA 4K97A 4QZDA 4XUSA 7ICTA 2HHPA 4NKUA 4O9MA 4KLMA 8ICLA 4RQ8A 5IIMA 4RWQA 4M9NA 1ZQVA 4Z6CA 3AQLA 1ZQIA 4I2GA 7ICQA 3OUYB 5CR0A 2B4VA 4M2YA 3AU2A 4M9HA 4AT9A 3UXPA 5HRBA 9ICQA 4O5CA 2GWSA 1NO5A 4K4GA 1TV9A 4ATBA 3ISDA 8ICGA 5DDMA 1JQRA 4QZBA 1ZQYA 3TFRA 5CHGA 9ICNA 3HW8A 3RJEA 4MKPA 2BPCA 5HR9A 7ICLA 4QZFA 2ZH2A 4I2EA 3V7LA 1ZQNA 4RPZA 4O68A 4K96A 8ICBA 5TZVA 2BE3A 4KLFA 8ICZA 4QZIA 4K4HA 2ZH8A 2M2WA 8ICQA 4IQUA 1ZQUA 8ICKA 1TVAA 2BPFA 4NY8A 4KLEA 4K99A 4F5RA 2DRBA 5HRDA 8ICHA 1ZQCA 1ZQLA 4FH3A 5J0TA 4X4OA 3ISCA 3OV7A 5DKWA 4E8FA 1UEUA 4FHXA 9ICHA 2IHMA 2PFOA 3JPQA 3H3AA 4PHAA 1FA0A 5J2FA 5J0XA 2ID1A 3MGIA 5J0QA 4RQ7A 2FMPA 3RJGA 5DBCA 1RZTA 2ZH4A 7ICEA 9ICPA 5DECA 4QZ9A 1ZQRA 1ZQEA 4O5KA 4DO9A 2DVIA 9ICUA 3UQ0A 4S3NA 2ZH5A 4UD4A 9ICIA 9ICEA 4X4NA 4UB4A 2ISOA 4P2HA 4WCWA 4E7XA 1R8AA 5HREA 9ICBA 3WFPA 2ZHBA 4O5EA 3OVBA 2ZH3A 4K8VA 4UBBA 4NKTA 3RJHA 3MBYA 2PFQA 4X4VA 4WC0A 4PHEA 4I2JA 4WC6A 5J0WA 4LZDA 4QZCA 4RPYA 2ISPA 4NLNA 1MIWA 8ICCA 4KLLA 3HX0A 4X4PA 3WFSC 3RH5A 4TUPA 1ZQFA 5J2GA 4QZ8A 1R8BA 4Z6EA 4M47A 4OAIZ 1ZQTA 5J2IA 2B56A 2M2TA 4KLQA 1XSLA 2BCVA 4WBYA 2BCRA 7ICRA 1ZQZA 3B0XA 5J2DA 4RQ0A 4WBZA 5BOMA 7ICVA 3C66A 4AT9B 4M0AA 4DOAA 4TURA 4GXKA 4R65A 1ZQWA 7ICNA 4ATBB 3AQNA 5D4BA 4I29A 4P4OA 4UAZA 9ICWA 3UPQA 4GXIA 2BCQA 4JWMA 3RH4A 3OVSA 4E80A 1BPXA 4XA5A 3C5GA 4AT7A 2DR9A 4RWNA 4X0BA 4JLZA 4I2DA 4K9BA 3RJFA 4FHVA 4WOYA 7ICHA 4LEYA 4PGQA 1BPYA 4NXWA 3HWTA 5CP2A 5J0PA 4YN4A 4F5NA 3UXNA 4M9JA 4K9AA 1MIVA 1TFWA 4FHPA 4NXZA 3H38A 4TUSA 4F5QA 4I28A 3MDAA 4X5VA 4X4UA 3UPSA 5DB7A 4YD2A 1ZQGA 4K4IA 4IQWA 1KEJA 7ICIA 4MF2A 4I2FA 7ICJA 1HUOA 2PXIA 4M9LA 4KLIA 5J29A 1NOMA 7ICFA 3JPOA 5CJ7A 3WFQE 4IQTA 2Q66A 2DR8A 9ICOA 4OAFA 5J2CA 2O1PA 8ICVA 4R63A 4O69A 4RQ1A 1JN3A 8ICRA 5IIOA 4JWNA 4I2BA 2PBEA 5EOZA 5J0RA 4O67A 2O5AA 2M2UA 4Z6FA 1F5AA 1OU5A 4KLTA 4Z6DA 3LK9A 1UETA 5J0UA 4O6AA 5J2KA 3HJ4A 3PMLA 3JYYA 5J2JA 4RQ4A 7ICUA 8ICMA 4RQ6A 7ICOA 5J0SA 4JLXA 8ICAA 4KLUA 4AT8A 4UB5A 1VJ7A 1R8CA 9ICVA 3AU6A 9ICRA 4UAYA 2ZH1A 8ICEA 5J2AA 1HUZA 5DB6A 4X4QA 5CA7A 2BCSA 4NXUA 3RJJA 4YMMA 9ICMA 3WFOA 4RQ3A 4R66A 1ZQXA 4KLDA 1Q78A 2ZH9A 4LEWA 9ICAA 4KLSA 8ICOA 4KM5A 4RT2A 4XQ8A 2ZH6A 9ICXA 2I9GA 3UQ2A 5HRIA 1ZQKA 4QZAA 4LEZA 3JPSA 7ICGA 3V7JA 1BPBA 1XSPA 5BOLA 8ICTA 4I27A 9ICGA 3AUOA 4RWPA 4KLGA 5J2BA 4EP7A 5IILA 1ZQPA 8ICNA 4MF8A 3OGUA 1WOTA 2W9MA 4K98A 1TFYA 3C18A 4AT7B 2RFFA 2DR7A 3WFRE 4QZGA 5HHHA 3PNCA 3HIYA 2DRAA 4IG8A 1JAJA 3C2LA 3V72A 4RWOA 4X0AA 9ICTA 4PPXA 4I2HA 