4FHXA

Crystal structures of the cid1 poly (u) polymerase reveal the mechanism for utp selectivity - h336n mutant bound to mgatp
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
338
structure length
323
Chain Sequence
SHKEFTKFCYEVYNEIKISDKEFKEKRAALDTLRLCLKRISPDAELVAFGSLESGLALKNSDMDLCVLMDSRVQSDTIALQFYEELIAEGFEGKFLQRARIPIIKLTSDTKNGFGASFQCDIGFNNRLAIHNTLLLSSYTKLDARLKPMVLLVKHWAKRKQINSPYFGTLSSYGYVLMVLYYLIHVIKPPVFPNLLLSPLKQEKIVDGFDVGFDDKLEDIPPSQNYSSLGSLLHGFFRFYAYKFEPREKVVTFRRPDGYLTKQEKGWTRYILAIEDPFEISNNVGRTVSSSGLYRIRGEFMAASRLLNSRSYPIPYDSLFEEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the Cid1 poly (U) polymerase reveal the mechanism for UTP selectivity.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transferase
molecule keywords Poly(A) RNA polymerase protein cid1
total genus 106
structure length 323
sequence length 338
ec nomenclature ec 2.7.7.19: Polynucleotide adenylyltransferase.
pdb deposition date 2012-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01909 NTP_transf_2 Nucleotidyltransferase domain
A PF03828 PAP_assoc Cid1 family poly A polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.10 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain Poly(a)-polymerase, middle domain 4fhxA01
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4fhxA02
4GXJA 5CB1A 5BPCA 4I2CA 4RQ4A 4QZ8A 4TURA 3V72A 4X4UA 4TUPA 4LVSA 8ICOA 2B56A 8ICMA 4O5EA 3UXPA 3TFRA 4YD1A 5HR9A 8ICSA 2PBEA 3B0YA 5J29A 4FHWA 1R8BA 4FHPA 9ICKA 8ICIA 2DR5A 4X4RA 9ICLA 1XSPA 4P4OA 3AQMA 7ICHA 1MQ2A 4X4QA 8ICAA 1TV9A 9ICRA 2M2WA 2DR9A 3HJ4A 5HRBA 4PHPA 4QZCA 4O5CA 4EBJA 4FO6A 3MGIA 4M9NA 4Z6EA 3JYYA 4RT3A 2M2TA 2O1PA 5DB9A 1VFGA 2ZH7A 4RWPA 1R8AA 3JPRA 3MGHA 7ICMA 7ICJA 1JQRA 7ICSA 4X4OA 3AQLA 4I2EA 7ICGA 4P4PA 3JPSA 3HX0A 5CHGA 2PFPA 4I2AA 4RWQA 4KLLA 5J0OA 7ICVA 2ZH4A 4UAWA 9ICBA 4M9LA 4KLHA 5J2FA 4JWMA 1ZQYA 3UPSA 2ZH8A 8ICLA 1MIWA 1ZQAA 1ZQIA 2DRBA 3WFOA 5J2IA 7ICLA 4S3NA 4DO9A 1ZQEA 1ZQSA 4RPXA 3C5GA 4PHAA 3OVAA 1ZQKA 4FH5A 3V7KA 4NM2A 5IIKA 4RQ5A 3RJEA 4LZDA 5DB8A 5BOLA 2FMPA 5TZVA 1MIYA 5J0YA 5CJ7A 9ICVA 8ICRA 2I9GA 7ICKA 3H39A 4PH5A 2BPCA 1ZQCA 3UXNA 1RPLA 4X4VA 4WC2A 3ISBA 4M9JA 4F5PA 4DOBA 3C2LA 1FA0A 2W9MA 4I2DA 3C18A 4KLSA 4X4TA 4R64A 7ICPA 9ICNA 4MFAA 5HHHA 1MIVA 3UQ2A 5J2JA 2P66A 2IHMA 5J2EA 3PMNA 8ICXA 9ICIA 5J2HA 1KNYA 1ZQQA 4TUQA 4WC5A 4UD5A 8ICTA 2ID1A 3OUYB 4XQ8A 9ICUA 4XRHA 4FHYA 4AT7B 1ZQHA 4I29A 4M9HA 1R89A 4PGQA 4P2HA 4WC1A 5IILA 1KEJA 1ZQBA 8ICZA 1ZQWA 4Z6DA 4WC3A 4KLIA 1V4AA 2DR7A 4NLZA 3HJ1A 5J0PA 5J0WA 4WBYA 5F2VO 2PFNA 4I2IA 2HHPA 5J2GA 2BPGA 4RQ8A 5HC9A 3HIYA 1BPDA 4GXIA 2ZH9A 5HRLA 3JPQA 5J2DA 2BCRA 7ICRA 4ATBA 1BPEA 9ICJA 1JN3A 3AU2A 2M2VA 4XQ7A 5DECA 1ZQMA 8ICJA 4NKTA 2BPFA 8ICEA 3AUOA 4AT9B 2ZHAA 4YD2A 3RH5A 1ZQDA 3UPQA 4K4IA 1ZQRA 8ICGA 4IQWA 4QZAA 1Q79A 8ICUA 9ICPA 4KLFA 1UEUA 4KLJA 3AQNA 5J2AA 9ICMA 4UAYA 3K75D 5HRFA 1BPBA 9ICCA 3LQCB 3B0XA 5DEDA 2M2UA 7ICIA 4EBKA 3HW8A 1VJ7A 4UB2A 5IIIA 3HWTA 7ICQA 5BOMA 2FMSA 9ICHA 3RJHA 9ICGA 4F5OA 4MFFA 1ZQLA 1F5AA 3MDCA 4NY8A 1ZQPA 3AU6A 5HRGA 3OGUA 3AQKA 4QZDA 2ZH2A 4X4NA 5CWRA 4RQ2A 1ZQNA 4F5RA 4DOCA 3C66A 4EP7A 4RPZA 4UBBA 4AT8B 4K4GA 4M2YA 4NKUA 4M47A 4KLGA 4KLOA 1RZTA 4AT9A 5HRDA 4I2JA 4GXKA 4PPXA 4IQUA 1XSNA 2GWSA 4PGXA 2RFFA 8ICHA 3PMLA 4JWNA 5CA7A 9ICEA 4IG8A 3UXOA 3WFQE 5IIOA 1ZJNA 4M5DA 4IQVA 3V7JA 1TVAA 4KLQA 4UB5A 5J0XA 5IIJA 4I2HA 5EOZA 4KLEA 4E80A 4X0AA 5DB6A 5HRIA 2PXIA 4QZIA 5HHIA 4R66A 4UBCA 3H3AA 1BPXA 3C5FA 1ZQTA 4WC7A 5HREA 3RJFA 4UB4A 2ZH6A 4K4HA 2B51A 4IQTA 4UB3A 1R8CA 4AT7A 5DB7A 1JMSA 5CP2A 4DOAA 7ICEA 8ICPA 5DBBA 4RPYA 4WBZA 1Q78A 4QZ9A 2ZH5A 4QZHA 1OU5A 3LK9A 2VANA 3H37A 2BCSA 4FH3A 4UB1A 4I27A 3WFRE 3OVBA 1UEVA 4WC0A 