1JAJA

Solution structure of dna polymerase x from the african swine fever virus
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
174
structure length
174
Chain Sequence
MLTLIQGKKIVNHLRSRLAFEYNGQLIKILSKNIVAVGSLRREEKMLNDVDLLIIVPEKKLLKHVLPNIRIKGLSFSVKVCGERKCVLFIEWEKKTYQLDLFTALAEEKPYAIFHFTGPVSYLIRIRAALKKKNYKLNQYGLFKNQTLVPLKITTEKELIKELGFTYRIPKKRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords DNA POLYMERASE BETA-LIKE PROTEIN
publication title Solution structure of a viral DNA repair polymerase.
pubmed doi rcsb
source organism African swine fever virus
total genus 32
structure length 174
sequence length 174
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2001-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 1jajA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 1jajA01
4P4PA 9ICXA 3HJ1A 2O1PA 5EOZA 5BOLA 4O5KA 5HRGA 4I2DA 5DB6A 2ZH2A 4PHAA 5DB7A 4X4QA 2M2TA 2BE3A 5J2KA 3HWTA 4K4HA 2ZH1A 4I27A 8ICAA 3UPSA 3NYBA 3AQNA 4QZEA 4NY8A 4LT6A 4M5DA 4KLJA 3ISDA 9ICKA 3WFRE 2BPGA 3JPRA 1UEVA 1HUZA 5J2BA 4RPXA 8ICWA 5DB9A 3OUYA 4GXIA 4X4VA 3TFSA 4DOAA 5DDYA 4EBKA 3C2LA 4RWNA 8ICRA 4WC2A 4UAYA 3V72A 4M9GA 9ICAA 8ICGA 7ICUA 5HHIA 4PHDA 4O9MA 4PGQA 5DECA 5BOMA 5IIMA 1XSPA 4RWPA 3OVSA 7ICLA 1MIWA 1OU5A 8ICEA 4KLUA 4S3NA 4TUQA 4NLKA 4WC5A 3UXPA 1ZQRA 4KLMA 5IIOA 4X4RA 7ICOA 3OV7A 4DOBA 3H3AA 5HC9A 5J29A 9ICEA 1ZQCA 4RQ1A 4K4GA 3UPQA 4WC0A 4KLDA 4XQ8A 4NKUA 4I2FA 1Q79A 5HRBA 4WBZA 4YN4A 8ICLA 2IHMA 3JPSA 4RQ2A 3MGHA 5CJ7A 2DR8A 2PFNA 4PH5A 5J0OA 1ZQXA 3LQCB 4KLQA 4QZIA 1ZQSA 2ISPA 4QZ9A 2DR5A 4P4OA 5HRHA 3JPQA 4YMMA 1YLQA 1KNYA 2FMPA 1V4AA 2ZHBA 3JPPA 4JWNA 5J0TA 3MGIA 2Q66A 5DBBA 3TFRA 1RPLA 4O5CA 4X4OA 4I2HA 5J0XA 2ZH7A 1R8BA 4TUPA 3JPNA 3OGUA 4QZBA 4LZDA 3C66A 8ICSA 5IIJA 5DDMA 4Z6CA 4X4PA 3HW8A 3HX0A 4XRHA 1TV9A 4IQWA 4EBJA 2PFQA 5CHGA 3RJFA 2HHPA 3HJ4A 1ZQLA 2BPFA 4QZCA 4RQ6A 2ZHAA 8ICMA 4FO6A 9ICVA 3MDAA 4Z6DA 7ICRA 1ZQMA 3ISCA 4X5VA 4I2GA 5TZVA 4AT7A 