3OVAA 2P66A 1ZQSA 3MDCA 4PGYA 4XQ7A 4YD1A 1MQ3A 3MGHA 3RJKA 3PMNA 4P4MA 4P4PA 4FO6A 9ICLA 7ICSA 5DBBA 4PHDA 5F2VO 1ZQOA 5DDYA 4MFCA 2B51A 4NLKA 2FMSA 3HJ1A 4QZEA 1UEVA 4MFAA 4RQ5A 2PFPA 4KLHA 3L9DA 1VFGA 2PFNA 4WC5A 4OAGA 3H37A 4YMNA 2DR5A 4WC2A 3ISBA 3AQKA 5DB8A 1R89A 5IIKA 1XSNA 1ZQHA 1YLQA 4NXTA 4X4SA 4NM2A 8ICFA 9ICFA 5IIIA 5HRGA 4YCXA 9ICKA 8ICYA 4RPXA 3OUYA 4UB3A 4XRHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FHW A;  2BPG A;  3RJI A;  5CB1 A;  9ICS A;  1V4A A;  4LT6 A;  4AT8 B;  5BPC A;  4DOC A;  1BPD A;  5HRH A;  5DB9 A;  5IIJ A;  1JMS A;  1ZQB A;  4X4R A;  3JZ0 A;  4PHP A;  4R64 A;  8ICU A;  3V7K A;  1ZQM A;  4FHY A;  3H39 A;  1ZQQ A;  1MQ2 A;  8ICI A;  2ZH7 A;  3JPN A;  4YMO A;  5HRF A;  5CWR A;  5HHI A;  4LVS A;  4KLJ A;  4MFF A;  5J2E A;  1ZQJ A;  4NLZ A;  4EBK A;  4QZH A;  4WC4 A;  1ZQD A;  4PH5 A;  5J0O A;  4UB2 A;  4UD5 A;  4WC3 A;  3B0Y A;  4GXJ A;  8ICW A;  1ZQA A;  5DED A;  4UB1 A;  5HC9 A;  4F5O A;  2M2V A;  9ICJ A;  8ICS A;  5HRL A;  4KLO A;  4UBC A;  4WC1 A;  3JPP A;  4RQ2 A;  1ZJM A;  9ICC A;  4NM1 A;  4TUQ A;  3LQC B;  4WC7 A;  3AQM A;  3NYB A;  3JPT A;  7ICM A;  7ICP A;  2FMQ A;  4EBJ A;  5J0Y A;  5HRK A;  2ZHA A;  3RH6 A;  5J2H A;  3C2M A;  1RPL A;  2BCU A;  1ZJN A;  1MIY A;  4X4T A;  4I2C A;  2VAN A;  3C2K A;  4M9G A;  4PGX A;  4M5D A;  4LZG A;  4FH5 A;  5DBA A;  8ICJ A;  8ICP A;  3JPR A;  4RT3 A;  8ICX A;  3K75 D;  1BPZ A;  4I2I A;  4I2A A;  4DOB A;  4IQV A;  7ICK A;  1KDH A;  1PX5 A;  1Q79 A;  5IIN A;  4M04 A;  2NRK A;  4F5P A;  1KNY A;  5D46 A;  3TFS A;  5D49 A;  3GDX A;  1BPE A;  3UXO A;  4UAW A;  3C5F A;  4QZD A;  4XUS A;  7ICT A;  2HHP A;  4NKU A;  4O9M A;  4KLM A;  8ICL A;  4RQ8 A;  5IIM A;  4RWQ A;  4M9N A;  1ZQV A;  4Z6C A;  3AQL A;  1ZQI A;  4I2G A;  7ICQ A;  3OUY B;  5CR0 A;  2B4V A;  4M2Y A;  3AU2 A;  4M9H A;  4AT9 A;  3UXP A;  5HRB A;  9ICQ A;  4O5C A;  2GWS A;  1NO5 A;  4K4G A;  1TV9 A;  4ATB A;  3ISD A;  8ICG A;  5DDM A;  1JQR A;  4QZB A;  1ZQY A;  3TFR A;  5CHG A;  9ICN A;  3HW8 A;  3RJE A;  2BPC A;  5HR9 A;  7ICL A;  4QZF A;  2ZH2 A;  4I2E A;  3V7L A;  1ZQN A;  4RPZ A;  8ICB A;  5TZV A;  2BE3 A;  4KLF A;  8ICZ A;  4QZI A;  4K4H A;  2ZH8 A;  2M2W A;  8ICQ A;  4IQU A;  1ZQU A;  8ICK A;  1TVA A;  2BPF A;  4NY8 A;  4KLE A;  4F5R A;  2DRB A;  5HRD A;  8ICH A;  1ZQC A;  1ZQL A;  4FH3 A;  5J0T A;  4X4O A;  3ISC A;  3OV7 A;  5DKW A;  4E8F A;  1UEU A;  4FHX A;  9ICH A;  2IHM A;  2PFO A;  3JPQ A;  3H3A A;  4PHA