1HUOA 4Z6FA 4UAZA 1ZQVA 1ZQFA 4E8FA 4NXZA 4PHEA 4O5KA 4NLNA 4RQ6A 4LT6A 4I2BA 4QZFA 3C2KA 4M04A 3JZ0A 8ICNA 4QZGA 4KLTA 8ICFA 1BPYA 3JPOA 4LZGA 2B4VA 8ICBA 3GDXA 4RQ1A 3OUYA 4FHVA 2DVIA 3OVSA 1PX5A 4UD4A 4XA5A 2FMQA 4O9MA 1YLQA 2Q66A 1TFYA 9ICOA 1MQ3A 9ICWA 4MF8A 4PGYA 3RJJA 4R63A 1NO5A 3WFPA 2BCQA 3ISCA 5HRKA 2PFOA 9ICFA 4MF2A 2BCVA 5J2KA 2O5AA 3JPPA 2ISOA 4PHDA 3OV7A 1WOTA 5IIMA 8ICWA 4QZBA 8ICVA 4M0AA 1ZQUA 5CR0A 5J0UA 3RJKA 1UETA 8ICYA 3NYBA 4YMNA 4E7XA 1ZQXA 1ZQGA 4M9GA 4WCWA 4YMMA 4RQ3A 4I2GA 5DDMA 1KDHA 8ICKA 4X5VA 3L9DA 2ZH1A 2BE3A 1JAJA 9ICAA 3ISDA 7ICOA 5D4BA 5DBCA 5D49A 2PFQA 3RH4A 3UQ0A 9ICQA 3C2MA 5DKWA 3RJGA 2ISPA 4NLKA 5DBAA 3JPNA 7ICFA 4YCXA 4WC6A 3H38A 5J2CA 3RH6A 4AT8A 4RWOA 2ZH3A 5HRHA 1HUZA 1ZQOA 7ICNA 4P4MA 5J0QA 9ICTA 4YMOA 4KLDA 5J2BA 4KLMA 3MDAA 1ZJMA 9ICXA 4WC4A 1ZQJA 4I2FA 4MFCA 1BPZA 8ICCA 1ZQZA 3WFSC 4X4SA 3RJIA 2NRKA 2DR8A 5J0RA 4RT2A 4X4PA 4X0BA 7ICTA 3MBYA 3JPTA 5IINA 4ATBB 3V7LA 4XUSA 2BCUA 4RQ7A 8ICQA 4TUSA 1TFWA 1NOMA 5J0SA 4FHXA 4NM1A 4QZEA 3PNCA 7ICUA 4KLUA 5J0TA 2ZHBA 4I28A 4RWNA 4F5QA 4Z6CA 4R65A 3TFSA 2DRAA 5DDYA 4RQ0A 4F5NA 9ICSA 4YN4A 1XSLA 5D46A
chains in the Genus database with same CATH superfamily
3NVOA 4GXJA 5CB1A 5BPCA 4I2CA 4RQ4A 4QZ8A 4TURA 3V72A 4X4UA 4TUPA 4LVSA 8ICOA 2B56A 8ICMA 2HN2A 4O5EA 3UXPA 3TFRA 4YD1A 5HR9A 8ICSA 2PBEA 3B0YA 5J29A 4FHWA 1R8BA 4FHPA 9ICKA 8ICIA 2FCLA 2DR5A 4X4RA 1GPJA 9ICLA 4EEBA 1XSPA 4P4OA 3AQMA 3PHZA 7ICHA 1MQ2A 4X4QA 8ICAA 1TV9A 9ICRA 2DR9A 2M2WA 3HJ4A 5HRBA 4PHPA 4OAIZ 4QZCA 4O5CA 4EBJA 4FO6A 3MGIA 4M9NA 4Z6EA 3JYYA 4RT3A 2M2TA 2O1PA 5DB9A 1VFGA 2ZH7A 4RWPA 1R8AA 3JPRA 3MGHA 7ICMA 7ICJA 1JQRA 7ICSA 4X4OA 3CK6A 3AQLA 4I2EA 7ICGA 4P4PA 3JPSA 3HX0A 5CHGA 3EF2A 4EGWA 2PFPA 4I2AA 4RWQA 3NKUA 4KLLA 5J0OA 7ICVA 2ZH4A 4UAWA 9ICBA 4M9LA 4KLHA 5J2FA 4JWMA 1ZQYA 3UPSA 2ZH8A 8ICLA 1MIWA 5D63A 1ZQAA 1ZQIA 2DRBA 3WFOA 3OWGA 5J2IA 7ICLA 4S3NA 4DO9A 1ZQEA 5CFSA 1ZQSA 4RPXA 3C5GA 4PHAA 3OVAA 1ZQKA 4FH5A 4NXWA 3V7KA 4NM2A 5IIKA 4RQ5A 3RJEA 4LZDA 4NXTA 5DB8A 5BOLA 2FMPA 5TZVA 1MIYA 5J0YA 5CJ7A 9ICVA 8ICRA 2I9GA 7ICKA 3H39A 4PH5A 2BPCA 1ZQCA 3UXNA 1RPLA 4X4VA 4WC2A 3ISBA 4M9JA 4F5PA 4DOBA 3C2LA 1FA0A 2W9MA 4I2DA 3C18A 4KLSA 4X4TA 4R64A 4WQKA 7ICPA 2GA9D 3ER9B 9ICNA 4MFAA 5HHHA 1MIVA 3UQ2A 3ER8C 5J2JA 2P66A 2IHMA 5J2EA 3PMNA 8ICXA 9ICIA 5J2HA 1KNYA 1ZQQA 4TUQA 4WC5A 4UD5A 4K8VA 8ICTA 2ID1A 3OUYB 4XQ8A 9ICUA 4XRHA 4FHYA 4AT7B 1ZQHA 4I29A 4I0UA 4M9HA 1R89A 3ERCC 4PGQA 4NXXA 4P2HA 4WC1A 5IILA 1KEJA 1ZQBA 8ICZA 1ZQWA 4Z6DA 4WC3A 4KLIA 1V4AA 4K9BA 2DR7A 4NLZA 3HJ1A 5J0PA 5J0WA 4WBYA 5F2VO 2PFNA 4I2IA 2HHPA 5J2GA 2BPGA 4RQ8A 5HC9A 3HIYA 1BPDA 4GXIA 2ZH9A 4LEWA 5HRLA 3JPQA 2GAFD 5JTGA 5J2DA 2BCRA 7ICRA 4ATBA 1BPEA 9ICJA 1JN3A 3AU2A 2M2VA 4XQ7A 5DECA 1ZQMA 8ICJA 4NKTA 2BPFA 8ICEA 3AUOA 4AT9B 4NXVA 2ZHAA 4YD2A 3RH5A 1ZQDA 3UPQA 4K4IA 1ZQRA 8ICGA 4IQWA 4QZAA 1Q79A 8ICUA 9ICPA 4KLFA 4KB6A 1UEUA 4KLJA 3AQNA 4WH5A 5J2AA 9ICMA 4UAYA 3K75D 5HRFA 4O6AA 1BPBA 9ICCA 3LQCB 3B0XA 4LEVA 2M2UA 5DEDA 7ICIA 4EBKA 3HW8A 1VJ7A 4UB2A 5IIIA 3HWTA 2EWRA 7ICQA 5BOMA 2FMSA 9ICHA 3RJHA 9ICGA 4F5OA 4MFFA 1ZQLA 1F5AA 3MDCA 4NY8A 1ZQPA 3AU6A 5HRGA 3OGUA 3AQKA 2ZH2A 4QZDA 4X4NA 5CWRA 4RQ2A 1ZQNA 4F5RA 4DOCA 4MKPA 3C66A 4EP7A 4RPZA 4UBBA 4AT8B 2IUBA 4K4GA 4M2YA 4NKUA 4M47A 4KLGA 4KLOA 1RZTA 4AT9A 5HRDA 4I2JA 4GXKA 4PPXA 4IQUA 4OAHA 1XSNA 4PGXA 2GWSA 2RFFA 8ICHA 3PMLA 4JWNA 5CA7A 9ICEA 4IG8A 3UXOA 3WFQE 5IIOA 4NXUA 1ZJNA 4M5DA 4IQVA 3V7JA 1TVAA 4KLQA 4UB5A 2IHOA 5J0XA 5IIJA 4I2HA 4O67A 4K99A 4EEDA 5EOZA 4KLEA 4E80A 4WQLA 4X0AA 3MCRA 5DB6A 5HRIA 2PXIA 5CFUA 4QZIA 5HHIA 4K96A 4R66A 4UBCA 3H3AA 1BPXA 3C5FA 1ZQTA 4WC7A 5HREA 3RJFA 2ZH6A 4UB4A 4K4HA 5D62A 2B51A 4IQTA 4UB3A 1R8CA 4K9AA 