1MQ3A 3RJEA 8ICTA 5J2JA 5IIKA 8ICUA 4FHYA 4UB2A 4X4SA 8ICPA 4AT9B 5J0QA 3UXOA 4R66A 3MDCA 7ICEA 4M9NA 9ICFA 5CR0A 8ICJA 4UB5A 4KLOA 5BPCA 3MBYA 4X4TA 2DRBA 4WC1A 5IILA 5HR9A 4I2BA 4GXJA 4XUSA 4IQTA 9ICBA 9ICOA 3RJGA 1ZJNA 2RFFA 2VANA 3RJIA 4NM2A 3JPTA 4YD1A 9ICIA 4F5NA 1R8AA 4UB3A 4NXZA 4E80A 2DR7A 4PHPA 4UAZA 5J2CA 2PFPA 5J0SA 4PPXA 4QZHA 4PGXA 1JQRA 4DO9A 3OUYB 1ZQVA 3RJJA 3RJHA 4PGYA 5HRIA 1ZJMA 1R89A 5J2FA 4RT3A 1XSLA 1KEJA 7ICNA 4X0AA 1RZTA 4XQ7A 1ZQZA 4FHWA 1MIVA 4M04A 9ICGA 8ICVA 4YMNA 3UQ0A 1ZQEA 4MFAA 4KLLA 4RQ3A 1HUOA 5IIIA 8ICBA 4FHPA 8ICCA 1ZQWA 2ZH9A 1UETA 3L9DA 4MF8A 4UAWA 2P66A 3C5GA 5J2EA 3AQLA 1BPXA 3GDXA 3RH4A 4M9HA 4I2AA 5F2VO 3C2MA 4TUSA 4YCXA 1TFYA 4I2IA 4RWQA 1VJ7A 4WC7A 7ICPA 2ZH4A 1ZQOA 9ICTA 1ZQDA 4RWOA 4ATBA 4UBCA 7ICTA 5J2HA 9ICUA 9ICLA 4WC6A 3C18A 4EP7A 5DKWA 3ISBA 4QZFA 2BCQA 2ZH8A 5J0WA 7ICGA 4GXKA 1F5AA 3RH6A 3JPOA 3RJKA 8ICOA 4KLHA 3OVBA 4F5OA 4WCWA 4AT8A 4E7XA 5D46A 9ICSA 1JN3A 4UD5A 5D49A 2DR9A 3V7LA 3JYYA 4KLTA 4M9JA 3V7KA 1ZQUA 5CWRA 5J2AA 4LZGA 1Q78A 4UD4A 9ICHA 3H37A 8ICZA 8ICIA 9ICPA 1KDHA 1R8CA 7ICFA 3AQKA 5DB8A 1ZQJA 4RQ4A 4Z6FA 5HRKA 4M9LA 2NRKA 1BPEA 4KLSA 5HHHA 4QZAA 1MQ2A 4MFFA 9ICQA 5DEDA 1BPZA 9ICJA 5J2IA 4KLIA 5DBAA 4AT7B 3AUOA 1ZQGA 3B0YA 5J2DA 4R63A 2ZH3A 3AU6A 2ID1A 4M0AA 2ZH6A 4FHVA 1ZQAA 8ICNA 4RQ0A 4UB1A 1UEUA 3RH5A 3WFPA 2BCSA 9ICCA 1BPYA 7ICVA 4NKTA 2DRAA 7ICJA 2M2WA 4PHEA 4MF2A 3HIYA 4KLGA 5HRLA 1XSNA 5D4BA 2ISOA 4LVSA 4MFCA 4FHXA 4KLFA 4RPYA 7ICIA 5J2GA 4QZ8A 9ICWA 4YMOA 4QZDA 4RQ8A 4E8FA 4XA5A 5DBCA 4QZGA 9ICRA 3K75D 5CA7A 1MIYA 4WC4A 2PBEA 2DVIA 1VFGA 1ZQFA 3V7JA 4X4UA 2M2UA 4FH5A 1ZQIA 4I2EA 5J0PA 4P4MA 2BPCA 3PMLA 3WFQE 1PX5A 1ZQHA 2O5AA 4X4NA 4F5QA 1ZQBA 4F5RA 2W9MA 4UBBA 3LK9A 7ICSA 2BCVA 4I2JA 4NLZA 4I2CA 5HRFA 8ICHA 5J0RA 2M2VA 8ICKA 2PXIA 1FA0A 5HREA 4YD2A 3WFOA 3WFSC 3UXNA 8ICYA 4UB4A 4IQUA 4R64A 2GWSA 3OVAA 4P2HA 4ATBB 4R65A 3C5FA 1NO5A 5CP2A 5IINA 3PNCA 1JMSA 4DOCA 1BPBA 1ZQQA 1ZQKA 2FMSA 