A;  1FA0 A;  5J2F A;  5J0X A;  2ID1 A;  3MGI A;  5J0Q A;  4RQ7 A;  2FMP A;  3RJG A;  5DBC A;  1RZT A;  2ZH4 A;  7ICE A;  9ICP A;  5DEC A;  4QZ9 A;  1ZQR A;  1ZQE A;  4O5K A;  4DO9 A;  2DVI A;  9ICU A;  3UQ0 A;  4S3N A;  2ZH5 A;  4UD4 A;  9ICI A;  9ICE A;  4X4N A;  4UB4 A;  2ISO A;  4P2H A;  4WCW A;  4E7X A;  1R8A A;  5HRE A;  9ICB A;  3WFP A;  2ZHB A;  4O5E A;  3OVB A;  2ZH3 A;  4UBB A;  4NKT A;  3RJH A;  3MBY A;  2PFQ A;  4X4V A;  4WC0 A;  4PHE A;  4I2J A;  4WC6 A;  5J0W A;  4LZD A;  4QZC A;  4RPY A;  2ISP A;  4NLN A;  1MIW A;  8ICC A;  4KLL A;  3HX0 A;  4X4P A;  3WFS C;  3RH5 A;  4TUP A;  1ZQF A;  5J2G A;  4QZ8 A;  1R8B A;  4Z6E A;  4M47 A;  1ZQT A;  5J2I A;  2B56 A;  2M2T A;  4KLQ A;  1XSL A;  2BCV A;  4WBY A;  2BCR A;  7ICR A;  1ZQZ A;  3B0X A;  5J2D A;  4RQ0 A;  4WBZ A;  5BOM A;  7ICV A;  3C66 A;  4AT9 B;  4M0A A;  4DOA A;  4TUR A;  4GXK A;  4R65 A;  1ZQW A;  7ICN A;  3AQN A;  4ATB B;  5D4B A;  4I29 A;  4P4O A;  4UAZ A;  9ICW A;  3UPQ A;  4GXI A;  2BCQ A;  4JWM A;  3RH4 A;  3OVS A;  4E80 A;  1BPX A;  4XA5 A;  3C5G A;  4AT7 A;  2DR9 A;  4RWN A;  4X0B A;  4I2D A;  3RJF A;  4FHV A;  7ICH A;  4PGQ A;  1BPY A;  3HWT A;  5CP2 A;  5J0P A;  4YN4 A;  4F5N A;  3UXN A;  4M9J A;  1MIV A;  1TFW A;  4FHP A;  4NXZ A;  3H38 A;  4TUS A;  4F5Q A;  4I28 A;  3MDA A;  4X5V A;  4X4U A;  3UPS A;  5DB7 A;  4YD2 A;  1ZQG A;  4K4I A;  4IQW A;  1KEJ A;  7ICI A;  4MF2 A;  4I2F A;  7ICJ A;  1HUO A;  2PXI A;  4M9L A;  4KLI A;  5J29 A;  1NOM A;  7ICF A;  3JPO A;  5CJ7 A;  3WFQ E;  4IQT A;  2Q66 A;  2DR8 A;  9ICO A;  5J2C A;  2O1P A;  8ICV A;  4R63 A;  4RQ1 A;  1JN3 A;  8ICR A;  5IIO A;  4JWN A;  4I2B A;  2PBE A;  5EOZ A;  5J0R A;  2O5A A;  2M2U A;  4Z6F A;  1F5A A;  1OU5 A;  4KLT A;  4Z6D A;  3LK9 A;  1UET A;  5J0U A;  5J2K A;  3HJ4 A;  3PML A;  3JYY A;  5J2J A;  4RQ4 A;  7ICU A;  8ICM A;  4RQ6 A;  7ICO A;  5J0S A;  8ICA A;  4KLU A;  4UB5 A;  4AT8 A;  1VJ7 A;  1R8C A;  9ICV A;  3AU6 A;  9ICR A;  4UAY A;  2ZH1 A;  8ICE A;  5J2A A;  1HUZ A;  5DB6 A;  5CA7 A;  4X4Q A;  2BCS A;  3RJJ A;  4YMM A;  9ICM A;  3WFO A;  4RQ3 A;  4R66 A;  1ZQX A;  4KLD A;  1Q78 A;  2ZH9 A;  9ICA A;  4KLS A;  8ICO A;  4RT2 A;  4XQ8 A;  2ZH6 A;  9ICX A;  2I9G A;  3UQ2 A;  5HRI A;  1ZQK A;  4QZA A;  3JPS A;  7ICG A;  3V7J A;  1BPB A;  1XSP A;  5BOL A;  8ICT A;  4I27 A;  9ICG A;  3AUO A;  4RWP A;  4KLG A;  5J2B A;  4EP7 A;  5IIL A;  1ZQP A;  8ICN A;  4MF8 A;  3OGU A;  1WOT A;  2W9M A;  1TFY A;  3C18 A;  