4AT7A 5DB7A 1JMSA 5CP2A 4JLZA 4DOAA 7ICEA 8ICPA 5DBBA 4RPYA 4QZ9A 4WBZA 1Q78A 2ZH5A 4QZHA 1OU5A 3LK9A 2VANA 3H37A 4FO1A 2BCSA 4FH3A 4UB1A 3OVBA 3WFRE 4I27A 1UEVA 4WC0A 1HUOA 4Z6FA 4UAZA 1ZQVA 1ZQFA 4E8FA 4NXZA 4PHEA 4O5KA 4NLNA 4RQ6A 4LT6A 4I2BA 4QZFA 3C2KA 4M04A 3JZ0A 8ICNA 4QZGA 4KLTA 8ICFA 1BPYA 3JPOA 4LZGA 2B4VA 8ICBA 3GDXA 3OUYA 4RQ1A 4FHVA 2DVIA 4EV6A 3OVSA 1PX5A 4UD4A 4XA5A 4WOYA 2FMQA 4O9MA 1YLQA 2Q66A 4O69A 1TFYA 9ICOA 4LEZA 1MQ3A 9ICWA 4MF8A 4PGYA 3RJJA 4R63A 1NO5A 3WFPA 2BCQA 3ISCA 5HRKA 2PFOA 9ICFA 4MF2A 2BCVA 4HX0A 5J2KA 4LEYA 2O5AA 3JPPA 4PHDA 2ISOA 3OV7A 1WOTA 5IIMA 8ICWA 4QZBA 8ICVA 5D61A 1ZQUA 4M0AA 5CR0A 5J0UA 3RJKA 1UETA 8ICYA 3NYBA 4YMNA 4E7XA 1ZQXA 1ZQGA 4M9GA 4WCWA 4YMMA 4RQ3A 5CFTA 4I2GA 5DDMA 5B3PA 1KDHA 8ICKA 4X5VA 3L9DA 2ZH1A 2BE3A 1JAJA 9ICAA 3ISDA 2BBJA 7ICOA 5D4BA 5DBCA 5D49A 2PFQA 3RH4A 3UQ0A 9ICQA 3C2MA 5DKWA 3RJGA 2ISPA 4KM5A 4NLKA 5DBAA 3JPNA 7ICFA 4YCXA 4WC6A 3H38A 5J2CA 2BBHA 4AT8A 4RWOA 2ZH3A 3RH6A 4JLXA 5HRHA 1HUZA 1ZQOA 4XJEA 7ICNA 4P4MA 5J0QA 9ICTA 4YMOA 4KLDA 5J2BA 4KLMA 3MDAA 1ZJMA 9ICXA 4WC4A 4N7RA 1ZQJA 4I2FA 4MFCA 1BPZA 8ICCA 1ZQZA 3WFSC 4X4SA 4K98A 3RJIA 3K7DA 3NWIA 2NRKA 2DR8A 5J0RA 4RT2A 4X4PA 4X0BA 7ICTA 3JCFA 3MBYA 3JPTA 5IINA 5CHEA 4ATBB 4K97A 3V7LA 4XUSA 2BCUA 4RQ7A 8ICQA 4TUSA 1TFWA 1NOMA 5J0SA 4FHXA 4NM1A 4QZEA 3PNCA 7ICUA 4KLUA 5J0TA 2ZHBA 4I28A 4O68A 4OAGA 4RWNA 4F5QA 5B3QA 4Z6CA 2HN1A 4R65A 2DRAA 5DDYA 3TFSA 4RQ0A 4F5NA 9ICSA 4YN4A 4OAFA 1XSLA 5D46A
chains in the Genus database with same CATH topology
4GXJA 5CB1A 5BPCA 4I2CA 4RQ4A 4QZ8A 4TURA 3V72A 4X4UA 4TUPA 4LVSA 8ICOA 2B56A 8ICMA 4O5EA 3UXPA 3TFRA 4YD1A 5HR9A 8ICSA 2PBEA 3B0YA 5J29A 4FHWA 1R8BA 4FHPA 9ICKA 8ICIA 2DR5A 4X4RA 9ICLA 1XSPA 4P4OA 3AQMA 7ICHA 1MQ2A 4X4QA 8ICAA 1TV9A 9ICRA 2DR9A 2M2WA 3HJ4A 5HRBA 4PHPA 4OAIZ 4QZCA 4O5CA 4EBJA 4FO6A 3MGIA 4M9NA 4Z6EA 3JYYA 4RT3A 2M2TA 2O1PA 5DB9A 1VFGA 2ZH7A 4RWPA 1R8AA 3JPRA 3MGHA 7ICMA 7ICJA 1JQRA 7ICSA 4X4OA 3AQLA 4I2EA 7ICGA 4P4PA 3JPSA 3HX0A 5CHGA 2PFPA 4I2AA 4RWQA 4KLLA 5J0OA 7ICVA 2ZH4A 4UAWA 9ICBA 4M9LA 4KLHA 5J2FA 4JWMA 1ZQYA 3UPSA 2ZH8A 8ICLA 1MIWA 1ZQAA 1ZQIA 2DRBA 3WFOA 5J2IA 7ICLA 4S3NA 4DO9A 1ZQEA 1ZQSA 4RPXA 3C5GA 4PHAA 3OVAA 1ZQKA 4FH5A 4NXWA 3V7KA 4NM2A 5IIKA 4RQ5A 3RJEA 4LZDA 4NXTA 5DB8A 5BOLA 2FMPA 5TZVA 1MIYA 5J0YA 5CJ7A 9ICVA 8ICRA 2I9GA 7ICKA 3H39A 4PH5A 2BPCA 1ZQCA 3UXNA 1RPLA 4X4VA 4WC2A 3ISBA 4M9JA 4F5PA 4DOBA 3C2LA 1FA0A 2W9MA 4I2DA 3C18A 4KLSA 4X4TA 4R64A 7ICPA 9ICNA 4MFAA 5HHHA 1MIVA 3UQ2A 5J2JA 2P66A 2IHMA 5J2EA 3PMNA 8ICXA 9ICIA 5J2HA 1KNYA 1ZQQA 4TUQA 4WC5A 4UD5A 4K8VA 8ICTA 2ID1A 3OUYB 4XQ8A 9ICUA 4XRHA 4FHYA 4AT7B 1ZQHA 4I29A 4M9HA 1R89A 4PGQA 4NXXA 4P2HA 4WC1A 5IILA 1KEJA 1ZQBA 8ICZA 1ZQWA 4Z6DA 4WC3A 4KLIA 1V4AA 4K9BA 2DR7A 4NLZA 3HJ1A 5J0PA 5J0WA 4WBYA 5F2VO 2PFNA 4I2IA 2HHPA 5J2GA 2BPGA 4RQ8A 5HC9A 3HIYA 1BPDA 4GXIA 2ZH9A 4LEWA 5HRLA 3JPQA 5J2DA 2BCRA 7ICRA 4ATBA 1BPEA 9ICJA 1JN3A 3AU2A 2M2VA 4XQ7A 5DECA 1ZQMA 8ICJA 4NKTA 2BPFA 8ICEA 3AUOA 4AT9B 4NXVA 2ZHAA 4YD2A 3RH5A 1ZQDA 3UPQA 4K4IA 1ZQRA 8ICGA 4IQWA 4QZAA 1Q79A 8ICUA 9ICPA 4KLFA 4KB6A 1UEUA 4KLJA 3AQNA 5J2AA 9ICMA 4UAYA 3K75D 5HRFA 4O6AA 1BPBA 9ICCA 3LQCB 3B0XA 4LEVA 2M2UA 5DEDA 7ICIA 4EBKA 3HW8A 1VJ7A 4UB2A 5IIIA 3HWTA 7ICQA 5BOMA 2FMSA 9ICHA 3RJHA 9ICGA 4F5OA 4MFFA 1ZQLA 1F5AA 3MDCA 4NY8A 1ZQPA 3AU6A 5HRGA 3OGUA 3AQKA 2ZH2A 4QZDA 4X4NA 5CWRA 4RQ2A 1ZQNA 4F5RA 4DOCA 4MKPA 3C66A 4EP7A 4RPZA 4UBBA 4AT8B 4K4GA 4M2YA 4NKUA 4M47A 4KLGA 4KLOA 1RZTA 4AT9A 5HRDA 4I2JA 4GXKA 4PPXA 4IQUA 4OAHA 1XSNA 4PGXA 2GWSA 2RFFA 8ICHA 3PMLA 4JWNA 5CA7A 9ICEA 4IG8A 3UXOA 3WFQE 5IIOA 4NXUA 1ZJNA 4M5DA 4IQVA 3V7JA 1TVAA 4KLQA 4UB5A 5J0XA 5IIJA 4I2HA 4O67A 4K99A 5EOZA 4KLEA 4E80A 4X0AA 