4NM1A 7ICKA 1TFWA 1BPDA 8ICXA 3AQMA 3PMNA 7ICMA 4O5EA 9ICNA 3B0XA 4RT2A 5HRDA 4RPZA 1WOTA 4AT8B 3JZ0A 4JWMA 2PFOA 4IG8A 5J0UA 3UQ2A 3C2KA 2BCUA 1ZQYA 4IQVA 3H39A 4K4IA 4X0BA 8ICQA 4FH3A 4I28A 9ICMA 4NLNA 3AU2A 5CB1A 4WC3A 7ICQA 1TVAA 4I29A 7ICHA 2ZH5A 4Z6EA 3H38A 4M47A 8ICFA 4TURA 4KLEA 4M2YA 2BCRA 1ZQPA 4WBYA 4RQ7A 1ZQTA 4F5PA 1ZQNA 1JAJA 2I9GA 5J0YA 2FMQA 4RQ5A 4AT9A 1NOMA
chains in the Genus database with same CATH superfamily
4P4PA 9ICXA 3HJ1A 2O1PA 4WOYA 5EOZA 5BOLA 4O5KA 5HRGA 4I2DA 5DB6A 4K99A 2ZH2A 4PHAA 5DB7A 4X4QA 2M2TA 2BE3A 5J2KA 3HWTA 4K4HA 2ZH1A 4I27A 8ICAA 3UPSA 5CFSA 3NYBA 3AQNA 4QZEA 4NY8A 4LT6A 4M5DA 4KLJA 3ISDA 9ICKA 3WFRE 2BPGA 4FO1A 3JPRA 1UEVA 1HUZA 5J2BA 4RPXA 8ICWA 5DB9A 5B3PA 3OUYA 4GXIA 4O6AA 4X4VA 3TFSA 4NXXA 4DOAA 5DDYA 4EBKA 3C2LA 4RWNA 4MKPA 8ICRA 4WC2A 3K7DA 4UAYA 3V72A 4M9GA 3MCRA 9ICAA 3CK6A 8ICGA 7ICUA 5HHIA 4PHDA 4O9MA 4PGQA 4O67A 5DECA 5BOMA 5IIMA 1XSPA 4RWPA 3OVSA 7ICLA 1MIWA 1OU5A 8ICEA 4KLUA 4S3NA 4TUQA 4NLKA 4WC5A 3UXPA 1ZQRA 4WQLA 5D62A 4KLMA 5IIOA 4X4RA 7ICOA 3OV7A 4DOBA 3H3AA 5HC9A 5J29A 3EF2A 9ICEA 1ZQCA 4RQ1A 4K4GA 3UPQA 4WC0A 4KLDA 4XQ8A 4NKUA 4I2FA 1Q79A 5HRBA 4WBZA 4YN4A 8ICLA 2IHMA 3JPSA 4RQ2A 3MGHA 5CJ7A 2DR8A 2PFNA 4PH5A 5J0OA 1ZQXA 3LQCB 4KLQA 4QZIA 4LEVA 4LEZA 1ZQSA 2ISPA 4QZ9A 2DR5A 4P4OA 5HRHA 3JPQA 4YMMA 2HN2A 5CHEA 1YLQA 1KNYA 2FMPA 1V4AA 2ZHBA 3JPPA 4N7RA 4JWNA 5J0TA 3MGIA 2Q66A 5DBBA 3TFRA 1RPLA 4O5CA 4X4OA 4I2HA 5J0XA 2ZH7A 1R8BA 2B4VA 4TUPA 3JPNA 3OGUA 4QZBA 4LZDA 3C66A 8ICSA 5IIJA 3ER8C 5DDMA 4Z6CA 4X4PA 3HW8A 3HX0A 4XRHA 1TV9A 4IQWA 4EBJA 2PFQA 5CHGA 3RJFA 2HHPA 3HJ4A 1ZQLA 2BPFA 4QZCA 4RQ6A 4K9AA 2ZHAA 8ICMA 4FO6A 2FCLA 9ICVA 3MDAA 4Z6DA 7ICRA 3ERCC 4EGWA 1ZQMA 3ISCA 4X5VA 4I2GA 4XJEA 5TZVA 4O68A 4AT7A 1MQ3A 3RJEA 8ICTA 5J2JA 5IIKA 8ICUA 4FHYA 4UB2A 4X4SA 5CFUA 8ICPA 4AT9B 5J0QA 3UXOA 4R66A 3MDCA 7ICEA 4M9NA 3NVOA 9ICFA 5CR0A 8ICJA 2HN1A 4UB5A 4KLOA 5BPCA 3MBYA 4X4TA 2DRBA 4WC1A 5IILA 4K8VA 5HR9A 3NWIA 