4AT7 B;  2RFF A;  2DR7 A;  3WFR E;  4QZG A;  5HHH A;  3PNC A;  3HIY A;  2DRA A;  4IG8 A;  1JAJ A;  3C2L A;  3V72 A;  4RWO A;  4X0A A;  9ICT A;  4PPX A;  4I2H A;  3OVA A;  2P66 A;  1ZQS A;  3MDC A;  4PGY A;  4XQ7 A;  4YD1 A;  1MQ3 A;  3MGH A;  3RJK A;  3PMN A;  4P4M A;  4P4P A;  4FO6 A;  9ICL A;  7ICS A;  5DBB A;  4PHD A;  5F2V O;  1ZQO A;  5DDY A;  4MFC A;  2B51 A;  4NLK A;  2FMS A;  3HJ1 A;  4QZE A;  1UEV A;  4MFA A;  4RQ5 A;  2PFP A;  4KLH A;  3L9D A;  1VFG A;  2PFN A;  4WC5 A;  3H37 A;  4YMN A;  3ISB A;  4WC2 A;  2DR5 A;  3AQK A;  5DB8 A;  1R89 A;  5IIK A;  1XSN A;  1ZQH A;  1YLQ A;  4NM2 A;  4X4S A;  8ICF A;  9ICF A;  5III A;  5HRG A;  4YCX A;  9ICK A;  8ICY A;  4RPX A;  3OUY A;  4UB3 A;  4XRH A; 
#chains in the Genus database with same CATH topology
 4FHW A;  2BPG A;  3RJI A;  5CB1 A;  9ICS A;  1V4A A;  4LT6 A;  4AT8 B;  5BPC A;  3ER8 C;  4DOC A;  1BPD A;  5HRH A;  5DB9 A;  5D61 A;  5IIJ A;  1JMS A;  1ZQB A;  4X4R A;  3JZ0 A;  4PHP A;  4R64 A;  8ICU A;  3V7K A;  1ZQM A;  4FHY A;  3H39 A;  3PHZ A;  1ZQQ A;  4OAH A;  1MQ2 A;  3NVO A;  8ICI A;  2ZH7 A;  3JPN A;  4KB6 A;  4YMO A;  5HRF A;  5CWR A;  5HHI A;  4LVS A;  4KLJ A;  4MFF A;  5J2E A;  1ZQJ A;  4NLZ A;  4EBK A;  4QZH A;  4WC4 A;  1ZQD A;  4PH5 A;  5J0O A;  4UB2 A;  4UD5 A;  4EEB A;  3B0Y A;  4WC3 A;  4GXJ A;  4NXV A;  8ICW A;  1ZQA A;  4LEV A;  5DED A;  4UB1 A;  5HC9 A;  4F5O A;  2M2V A;  9ICJ A;  8ICS A;  5HRL A;  4KLO A;  4UBC A;  4WC1 A;  3JPP A;  4RQ2 A;  1ZJM A;  9ICC A;  4NM1 A;  4TUQ A;  3LQC B;  4WC7 A;  3AQM A;  3NYB A;  3JPT A;  7ICM A;  7ICP A;  2FMQ A;  5D63 A;  4EBJ A;  5J0Y A;  2ZHA A;  5HRK A;  3RH6 A;  5J2H A;  3C2M A;  1RPL A;  2BCU A;  1ZJN A;  4NXX A;  1MIY A;  4X4T A;  4I2C A;  2VAN A;  3C2K A;  4M9G A;  4PGX A;  4M5D A;  4LZG A;  4FH5 A;  5DBA A;  8ICJ A;  3K7D A;  8ICP A;  3JPR A;  4RT3 A;  8ICX A;  3K75 D;  1BPZ A;  4EV6 A;  4I2I A;  4I2A A;  4DOB A;  4IQV A;  7ICK A;  1KDH A;  1PX5 A;  1Q79 A;  5IIN A;  4M04 A;  5B3Q A;  2NRK A;  4F5P A;  1KNY A;  5D46 A;  3TFS A;  5D49 A;  3JCF A;  3GDX A;  5B3P A;  1BPE A;  3UXO A;  3ER9 B;  4UAW A;  3C5F A;  4K97 A;  4N7R A;  4QZD A;  4XUS A;  7ICT A;  2HHP A;  4NKU A;  4O9M A;  4KLM A;  8ICL A;  2HN2 A;  4RQ8 A;  5IIM A;  4RWQ A;  4M9N A;  1ZQV A;  4Z6C A;  3AQL A;  1ZQI A;  4I2G A;  7ICQ A;  3OUY B;  5CR0 A;  2B4V A;  4M2Y A;  3AU2 A;  4M9H A;  4AT9 A;  3UXP A;  5HRB A;  9ICQ A;  4O5C A;  2GWS A;  1NO5 A;  4K4G A;  1TV9 A;  4ATB