5DB6A 5HRIA 2PXIA 4QZIA 5HHIA 4K96A 4R66A 4UBCA 3H3AA 1BPXA 3C5FA 1ZQTA 4WC7A 5HREA 3RJFA 2ZH6A 4UB4A 4K4HA 2B51A 4IQTA 4UB3A 1R8CA 4K9AA 4AT7A 5DB7A 1JMSA 5CP2A 4JLZA 4DOAA 7ICEA 8ICPA 5DBBA 4RPYA 4WBZA 1Q78A 2ZH5A 4QZ9A 4QZHA 1OU5A 3LK9A 2VANA 3H37A 2BCSA 4FH3A 4UB1A 3OVBA 3WFRE 4I27A 1UEVA 4WC0A 1HUOA 4Z6FA 4UAZA 1ZQVA 1ZQFA 4E8FA 4NXZA 4PHEA 4O5KA 4NLNA 4RQ6A 4LT6A 4I2BA 4QZFA 3C2KA 4M04A 3JZ0A 8ICNA 4QZGA 4KLTA 8ICFA 1BPYA 3JPOA 4LZGA 2B4VA 8ICBA 3GDXA 3OUYA 4RQ1A 4FHVA 2DVIA 3OVSA 1PX5A 4UD4A 4XA5A 4WOYA 2FMQA 4O9MA 1YLQA 2Q66A 4O69A 1TFYA 9ICOA 4LEZA 1MQ3A 9ICWA 4MF8A 4PGYA 3RJJA 4R63A 1NO5A 3WFPA 2BCQA 3ISCA 5HRKA 2PFOA 9ICFA 4MF2A 2BCVA 5J2KA 4LEYA 2O5AA 3JPPA 4PHDA 2ISOA 3OV7A 1WOTA 5IIMA 8ICWA 4QZBA 8ICVA 4M0AA 1ZQUA 5CR0A 5J0UA 3RJKA 1UETA 8ICYA 3NYBA 4YMNA 4E7XA 1ZQXA 1ZQGA 4M9GA 4WCWA 4YMMA 4RQ3A 4I2GA 5DDMA 1KDHA 8ICKA 4X5VA 3L9DA 2ZH1A 2BE3A 1JAJA 9ICAA 3ISDA 7ICOA 5D4BA 5DBCA 5D49A 2PFQA 3RH4A 3UQ0A 9ICQA 3C2MA 5DKWA 3RJGA 2ISPA 4KM5A 4NLKA 5DBAA 3JPNA 7ICFA 4YCXA 4WC6A 3H38A 5J2CA 3RH6A 4AT8A 4RWOA 2ZH3A 4JLXA 5HRHA 1HUZA 1ZQOA 7ICNA 4P4MA 5J0QA 9ICTA 4YMOA 4KLDA 5J2BA 4KLMA 3MDAA 1ZJMA 9ICXA 4WC4A 1ZQJA 4I2FA 4MFCA 1BPZA 8ICCA 1ZQZA 3WFSC 4X4SA 4K98A 3RJIA 2NRKA 2DR8A 5J0RA 4RT2A 4X4PA 4X0BA 7ICTA 3MBYA 3JPTA 5IINA 4ATBB 4K97A 3V7LA 4XUSA 2BCUA 4RQ7A 8ICQA 4TUSA 1TFWA 1NOMA 5J0SA 4FHXA 4NM1A 4QZEA 3PNCA 7ICUA 4KLUA 5J0TA 2ZHBA 4I28A 4O68A 4OAGA 4RWNA 4F5QA 4Z6CA 4R65A 3TFSA 2DRAA 5DDYA 4RQ0A 4F5NA 9ICSA 4YN4A 4OAFA 1XSLA 5D46A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GXJ A;  5CB1 A;  5BPC A;  4I2C A;  4RQ4 A;  4QZ8 A;  4TUR A;  3V72 A;  4X4U A;  4TUP A;  4LVS A;  8ICO A;  2B56 A;  8ICM A;  4O5E A;  3UXP A;  3TFR A;  4YD1 A;  5HR9 A;  8ICS A;  2PBE A;  3B0Y A;  5J29 A;  4FHW A;  1R8B A;  4FHP A;  9ICK A;  8ICI A;  2DR5 A;  4X4R A;  9ICL A;  1XSP A;  4P4O A;  3AQM A;  7ICH A;  1MQ2 A;  4X4Q A;  8ICA A;  1TV9 A;  9ICR A;  2M2W A;  2DR9 A;  3HJ4 A;  5HRB A;  4PHP A;  4QZC A;  4O5C A;  4EBJ A;  4FO6 A;  3MGI A;  4M9N A;  4Z6E A;  3JYY A;  4RT3 A;  2M2T A;  2O1P A;  5DB9 A;  1VFG A;  2ZH7 A;  4RWP A;  1R8A A;  3JPR A;  3MGH A;  7ICM A;  7ICJ A;  1JQR A;  7ICS A;  4X4O A;  3AQL A;  4I2E A;  7ICG A;  4P4P A;  3JPS A;  3HX0 A;  5CHG A;  2PFP A;  4I2A A;  4RWQ A;  4KLL A;  5J0O A;  7ICV A;  2ZH4 A;  4UAW A;  9ICB A;  4M9L A;  4KLH A;  5J2F A;  4JWM A;  1ZQY A;  3UPS A;  2ZH8 A;  8ICL A;  1MIW A;  1ZQA A;  1ZQI A;  2DRB A;  3WFO A;  5J2I A;  7ICL A;  4S3N A;  4DO9 A;  1ZQE A;  1ZQS A;  4RPX A;  3C5G A;  4PHA A;  3OVA A;  1ZQK A;  4FH5 A;  3V7K A;  4NM2 A;  5IIK A;  4RQ5 A;  3RJE A;  4LZD A;  5DB8 A;  5BOL A;  2FMP A;  5TZV A;  1MIY A;  5J0Y A;  5CJ7 A;  9ICV A;  8ICR A;  2I9G A;  7ICK A;  3H39 A;  4PH5 A;  2BPC A;  1ZQC A;  3UXN A;  1RPL A;  4X4V A;  4WC2 A;  3ISB A;  4M9J A;  4F5P A;  4DOB A;  3C2L A;  1FA0 A;  2W9M A;  4I2D A;  3C18 A;  4KLS A;  4X4T A;  4R64 A;  7ICP A;  9ICN A;  4MFA A;  5HHH A;  1MIV A;  3UQ2 A;  5J2J A;  2P66 A;  2IHM A;  5J2E A;  3PMN A;  8ICX A;  9ICI A;  5J2H A;  1KNY A;  1ZQQ A;  4TUQ A;  4WC5 A;  4UD5 A;  8ICT A;  2ID1 A;  3OUY B;  4XQ8 A;  9ICU A;  4XRH A;  4FHY A;  4AT7 B;  1ZQH A;  4I29 A;  4M9H A;  1R89 A;  4PGQ A;  4P2H A;  4WC1 A;  5IIL A;  1KEJ A;  1ZQB A;  8ICZ A;  1ZQW A;  4Z6D A;  4WC3 A;  4KLI A;  1V4A A;  2DR7 A;  4NLZ A;  3HJ1 A;  5J0P A;  5J0W A;  4WBY A;  5F2V O;  2PFN A;  4I2I A;  2HHP A;  5J2G A;  2BPG A;  4RQ8 A;  5HC9 A;  3HIY A;  1BPD A;  4GXI A;  2ZH9 A;  5HRL A;  3JPQ A;  5J2D A;  2BCR A;  7ICR A;  4ATB A;  1BPE A;  9ICJ A;  1JN3 A;  3AU2 A;  2M2V A;  4XQ7 A;  5DEC A;  1ZQM A;  8ICJ A;  4NKT A;  2BPF A;  8ICE A;  3AUO A;  4AT9 B;  2ZHA