4I2BA 4GXJA 4XUSA 4NXWA 4IQTA 9ICBA 9ICOA 3RJGA 1ZJNA 3ER9B 2RFFA 2VANA 3RJIA 4NM2A 3JPTA 4YD1A 9ICIA 4F5NA 1R8AA 4UB3A 4NXZA 4E80A 2DR7A 4PHPA 4K97A 5D63A 4UAZA 5J2CA 2PFPA 5J0SA 4PPXA 4QZHA 4PGXA 1JQRA 4DO9A 3OUYB 1ZQVA 3RJJA 3RJHA 5D61A 4PGYA 5HRIA 1ZJMA 1R89A 5J2FA 4RT3A 1XSLA 4I0UA 1KEJA 7ICNA 4X0AA 1RZTA 4XQ7A 1ZQZA 4FHWA 1MIVA 4M04A 4WH5A 9ICGA 8ICVA 2BBJA 4YMNA 3UQ0A 1ZQEA 4MFAA 4KLLA 4RQ3A 1HUOA 5IIIA 8ICBA 4FHPA 8ICCA 1ZQWA 2GAFD 2ZH9A 1UETA 3L9DA 4OAIZ 4MF8A 4UAWA 2P66A 3C5GA 5J2EA 3AQLA 2IUBA 4OAGA 1BPXA 3GDXA 3RH4A 4M9HA 4I2AA 5F2VO 3C2MA 4TUSA 4YCXA 1TFYA 4I2IA 4O69A 4RWQA 1VJ7A 4WC7A 7ICPA 2B51A 2ZH4A 1ZQOA 9ICTA 1ZQDA 4RWOA 4ATBA 4UBCA 7ICTA 5J2HA 9ICUA 9ICLA 4WC6A 3C18A 4EP7A 5DKWA 3ISBA 4QZFA 2BCQA 2ZH8A 5J0WA 7ICGA 4GXKA 1F5AA 3RH6A 3JPOA 3RJKA 8ICOA 4KLHA 3OVBA 4JLXA 4F5OA 4WCWA 3PHZA 4LEWA 4AT8A 4E7XA 5D46A 9ICSA 1JN3A 4UD5A 3OWGA 5D49A 2DR9A 3V7LA 3JYYA 4KLTA 4M9JA 3V7KA 1ZQUA 4K9BA 5CWRA 5J2AA 4LZGA 1Q78A 4UD4A 9ICHA 3H37A 8ICZA 8ICIA 4OAHA 9ICPA 1KDHA 1R8CA 7ICFA 3AQKA 5DB8A 1ZQJA 4RQ4A 5B3QA 4Z6FA 2B56A 5HRKA 4M9LA 2NRKA 1BPEA 4KLSA 5HHHA 4QZAA 1MQ2A 4MFFA 9ICQA 5DEDA 2GA9D 1BPZA 3NKUA 9ICJA 5J2IA 4KLIA 5DBAA 4AT7B 3AUOA 1ZQGA 3B0YA 5J2DA 4R63A 4JLZA 3AU6A 2ID1A 4M0AA 2ZH3A 1GPJA 2ZH6A 4FHVA 1ZQAA 8ICNA 4RQ0A 4UB1A 1UEUA 3RH5A 3WFPA 2BCSA 9ICCA 1BPYA 7ICVA 4OAFA 4NKTA 2DRAA 7ICJA 2M2WA 4PHEA 4MF2A 4K98A 3HIYA 4KLGA 4KB6A 5HRLA 1XSNA 5D4BA 4WQKA 2ISOA 4LVSA 4MFCA 4FHXA 4KLFA 4RPYA 7ICIA 4HX0A 5J2GA 4QZ8A 9ICWA 4YMOA 4QZDA 4NXUA 4RQ8A 4E8FA 4XA5A 5DBCA 4QZGA 9ICRA 3K75D 5CA7A 1MIYA 4WC4A 2PBEA 2DVIA 1VFGA 4NXVA 1ZQFA 3V7JA 4NXTA 4X4UA 2M2UA 4FH5A 1ZQIA 4I2EA 5J0PA 5JTGA 2BBHA 4P4MA 2BPCA 3PMLA 3WFQE 1PX5A 1ZQHA 2O5AA 4X4NA 4F5QA 2IHOA 1ZQBA 4F5RA 2W9MA 4UBBA 3LK9A 7ICSA 2BCVA 4I2JA 4NLZA 4I2CA 5HRFA 8ICHA 5J0RA 2M2VA 8ICKA 2PXIA 1FA0A 5HREA 4LEYA 4YD2A 3JCFA 3WFOA 3WFSC 3UXNA 8ICYA 4UB4A 4IQUA 4R64A 2GWSA 3OVAA 4P2HA 4ATBB 4R65A 3C5FA 