A;  3ISD A;  8ICG A;  5DDM A;  1JQR A;  4QZB A;  1ZQY A;  2GAF D;  3TFR A;  5CHG A;  9ICN A;  3HW8 A;  3RJE A;  4MKP A;  2BPC A;  5HR9 A;  7ICL A;  4QZF A;  2ZH2 A;  4I2E A;  3V7L A;  1ZQN A;  4RPZ A;  4O68 A;  4K96 A;  8ICB A;  5TZV A;  2BE3 A;  4KLF A;  8ICZ A;  4QZI A;  4K4H A;  2ZH8 A;  2M2W A;  8ICQ A;  4IQU A;  1ZQU A;  8ICK A;  1TVA A;  2BPF A;  4NY8 A;  4KLE A;  4K99 A;  4F5R A;  2DRB A;  5HRD A;  8ICH A;  1ZQC A;  1ZQL A;  4FH3 A;  5J0T A;  3CK6 A;  4X4O A;  3ISC A;  3OV7 A;  5DKW A;  4E8F A;  1UEU A;  4FHX A;  9ICH A;  2IHM A;  2PFO A;  3JPQ A;  3H3A A;  4PHA A;  1FA0 A;  5J2F A;  5J0X A;  2ID1 A;  3MGI A;  5J0Q A;  4RQ7 A;  2FMP A;  3RJG A;  5DBC A;  1RZT A;  2ZH4 A;  7ICE A;  9ICP A;  5DEC A;  4QZ9 A;  1ZQR A;  2BBH A;  1ZQE A;  4O5K A;  4DO9 A;  2BBJ A;  2DVI A;  9ICU A;  3UQ0 A;  4S3N A;  2ZH5 A;  4UD4 A;  9ICI A;  9ICE A;  4X4N A;  4UB4 A;  2ISO A;  4P2H A;  4WCW A;  4E7X A;  1R8A A;  5HRE A;  9ICB A;  3WFP A;  2ZHB A;  4O5E A;  3OVB A;  2ZH3 A;  4K8V A;  4UBB A;  4NKT A;  3RJH A;  3MBY A;  2PFQ A;  4X4V A;  4WC0 A;  4PHE A;  4I2J A;  4WC6 A;  5J0W A;  5CFS A;  4LZD A;  3NKU A;  4QZC A;  4RPY A;  2ISP A;  4NLN A;  1MIW A;  8ICC A;  4KLL A;  5D62 A;  3HX0 A;  3NWI A;  4X4P A;  2IHO A;  3WFS C;  3RH5 A;  4TUP A;  1ZQF A;  5J2G A;  4QZ8 A;  1R8B A;  4Z6E A;  4M47 A;  4OAI Z;  1ZQT A;  5J2I A;  2B56 A;  2M2T A;  4KLQ A;  1XSL A;  2BCV A;  4WBY A;  2BCR A;  7ICR A;  5CFT A;  1ZQZ A;  3B0X A;  5J2D A;  4RQ0 A;  4WBZ A;  5BOM A;  7ICV A;  3C66 A;  4AT9 B;  4M0A A;  4DOA A;  4TUR A;  4GXK A;  4R65 A;  1ZQW A;  7ICN A;  4ATB B;  3AQN A;  5D4B A;  1GPJ A;  4I29 A;  4P4O A;  4UAZ A;  9ICW A;  3UPQ A;  4GXI A;  2BCQ A;  4JWM A;  3RH4 A;  3OVS A;  5JTG A;  4E80 A;  1BPX A;  4I0U A;  4XA5 A;  3C5G A;  4AT7 A;  2DR9 A;  4RWN A;  4X0B A;  4JLZ A;  4I2D A;  4FO1 A;  2FCL A;  4K9B A;  3RJF A;  4FHV A;  4WOY A;  7ICH A;  4LEY A;  4PGQ A;  1BPY A;  4NXW A;  3HWT A;  5CP2 A;  5J0P A;  4YN4 A;  4F5N A;  3UXN A;  4M9J A;  4K9A A;  1MIV A;  1TFW A;  4FHP A;  4NXZ A;  3H38 A;  4TUS A;  4F5Q A;  4I28 A;  3MDA A;  4X5V A;  4X4U A;  3UPS A;  5DB7 A;  4YD2 A;  1ZQG A;  4K4I A;  4IQW A;  1KEJ A;  7ICI A;  4MF2 A;  4I2F A;  7ICJ A;  1HUO A;  2PXI A;  3MCR A;  4M9L A;  4KLI A;  5J29 A;  1NOM A;  7ICF A;  3JPO A;  5CJ7 A;  3WFQ E;  4IQT A;  2Q66 A;  2DR8 A;  9ICO A;  4OAF A;  5J2C A;  2O1P A;  8ICV A;  4R63 A;  4O69 A;  4RQ1 A;  1JN3 A;  8ICR A;  5IIO A;  4JWN A;  4I2B