A;  4YD2 A;  3RH5 A;  1ZQD A;  3UPQ A;  4K4I A;  1ZQR A;  8ICG A;  4IQW A;  4QZA A;  1Q79 A;  8ICU A;  9ICP A;  4KLF A;  1UEU A;  4KLJ A;  3AQN A;  5J2A A;  9ICM A;  4UAY A;  3K75 D;  5HRF A;  1BPB A;  9ICC A;  3LQC B;  3B0X A;  5DED A;  2M2U A;  7ICI A;  4EBK A;  3HW8 A;  1VJ7 A;  4UB2 A;  5III A;  3HWT A;  7ICQ A;  5BOM A;  2FMS A;  9ICH A;  3RJH A;  9ICG A;  4F5O A;  4MFF A;  1ZQL A;  1F5A A;  3MDC A;  4NY8 A;  1ZQP A;  3AU6 A;  5HRG A;  3OGU A;  3AQK A;  4QZD A;  2ZH2 A;  4X4N A;  5CWR A;  4RQ2 A;  1ZQN A;  4F5R A;  4DOC A;  3C66 A;  4EP7 A;  4RPZ A;  4UBB A;  4AT8 B;  4K4G A;  4M2Y A;  4NKU A;  4M47 A;  4KLG A;  4KLO A;  1RZT A;  4AT9 A;  5HRD A;  4I2J A;  4GXK A;  4PPX A;  4IQU A;  1XSN A;  2GWS A;  4PGX A;  2RFF A;  8ICH A;  3PML A;  4JWN A;  5CA7 A;  9ICE A;  4IG8 A;  3UXO A;  3WFQ E;  5IIO A;  1ZJN A;  4M5D A;  4IQV A;  3V7J A;  1TVA A;  4KLQ A;  4UB5 A;  5J0X A;  5IIJ A;  4I2H A;  5EOZ A;  4KLE A;  4E80 A;  4X0A A;  5DB6 A;  5HRI A;  2PXI A;  4QZI A;  5HHI A;  4R66 A;  4UBC A;  3H3A A;  1BPX A;  3C5F A;  1ZQT A;  4WC7 A;  5HRE A;  3RJF A;  4UB4 A;  2ZH6 A;  4K4H A;  2B51 A;  4IQT A;  4UB3 A;  1R8C A;  4AT7 A;  5DB7 A;  1JMS A;  5CP2 A;  4DOA A;  7ICE A;  8ICP A;  5DBB A;  4RPY A;  4WBZ A;  1Q78 A;  4QZ9 A;  2ZH5 A;  4QZH A;  1OU5 A;  3LK9 A;  2VAN A;  3H37 A;  2BCS A;  4FH3 A;  4UB1 A;  4I27 A;  3WFR E;  3OVB A;  1UEV A;  4WC0 A;  1HUO A;  4Z6F A;  4UAZ A;  1ZQV A;  1ZQF A;  4E8F A;  4NXZ A;  4PHE A;  4O5K A;  4NLN A;  4RQ6 A;  4LT6 A;  4I2B A;  4QZF A;  3C2K A;  4M04 A;  3JZ0 A;  8ICN A;  4QZG A;  4KLT A;  8ICF A;  1BPY A;  3JPO A;  4LZG A;  2B4V A;  8ICB A;  3GDX A;  4RQ1 A;  3OUY A;  4FHV A;  2DVI A;  3OVS A;  1PX5 A;  4UD4 A;  4XA5 A;  2FMQ A;  4O9M A;  1YLQ A;  2Q66 A;  1TFY A;  9ICO A;  1MQ3 A;  9ICW A;  4MF8 A;  4PGY A;  3RJJ A;  4R63 A;  1NO5 A;  3WFP A;  2BCQ A;  3ISC A;  5HRK A;  2PFO A;  9ICF A;  4MF2 A;  2BCV A;  5J2K A;  2O5A A;  3JPP A;  2ISO A;  4PHD A;  3OV7 A;  1WOT A;  5IIM A;  8ICW A;  4QZB A;  8ICV A;  4M0A A;  1ZQU A;  5CR0 A;  5J0U A;  3RJK A;  1UET A;  8ICY A;  3NYB A;  4YMN A;  4E7X A;  1ZQX A;  1ZQG A;  4M9G A;  4WCW A;  4YMM A;  4RQ3 A;  4I2G A;  5DDM A;  1KDH A;  8ICK A;  4X5V A;  3L9D A;  2ZH1 A;  2BE3 A;  1JAJ A;  9ICA A;  3ISD A;  7ICO A;  5D4B A;  5DBC A;  5D49 A;  2PFQ A;  3RH4 A;  3UQ0 A;  9ICQ A;  3C2M A;  5DKW A;  3RJG A;  2ISP A;  4NLK A;  5DBA A;  3JPN A;  7ICF A;  4YCX A;  4WC6 A;  3H38 A;  5J2C A;  3RH6 A;  4AT8 A;  4RWO A;  2ZH3 A;  5HRH A;  1HUZ A;  1ZQO A;  7ICN A;  4P4M A;  5J0Q A;  9ICT A;  4YMO A;  4KLD A;  5J2B A;  4KLM A;  3MDA A;  1ZJM A;  9ICX A;  4WC4 A;  1ZQJ A;  4I2F A;  4MFC A;  1BPZ A;  8ICC A;  1ZQZ A;  3WFS C;  4X4S A;  3RJI A;  2NRK A;  2DR8 A;  5J0R A;  4RT2 A;  4X4P A;  4X0B A;  7ICT A;  3MBY A;  3JPT A;  5IIN A;  4ATB B;  3V7L A;  4XUS A;  2BCU A;  4RQ7 A;  8ICQ A;  4TUS A;  1TFW A;  1NOM A;  5J0S A;  4FHX A;  4NM1 A;  4QZE A;  3PNC A;  7ICU A;  4KLU A;  5J0T A;  2ZHB A;  4I28 A;  4RWN A;  4F5Q A;  4Z6C A;  4R65 A;  3TFS A;  2DRA A;  5DDY A;  4RQ0 A;  4F5N A;  9ICS A;  4YN4 A;  1XSL A;  5D46 A; 
#chains in the Genus database with same CATH topology