A;  2PBE A;  5EOZ A;  5J0R A;  4O67 A;  2O5A A;  5CHE A;  2M2U A;  4Z6F A;  1F5A A;  3ERC C;  1OU5 A;  4KLT A;  4Z6D A;  3LK9 A;  1UET A;  5J0U A;  4O6A A;  5J2K A;  3HJ4 A;  3PML A;  3JYY A;  5J2J A;  4RQ4 A;  7ICU A;  8ICM A;  4RQ6 A;  7ICO A;  5J0S A;  4JLX A;  8ICA A;  4KLU A;  4AT8 A;  4UB5 A;  1VJ7 A;  1R8C A;  9ICV A;  3AU6 A;  9ICR A;  4UAY A;  2ZH1 A;  8ICE A;  4EGW A;  5J2A A;  2EWR A;  1HUZ A;  5DB6 A;  4X4Q A;  5CA7 A;  2BCS A;  4NXU A;  3RJJ A;  4WQL A;  4YMM A;  9ICM A;  3EF2 A;  3WFO A;  4RQ3 A;  4R66 A;  1ZQX A;  4KLD A;  1Q78 A;  2ZH9 A;  4XJE A;  4LEW A;  9ICA A;  4KLS A;  8ICO A;  4KM5 A;  4RT2 A;  4XQ8 A;  2ZH6 A;  9ICX A;  2I9G A;  4WH5 A;  3OWG A;  3UQ2 A;  5HRI A;  1ZQK A;  4QZA A;  4LEZ A;  3JPS A;  7ICG A;  3V7J A;  1BPB A;  1XSP A;  5BOL A;  8ICT A;  4I27 A;  9ICG A;  2GA9 D;  3AUO A;  4RWP A;  4KLG A;  5J2B A;  4EP7 A;  5IIL A;  1ZQP A;  8ICN A;  4MF8 A;  3OGU A;  1WOT A;  2W9M A;  4K98 A;  1TFY A;  3C18 A;  4AT7 B;  2RFF A;  2DR7 A;  3WFR E;  4QZG A;  5HHH A;  3PNC A;  3HIY A;  2DRA A;  4IG8 A;  1JAJ A;  3C2L A;  3V72 A;  4RWO A;  4X0A A;  9ICT A;  4PPX A;  4I2H A;  3OVA A;  2P66 A;  1ZQS A;  3MDC A;  4PGY A;  4XQ7 A;  4YD1 A;  1MQ3 A;  3MGH A;  3RJK A;  3PMN A;  4P4M A;  4P4P A;  4FO6 A;  9ICL A;  7ICS A;  5DBB A;  4PHD A;  5F2V O;  1ZQO A;  5DDY A;  4MFC A;  2B51 A;  4NLK A;  2FMS A;  3HJ1 A;  4QZE A;  1UEV A;  4MFA A;  4RQ5 A;  2PFP A;  4KLH A;  3L9D A;  4EED A;  1VFG A;  2PFN A;  2HN1 A;  4HX0 A;  4WC5 A;  4OAG A;  3H37 A;  4YMN A;  2DR5 A;  4WC2 A;  3ISB A;  3AQK A;  5DB8 A;  1R89 A;  5IIK A;  1XSN A;  1ZQH A;  1YLQ A;  4NXT A;  4X4S A;  4NM2 A;  8ICF A;  9ICF A;  5III A;  5CFU A;  4YCX A;  5HRG A;  9ICK A;  8ICY A;  2IUB A;  4WQK A;  4RPX A;  3OUY A;  4UB3 A;  4XRH A; 
#chains in the Genus database with same CATH homology
 4FHW A;  2BPG A;  3RJI A;  5CB1 A;  9ICS A;  1V4A A;  4LT6 A;  4AT8 B;  5BPC A;  4DOC A;  1BPD A;  5HRH A;  5DB9 A;  5IIJ A;  1JMS A;  1ZQB A;  4X4R A;  3JZ0 A;  4PHP A;  4R64 A;  8ICU A;  3V7K A;  1ZQM A;  4FHY A;  3H39 A;  1ZQQ A;  4OAH A;  1MQ2 A;  8ICI A;  2ZH7 A;  3JPN A;  4KB6 A;  4YMO A;  5HRF A;  5CWR A;  5HHI A;  4LVS A;  4KLJ A;  4MFF A;  5J2E A;  1ZQJ A;  4NLZ A;  4EBK A;  4QZH A;  4WC4 A;  1ZQD A;  4PH5 A;  5J0O A;  4UB2 A;  4UD5 A;  4WC3 A;  3B0Y A;  4GXJ A;  4NXV A;  8ICW A;  1ZQA A;  4LEV A;  5DED A;  4UB1 A;  5HC9 A;  4F5O A;  2M2V A;  9ICJ A;  8ICS A;  5HRL A;  4KLO A;  4UBC A;  4WC1 A;  3JPP A;  4RQ2 A;  1ZJM A;  9ICC A;  4NM1 A;  4TUQ A;  3LQC B;  4WC7 A;  3AQM A;  3NYB A;  3JPT A;  7ICM A;  7ICP A;  2FMQ A;  4EBJ A;  5J0Y A;  2ZHA A;  5HRK A;  3RH6 A;  5J2H A;  3C2M A;  1RPL A;  2BCU A;  1ZJN A;  4NXX A;  1MIY A;  4X4T A;  4I2C A;  2VAN A;  3C2K A;  4M9G A;  4PGX A;  4M5D A;  4LZG A;  4FH5 A;  5DBA A;  8ICJ A;  8ICP A;  3JPR A;  4RT3 A;  8ICX A;  3K75 D;  1BPZ A;  4I2I A;  4I2A A;  4DOB A;  4IQV A;  7ICK A;  1KDH A;  1PX5 A;  1Q79 A;  5IIN A;  4M04 A;  2NRK A;  4F5P A;  1KNY A;  5D46 A;  3TFS A;  5D49 A;  3GDX A;  1BPE A;  3UXO A;  4UAW A;  3C5F A;  4K97 A;  4QZD A;  4XUS A;  7ICT A;  2HHP A;  4NKU A;  4O9M A;  4KLM A;  8ICL A;  4RQ8 A;  5IIM A;  4RWQ A;  4M9N A;  1ZQV A;  4Z6C A;  3AQL A;  1ZQI A;  4I2G A;  7ICQ A;  3OUY B;  5CR0 A;  2B4V A;  4M2Y A;  3AU2 A;  4M9H A;  4AT9 A;  3UXP A;  5HRB A;  9ICQ A;  4O5C A;  2GWS A;  1NO5 A;  4K4G A;  1TV9 A;  4ATB A;  3ISD A;  8ICG A;  5DDM A;  1JQR A;  4QZB A;  1ZQY A;  3TFR A;  5CHG A;  9ICN A;  3HW8 A;  3RJE A;  4MKP A;  2BPC A;  5HR9 A;  7ICL A;  4QZF A;  2ZH2 A;  4I2E A;  3V7L A;  1ZQN A;  4RPZ A;  4O68 A;  4K96 A;  8ICB A;  5TZV A;  2BE3 A;  4KLF A;  8ICZ A;  4QZI A;  4K4H A;  2ZH8 A;  2M2W A;  8ICQ A;  4IQU A;  1ZQU A;  8ICK A;  1TVA A;  2BPF A;  4NY8 A;  4KLE A;  4K99 A;  4F5R A;  2DRB A;  5HRD A;  8ICH A;  1ZQC A;  1ZQL A;  4FH3 A;  5J0T A;  4X4O A;  3ISC A;  3OV7 A;  5DKW A;  4E8F A;  1UEU A;  4FHX A;  9ICH A;  2IHM A;  2PFO A;  3JPQ A;  3H3A A;  4PHA A;  1FA0 A;  5J2F A;  5J0X A;  2ID1 A;  3MGI A;  5J0Q A;  4RQ7 A;  2FMP A;  3RJG A;  5DBC A;  1RZT A;  2ZH4 A;  7ICE A;  9ICP A;  5DEC A;  4QZ9 A;  1ZQR A;  1ZQE A;  4O5K A;  4DO9 A;  2DVI A;  9ICU A;  3UQ0 A;  4S3N A;  2ZH5 A;  4UD4 A;  9ICI A;  9ICE A;  4X4N A;  4UB4 A;  2ISO A;  4P2H A;  4WCW A;  4E7X A;  1R8A A;  5HRE A;  9ICB A;  3WFP A;  2ZHB A;  4O5E A;  3OVB A;  2ZH3 A;  4K8V A;  4UBB A;  4NKT A;  3RJH A;  3MBY A;  2PFQ A;  4X4V A;  4WC0 A;  4PHE A;  4I2J A;  4WC6 A;  5J0W A;  4LZD A;  4QZC A;  4RPY A;  2ISP A;  4NLN A;  1MIW A;  8ICC A;  4KLL A;  3HX0 A;  4X4P A;  3WFS C;  3RH5 A;  4TUP A;  1ZQF A;  5J2G A;  4QZ8 A;  1R8B A;  4Z6E A;  4M47 A;  4OAI Z;  1ZQT A;  5J2I A;  2B56 A;  2M2T A;  4KLQ A;  1XSL A;  2BCV A;  4WBY A;  2BCR A;  7ICR A;  1ZQZ A;  3B0X A;  5J2D A;  4RQ0 A;  4WBZ A;  5BOM A;  7ICV A;  3C66 A;  4AT9 B;  4M0A A;  4DOA A;  4TUR A;  4GXK A;  4R65 A;  1ZQW A;  7ICN A;  4ATB B;  3AQN A;  5D4B A;  4I29 A;  