 3NVO A;  4GXJ A;  5CB1 A;  5BPC A;  4I2C A;  4RQ4 A;  4QZ8 A;  4TUR A;  3V72 A;  4X4U A;  4TUP A;  4LVS A;  8ICO A;  2B56 A;  8ICM A;  2HN2 A;  4O5E A;  3UXP A;  3TFR A;  4YD1 A;  5HR9 A;  8ICS A;  2PBE A;  3B0Y A;  5J29 A;  4FHW A;  1R8B A;  4FHP A;  9ICK A;  8ICI A;  2FCL A;  2DR5 A;  4X4R A;  1GPJ A;  9ICL A;  4EEB A;  1XSP A;  4P4O A;  3AQM A;  3PHZ A;  7ICH A;  1MQ2 A;  4X4Q A;  8ICA A;  1TV9 A;  9ICR A;  2DR9 A;  2M2W A;  3HJ4 A;  5HRB A;  4PHP A;  4OAI Z;  4QZC A;  4O5C A;  4EBJ A;  4FO6 A;  3MGI A;  4M9N A;  4Z6E A;  3JYY A;  4RT3 A;  2M2T A;  2O1P A;  5DB9 A;  1VFG A;  2ZH7 A;  4RWP A;  1R8A A;  3JPR A;  3MGH A;  7ICM A;  7ICJ A;  1JQR A;  7ICS A;  4X4O A;  3CK6 A;  3AQL A;  4I2E A;  7ICG A;  4P4P A;  3JPS A;  3HX0 A;  5CHG A;  3EF2 A;  4EGW A;  2PFP A;  4I2A A;  4RWQ A;  3NKU A;  4KLL A;  5J0O A;  7ICV A;  2ZH4 A;  4UAW A;  9ICB A;  4M9L A;  4KLH A;  5J2F A;  4JWM A;  1ZQY A;  3UPS A;  2ZH8 A;  8ICL A;  1MIW A;  5D63 A;  1ZQA A;  1ZQI A;  2DRB A;  3WFO A;  3OWG A;  5J2I A;  7ICL A;  4S3N A;  4DO9 A;  1ZQE A;  5CFS A;  1ZQS A;  4RPX A;  3C5G A;  4PHA A;  3OVA A;  1ZQK A;  4FH5 A;  4NXW A;  3V7K A;  4NM2 A;  5IIK A;  4RQ5 A;  3RJE A;  4LZD A;  4NXT A;  5DB8 A;  5BOL A;  2FMP A;  5TZV A;  1MIY A;  5J0Y A;  5CJ7 A;  9ICV A;  8ICR A;  2I9G A;  7ICK A;  3H39 A;  4PH5 A;  2BPC A;  1ZQC A;  3UXN A;  1RPL A;  4X4V A;  4WC2 A;  3ISB A;  4M9J A;  4F5P A;  4DOB A;  3C2L A;  1FA0 A;  2W9M A;  4I2D A;  3C18 A;  4KLS A;  4X4T A;  4R64 A;  4WQK A;  7ICP A;  2GA9 D;  3ER9 B;  9ICN A;  4MFA A;  5HHH A;  1MIV A;  3UQ2 A;  3ER8 C;  5J2J A;  2P66 A;  2IHM A;  5J2E A;  3PMN A;  8ICX A;  9ICI A;  5J2H A;  1KNY A;  1ZQQ A;  4TUQ A;  4WC5 A;  4UD5 A;  4K8V A;  8ICT A;  2ID1 A;  3OUY B;  4XQ8 A;  9ICU A;  4XRH A;  4FHY A;  4AT7 B;  1ZQH A;  4I29 A;  4I0U A;  4M9H A;  1R89 A;  3ERC C;  4PGQ A;  4NXX A;  4P2H A;  4WC1 A;  5IIL A;  1KEJ A;  1ZQB A;  8ICZ A;  1ZQW A;  4Z6D A;  4WC3 A;  4KLI A;  1V4A A;  4K9B A;  2DR7 A;  4NLZ A;  3HJ1 A;  5J0P A;  5J0W A;  4WBY A;  5F2V O;  2PFN A;  4I2I A;  2HHP A;  5J2G A;  2BPG A;  4RQ8 A;  5HC9 A;  3HIY A;  1BPD A;  4GXI A;  2ZH9 A;  4LEW A;  5HRL A;  3JPQ A;  2GAF D;  5JTG A;  5J2D A;  2BCR A;  7ICR A;  4ATB A;  1BPE A;  9ICJ A;  1JN3 A;  3AU2 A;  2M2V A;  4XQ7 A;  5DEC A;  1ZQM A;  8ICJ A;  4NKT A;  2BPF A;  8ICE A;  3AUO A;  4AT9 B;  4NXV A;  2ZHA A;  4YD2 A;  3RH5 A;  1ZQD A;  3UPQ A;  4K4I A;  1ZQR A;  8ICG A;  4IQW A;  4QZA A;  1Q79 A;  8ICU A;  9ICP A;  4KLF A;  4KB6 A;  1UEU A;  4KLJ A;  3AQN A;  4WH5 A;  5J2A A;  9ICM A;  4UAY A;  3K75 D;  5HRF A;  4O6A A;  1BPB A;  9ICC A;  3LQC B;  3B0X A;  4LEV A;  2M2U A;  5DED A;  7ICI A;  4EBK A;  3HW8 A;  1VJ7 A;  4UB2 A;  5III A;  3HWT A;  2EWR A;  7ICQ A;  5BOM A;  2FMS A;  9ICH A;  3RJH A;  9ICG A;  4F5O A;  4MFF A;  1ZQL A;  1F5A A;  3MDC A;  4NY8 A;  1ZQP A;  3AU6 A;  5HRG A;  3OGU A;  3AQK A;  2ZH2 A;  4QZD A;  4X4N A;  5CWR A;  4RQ2 A;  1ZQN A;  4F5R A;  4DOC A;  4MKP A;  3C66 A;  4EP7 A;  4RPZ A;  4UBB A;  4AT8 B;  2IUB A;  4K4G A;  4M2Y A;  4NKU A;  4M47 A;  4KLG A;  4KLO A;  1RZT A;  4AT9 A;  5HRD A;  4I2J A;  4GXK A;  4PPX A;  4IQU A;  4OAH A;  1XSN A;  4PGX A;  2GWS A;  2RFF A;  8ICH A;  3PML A;  4JWN A;  5CA7 A;  9ICE A;  4IG8 A;  3UXO A;  3WFQ E;  5IIO A;  4NXU A;  1ZJN A;  4M5D A;  4IQV A;  3V7J A;  1TVA A;  4KLQ A;  4UB5 A;  2IHO A;  5J0X A;  5IIJ A;  4I2H A;  4O67 A;  4K99 A;  4EED A;  5EOZ A;  4KLE A;  4E80 A;  4WQL A;  4X0A A;  3MCR A;  5DB6 A;  5HRI A;  2PXI A;  5CFU A;  4QZI A;  5HHI A;  4K96 A;  4R66 A;  4UBC A;  3H3A A;  1BPX A;  3C5F A;  1ZQT A;  4WC7 A;  5HRE A;  3RJF A;  2ZH6 A;  4UB4 A;  4K4H A;  5D62 A;  2B51 A;  4IQT A;  4UB3 A;  1R8C A;  4K9A A;  4AT7 A;  5DB7 A;  1JMS A;  5CP2 A;  4JLZ A;  4DOA A;  7ICE A;  8ICP A;  5DBB A;  4RPY A;  4QZ9 A;  4WBZ A;  1Q78 A;  2ZH5 A;  4QZH A;  1OU5 A;  3LK9 A;  2VAN A;  3H37 A;  4FO1 A;  2BCS A;  4FH3 A;  4UB1 A;  3OVB A;  3WFR E;  4I27 A;  1UEV A;  4WC0 A;  1HUO A;  4Z6F A;  4UAZ A;  1ZQV A;  1ZQF A;  4E8F A;  4NXZ A;  4PHE A;  4O5K A;  4NLN A;  4RQ6 A;  4LT6 A;  4I2B A;  4QZF A;  3C2K A;  4M04 A;  3JZ0 A;  8ICN A;  4QZG A;  4KLT A;  8ICF A;  1BPY A;  