4P4O A;  4UAZ A;  9ICW A;  3UPQ A;  4GXI A;  2BCQ A;  4JWM A;  3RH4 A;  3OVS A;  4E80 A;  1BPX A;  4XA5 A;  3C5G A;  4AT7 A;  2DR9 A;  4RWN A;  4X0B A;  4JLZ A;  4I2D A;  4K9B A;  3RJF A;  4FHV A;  4WOY A;  7ICH A;  4LEY A;  4PGQ A;  1BPY A;  4NXW A;  3HWT A;  5CP2 A;  5J0P A;  4YN4 A;  4F5N A;  3UXN A;  4M9J A;  4K9A A;  1MIV A;  1TFW A;  4FHP A;  4NXZ A;  3H38 A;  4TUS A;  4F5Q A;  4I28 A;  3MDA A;  4X5V A;  4X4U A;  3UPS A;  5DB7 A;  4YD2 A;  1ZQG A;  4K4I A;  4IQW A;  1KEJ A;  7ICI A;  4MF2 A;  4I2F A;  7ICJ A;  1HUO A;  2PXI A;  4M9L A;  4KLI A;  5J29 A;  1NOM A;  7ICF A;  3JPO A;  5CJ7 A;  3WFQ E;  4IQT A;  2Q66 A;  2DR8 A;  9ICO A;  4OAF A;  5J2C A;  2O1P A;  8ICV A;  4R63 A;  4O69 A;  4RQ1 A;  1JN3 A;  8ICR A;  5IIO A;  4JWN A;  4I2B A;  2PBE A;  5EOZ A;  5J0R A;  4O67 A;  2O5A A;  2M2U A;  4Z6F A;  1F5A A;  1OU5 A;  4KLT A;  4Z6D A;  3LK9 A;  1UET A;  5J0U A;  4O6A A;  5J2K A;  3HJ4 A;  3PML A;  3JYY A;  5J2J A;  4RQ4 A;  7ICU A;  8ICM A;  4RQ6 A;  7ICO A;  5J0S A;  4JLX A;  8ICA A;  4KLU A;  4AT8 A;  4UB5 A;  1VJ7 A;  1R8C A;  9ICV A;  3AU6 A;  9ICR A;  4UAY A;  2ZH1 A;  8ICE A;  5J2A A;  1HUZ A;  5DB6 A;  4X4Q A;  5CA7 A;  2BCS A;  4NXU A;  3RJJ A;  4YMM A;  9ICM A;  3WFO A;  4RQ3 A;  4R66 A;  1ZQX A;  4KLD A;  1Q78 A;  2ZH9 A;  4LEW A;  9ICA A;  4KLS A;  8ICO A;  4KM5 A;  4RT2 A;  4XQ8 A;  2ZH6 A;  9ICX A;  2I9G A;  3UQ2 A;  5HRI A;  1ZQK A;  4QZA A;  4LEZ A;  3JPS A;  7ICG A;  3V7J A;  1BPB A;  1XSP A;  5BOL A;  8ICT A;  4I27 A;  9ICG A;  3AUO A;  4RWP A;  4KLG A;  5J2B A;  4EP7 A;  5IIL A;  1ZQP A;  8ICN A;  4MF8 A;  3OGU A;  1WOT A;  2W9M A;  4K98 A;  1TFY A;  3C18 A;  4AT7 B;  2RFF A;  2DR7 A;  3WFR E;  4QZG A;  5HHH A;  3PNC A;  3HIY A;  2DRA A;  4IG8 A;  1JAJ A;  3C2L A;  3V72 A;  4RWO A;  4X0A A;  9ICT A;  4PPX A;  4I2H A;  3OVA A;  2P66 A;  1ZQS A;  3MDC A;  4PGY A;  4XQ7 A;  4YD1 A;  1MQ3 A;  3MGH A;  3RJK A;  3PMN A;  4P4M A;  4P4P A;  4FO6 A;  9ICL A;  7ICS A;  5DBB A;  4PHD A;  5F2V O;  1ZQO A;  5DDY A;  4MFC A;  2B51 A;  4NLK A;  2FMS A;  3HJ1 A;  4QZE A;  1UEV A;  4MFA A;  4RQ5 A;  2PFP A;  4KLH A;  3L9D A;  1VFG A;  2PFN A;  4WC5 A;  4OAG A;  3H37 A;  4YMN A;  2DR5 A;  4WC2 A;  3ISB A;  3AQK A;  5DB8 A;  1R89 A;  5IIK A;  1XSN A;  1ZQH A;  1YLQ A;  4NXT A;  4X4S A;  4NM2 A;  8ICF A;  9ICF A;  5III A;  5HRG A;  4YCX A;  9ICK A;  8ICY A;  4RPX A;  3OUY A;  4UB3 A;  4XRH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...