3JPO A;  4LZG A;  2B4V A;  8ICB A;  3GDX A;  3OUY A;  4RQ1 A;  4FHV A;  2DVI A;  4EV6 A;  3OVS A;  1PX5 A;  4UD4 A;  4XA5 A;  4WOY A;  2FMQ A;  4O9M A;  1YLQ A;  2Q66 A;  4O69 A;  1TFY A;  9ICO A;  4LEZ A;  1MQ3 A;  9ICW A;  4MF8 A;  4PGY A;  3RJJ A;  4R63 A;  1NO5 A;  3WFP A;  2BCQ A;  3ISC A;  5HRK A;  2PFO A;  9ICF A;  4MF2 A;  2BCV A;  4HX0 A;  5J2K A;  4LEY A;  2O5A A;  3JPP A;  4PHD A;  2ISO A;  3OV7 A;  1WOT A;  5IIM A;  8ICW A;  4QZB A;  8ICV A;  5D61 A;  1ZQU A;  4M0A A;  5CR0 A;  5J0U A;  3RJK A;  1UET A;  8ICY A;  3NYB A;  4YMN A;  4E7X A;  1ZQX A;  1ZQG A;  4M9G A;  4WCW A;  4YMM A;  4RQ3 A;  5CFT A;  4I2G A;  5DDM A;  5B3P A;  1KDH A;  8ICK A;  4X5V A;  3L9D A;  2ZH1 A;  2BE3 A;  1JAJ A;  9ICA A;  3ISD A;  2BBJ A;  7ICO A;  5D4B A;  5DBC A;  5D49 A;  2PFQ A;  3RH4 A;  3UQ0 A;  9ICQ A;  3C2M A;  5DKW A;  3RJG A;  2ISP A;  4KM5 A;  4NLK A;  5DBA A;  3JPN A;  7ICF A;  4YCX A;  4WC6 A;  3H38 A;  5J2C A;  2BBH A;  4AT8 A;  4RWO A;  2ZH3 A;  3RH6 A;  4JLX A;  5HRH A;  1HUZ A;  1ZQO A;  4XJE A;  7ICN A;  4P4M A;  5J0Q A;  9ICT A;  4YMO A;  4KLD A;  5J2B A;  4KLM A;  3MDA A;  1ZJM A;  9ICX A;  4WC4 A;  4N7R A;  1ZQJ A;  4I2F A;  4MFC A;  1BPZ A;  8ICC A;  1ZQZ A;  3WFS C;  4X4S A;  4K98 A;  3RJI A;  3K7D A;  3NWI A;  2NRK A;  2DR8 A;  5J0R A;  4RT2 A;  4X4P A;  4X0B A;  7ICT A;  3JCF A;  3MBY A;  3JPT A;  5IIN A;  5CHE A;  4ATB B;  4K97 A;  3V7L A;  4XUS A;  2BCU A;  4RQ7 A;  8ICQ A;  4TUS A;  1TFW A;  1NOM A;  5J0S A;  4FHX A;  4NM1 A;  4QZE A;  3PNC A;  7ICU A;  4KLU A;  5J0T A;  2ZHB A;  4I28 A;  4O68 A;  4OAG A;  4RWN A;  4F5Q A;  5B3Q A;  4Z6C A;  2HN1 A;  4R65 A;  2DRA A;  5DDY A;  3TFS A;  4RQ0 A;  4F5N A;  9ICS A;  4YN4 A;  4OAF A;  1XSL A;  5D46 A; 
#chains in the Genus database with same CATH homology
 4GXJ A;  5CB1 A;  5BPC A;  4I2C A;  4RQ4 A;  4QZ8 A;  4TUR A;  3V72 A;  4X4U A;  4TUP A;  4LVS A;  8ICO A;  2B56 A;  8ICM A;  4O5E A;  3UXP A;  3TFR A;  4YD1 A;  5HR9 A;  8ICS A;  2PBE A;  3B0Y A;  5J29 A;  4FHW A;  1R8B A;  4FHP A;  9ICK A;  8ICI A;  2DR5 A;  4X4R A;  9ICL A;  1XSP A;  4P4O A;  3AQM A;  7ICH A;  1MQ2 A;  4X4Q A;  8ICA A;  1TV9 A;  9ICR A;  2DR9 A;  2M2W A;  3HJ4 A;  5HRB A;  4PHP A;  4OAI Z;  4QZC A;  4O5C A;  4EBJ A;  4FO6 A;  3MGI A;  4M9N A;  4Z6E A;  3JYY A;  4RT3 A;  2M2T A;  2O1P A;  5DB9 A;  1VFG A;  2ZH7 A;  4RWP A;  1R8A A;  3JPR A;  3MGH A;  7ICM A;  7ICJ A;  1JQR A;  7ICS A;  4X4O A;  3AQL A;  4I2E A;  7ICG A;  4P4P A;  3JPS A;  3HX0 A;  5CHG A;  2PFP A;  4I2A A;  4RWQ A;  4KLL A;  5J0O A;  7ICV A;  2ZH4 A;  4UAW A;  9ICB A;  4M9L A;  4KLH A;  5J2F A;  4JWM A;  1ZQY A;  3UPS A;  2ZH8 A;  8ICL A;  1MIW A;  1ZQA A;  1ZQI A;  2DRB A;  3WFO A;  5J2I A;  7ICL A;  4S3N A;  4DO9 A;  1ZQE A;  1ZQS A;  4RPX A;  3C5G A;  4PHA A;  3OVA A;  1ZQK A;  4FH5 A;  4NXW A;  3V7K A;  4NM2 A;  5IIK A;  4RQ5 A;  3RJE A;  4LZD A;  4NXT A;  5DB8 A;  5BOL A;  2FMP A;  5TZV A;  1MIY A;  5J0Y A;  5CJ7 A;  9ICV A;  8ICR A;  2I9G A;  7ICK A;  3H39 A;  4PH5 A;  2BPC A;  1ZQC A;  3UXN A;  1RPL A;  4X4V A;  4WC2 A;  3ISB A;  4M9J A;  4F5P A;  4DOB A;  3C2L A;  1FA0 A;  2W9M A;  4I2D A;  3C18 A;  4KLS A;  4X4T A;  4R64 A;  7ICP A;  9ICN A;  4MFA A;  5HHH A;  1MIV A;  3UQ2 A;  5J2J A;  2P66 A;  2IHM A;  5J2E A;  3PMN A;  8ICX A;  9ICI A;  5J2H A;  1KNY A;  1ZQQ A;  4TUQ A;  4WC5 A;  4UD5 A;  4K8V A;  8ICT A;  2ID1 A;  3OUY B;  4XQ8 A;  9ICU A;  4XRH A;  4FHY A;  4AT7 B;  1ZQH A;  4I29 A;  4M9H A;  1R89 A;  4PGQ A;  4NXX A;  4P2H A;  4WC1 A;  5IIL A;  1KEJ A;  1ZQB A;  8ICZ A;  1ZQW A;  4Z6D A;  4WC3 A;  4KLI A;  1V4A A;  4K9B A;  2DR7 A;  4NLZ A;  3HJ1 A;  5J0P A;  5J0W A;  4WBY A;  5F2V O;  2PFN A;  4I2I A;  2HHP A;  5J2G A;  2BPG A;  4RQ8 A;  5HC9 A;  3HIY A;  1BPD A;  4GXI A;  2ZH9 A;  4LEW A;  5HRL A;  3JPQ A;  5J2D A;  2BCR A;  7ICR A;  4ATB A;  1BPE A;  9ICJ A;  1JN3 A;  3AU2 A;  2M2V A;  4XQ7 A;  5DEC A;  1ZQM A;  8ICJ A;  4NKT A;  2BPF A;  8ICE A;  3AUO A;  4AT9 B;  4NXV A;  2ZHA A;  4YD2 A;  3RH5 A;  1ZQD A;  3UPQ A;  4K4I A;  1ZQR A;  8ICG A;  4IQW A;  4QZA A;  1Q79 A;  8ICU A;  9ICP A;  4KLF A;  4KB6 A;  1UEU A;  4KLJ A;  3AQN A;  5J2A A;  9ICM A;  4UAY A;  3K75 D;  5HRF A;  4O6A A;  1BPB A;  9ICC A;  3LQC B;  3B0X A;  4LEV A;  2M2U A;  5DED A;  7ICI A;  4EBK A;  3HW8 A;  1VJ7 A;  4UB2 A;  5III A;  3HWT A;  7ICQ A;  5BOM A;  2FMS A;  9ICH A;  3RJH A;  9ICG A;  4F5O A;  4MFF A;  1ZQL A;  1F5A A;  3MDC A;  4NY8 A;  1ZQP A;  3AU6 A;  5HRG A;  3OGU A;  3AQK A;  2ZH2 A;  4QZD A;  4X4N A;  5CWR A;  4RQ2 A;  1ZQN A;  4F5R A;  4DOC A;  4MKP A;  3C66 A;  4EP7 A;  4RPZ A;  4UBB A;  4AT8 B;  4K4G A;  4M2Y A;  4NKU A;  4M47 A;  4KLG A;  4KLO A;  1RZT A;  4AT9 A;  5HRD A;  4I2J A;  4GXK A;  4PPX A;  4IQU A;  4OAH A;  1XSN A;  4PGX A;  2GWS A;  2RFF A;  8ICH A;  3PML A;  4JWN A;  5CA7 A;  9ICE A;  4IG8 A;  3UXO A;  3WFQ E;  5IIO A;  4NXU A;  1ZJN A;  4M5D A;  4IQV A;  3V7J A;  1TVA A;  4KLQ A;  4UB5 A;  5J0X A;  5IIJ A;  4I2H A;  4O67 A;  4K99 A;  5EOZ A;  4KLE A;  4E80 A;  4X0A A;  5DB6 A;  5HRI A;  2PXI A;  4QZI A;  5HHI A;  4K96 A;  4R66 A;  4UBC A;  3H3A A;  1BPX A;  3C5F A;  1ZQT A;  4WC7 A;  5HRE A;  3RJF A;  2ZH6 A;  4UB4 A;  4K4H A;  2B51 A;  4IQT A;  4UB3 A;  1R8C A;  4K9A A;  4AT7 A;  5DB7 A;  1JMS A;  5CP2 A;  4JLZ A;  4DOA A;  7ICE A;  8ICP A;  5DBB A;  4RPY A;  4WBZ A;  1Q78 A;  2ZH5 A;  4QZ9 A;  4QZH A;  1OU5 A;  3LK9 A;  2VAN A;  3H37 A;  2BCS A;  4FH3 A;  4UB1 A;  3OVB A;  3WFR E;  4I27 A;  1UEV A;  4WC0 A;  1HUO A;  4Z6F A;  4UAZ A;  1ZQV A;  1ZQF A;  4E8F A;  4NXZ A;  4PHE A;  4O5K A;  4NLN A;  4RQ6 A;  4LT6 A;  4I2B A;  4QZF A;  3C2K A;  4M04 A;  3JZ0 A;  8ICN A;  4QZG A;  4KLT A;  8ICF A;  1BPY A;  3JPO A;  4LZG A;  2B4V A;  8ICB A;  3GDX A;  3OUY A;  4RQ1 A;  4FHV A;  2DVI A;  3OVS A;  1PX5 A;  4UD4 A;  4XA5 A;  4WOY A;  2FMQ A;  4O9M A;  1YLQ A;  2Q66 A;  4O69 A;  1TFY A;  9ICO A;  4LEZ A;  1MQ3 A;  9ICW A;  4MF8 A;  4PGY A;  3RJJ A;  4R63 A;  1NO5 A;  3WFP A;  2BCQ A;  3ISC A;  5HRK A;  2PFO A;  9ICF A;  4MF2 A;  2BCV A;  5J2K A;  4LEY A;  2O5A A;  3JPP A;  4PHD A;  2ISO A;  3OV7 A;  1WOT A;  5IIM A;  8ICW A;  4QZB A;  8ICV A;  4M0A A;  1ZQU A;  5CR0 A;  5J0U A;  3RJK A;  1UET A;  8ICY A;  3NYB A;  4YMN A;  4E7X A;  1ZQX A;  1ZQG A;  4M9G A;  4WCW A;  4YMM A;  4RQ3 A;  4I2G A;  5DDM A;  1KDH A;  8ICK A;  4X5V A;  3L9D A;  2ZH1 A;  2BE3 A;  1JAJ A;  9ICA A;  3ISD A;  7ICO A;  5D4B A;  5DBC A;  5D49 A;  2PFQ A;  3RH4 A;  3UQ0 A;  9ICQ A;  3C2M A;  5DKW A;  3RJG A;  2ISP A;  4KM5 A;  4NLK A;  5DBA A;  3JPN A;  7ICF A;  4YCX A;  4WC6 A;  3H38 A;  5J2C A;  3RH6 A;  4AT8 A;  4RWO A;  2ZH3 A;  4JLX A;  5HRH A;  1HUZ A;  1ZQO A;  7ICN A;  4P4M A;  5J0Q A;  9ICT A;  4YMO A;  4KLD A;  5J2B A;  4KLM A;  3MDA A;  1ZJM A;  9ICX A;  4WC4 A;  1ZQJ A;  4I2F A;  4MFC A;  1BPZ A;  8ICC A;  1ZQZ A;  3WFS C;  4X4S A;  4K98 A;  3RJI A;  2NRK A;  2DR8 A;  5J0R A;  4RT2 A;  4X4P A;  4X0B A;  7ICT A;  3MBY A;  3JPT A;  5IIN A;  4ATB B;  4K97 A;  3V7L A;  4XUS A;  2BCU A;  4RQ7 A;  8ICQ A;  4TUS A;  1TFW A;  1NOM A;  5J0S A;  4FHX A;  4NM1 A;  4QZE A;  3PNC A;  7ICU A;  4KLU A;  5J0T A;  2ZHB A;  4I28 A;  4O68 A;  4OAG A;  4RWN A;  4F5Q A;  4Z6C A;  4R65 A;  3TFS A;  2DRA A;  5DDY A;  4RQ0 A;  4F5N A;  9ICS A;  4YN4 A;  4OAF A;  1XSL A;  5D46 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...