1NO5A 5CP2A 5IINA 3PNCA 1JMSA 4DOCA 1BPBA 1ZQQA 4EEDA 1ZQKA 2FMSA 4NM1A 7ICKA 1TFWA 1BPDA 8ICXA 3AQMA 3PMNA 7ICMA 4O5EA 9ICNA 3B0XA 4RT2A 5HRDA 4RPZA 1WOTA 4AT8B 3JZ0A 4K96A 4JWMA 2PFOA 4IG8A 5J0UA 3UQ2A 3C2KA 2BCUA 1ZQYA 4IQVA 3H39A 4K4IA 4X0BA 8ICQA 4FH3A 4I28A 9ICMA 4EV6A 4NLNA 3AU2A 5CB1A 4WC3A 7ICQA 1TVAA 4I29A 4EEBA 7ICHA 2ZH5A 4Z6EA 3H38A 5CFTA 2EWRA 4M47A 8ICFA 4TURA 4KLEA 4M2YA 2BCRA 1ZQPA 4WBYA 4RQ7A 1ZQTA 4KM5A 4F5PA 1ZQNA 1JAJA 2I9GA 5J0YA 2FMQA 4RQ5A 4AT9A 1NOMA
chains in the Genus database with same CATH topology
4P4PA 9ICXA 3HJ1A 2O1PA 5EOZA 5BOLA 4O5KA 5HRGA 4I2DA 5DB6A 2ZH2A 4PHAA 5DB7A 4X4QA 2M2TA 2BE3A 5J2KA 3HWTA 4K4HA 2ZH1A 4I27A 8ICAA 3UPSA 3NYBA 3AQNA 4QZEA 4NY8A 4LT6A 4M5DA 4KLJA 3ISDA 9ICKA 3WFRE 2BPGA 3JPRA 1UEVA 1HUZA 5J2BA 4RPXA 8ICWA 5DB9A 3OUYA 4GXIA 4X4VA 3TFSA 4DOAA 5DDYA 4EBKA 3C2LA 4RWNA 8ICRA 4WC2A 4UAYA 3V72A 4M9GA 9ICAA 8ICGA 7ICUA 5HHIA 4PHDA 4O9MA 4PGQA 5DECA 5BOMA 5IIMA 1XSPA 4RWPA 3OVSA 7ICLA 1MIWA 1OU5A 8ICEA 4KLUA 4S3NA 4TUQA 4NLKA 4WC5A 3UXPA 1ZQRA 4KLMA 5IIOA 4X4RA 7ICOA 3OV7A 4DOBA 3H3AA 5HC9A 5J29A 9ICEA 1ZQCA 4RQ1A 4K4GA 3UPQA 4WC0A 4KLDA 4XQ8A 4NKUA 4I2FA 1Q79A 5HRBA 4WBZA 4YN4A 8ICLA 2IHMA 3JPSA 4RQ2A 3MGHA 5CJ7A 2DR8A 2PFNA 4PH5A 5J0OA 1ZQXA 3LQCB 4KLQA 4QZIA 1ZQSA 2ISPA 4QZ9A 2DR5A 4P4OA 5HRHA 3JPQA 4YMMA 1YLQA 1KNYA 2FMPA 1V4AA 2ZHBA 3JPPA 4JWNA 5J0TA 3MGIA 2Q66A 5DBBA 3TFRA 1RPLA 4O5CA 4X4OA 4I2HA 5J0XA 2ZH7A 1R8BA 4TUPA 3JPNA 3OGUA 4QZBA 4LZDA 3C66A 8ICSA 5IIJA 5DDMA 4Z6CA 4X4PA 3HW8A 3HX0A 4XRHA 1TV9A 4IQWA 4EBJA 2PFQA 5CHGA 3RJFA 2HHPA 3HJ4A 1ZQLA 2BPFA 4QZCA 4RQ6A 2ZHAA 8ICMA 4FO6A 9ICVA 3MDAA 4Z6DA 7ICRA 1ZQMA 3ISCA 4X5VA 4I2GA 5TZVA 4AT7A 1MQ3A 3RJEA 8ICTA 5J2JA 5IIKA 8ICUA 4FHYA 4UB2A 4X4SA 8ICPA 4AT9B 5J0QA 3UXOA 4R66A 3MDCA 7ICEA 4M9NA 9ICFA 5CR0A 8ICJA 4UB5A 4KLOA 5BPCA 3MBYA 4X4TA 2DRBA 4WC1A 5IILA 5HR9A 4I2BA 4GXJA 4XUSA 4IQTA 9ICBA 9ICOA 3RJGA 1ZJNA 2RFFA 2VANA 3RJIA 4NM2A 3JPTA 4YD1A 9ICIA 4F5NA 1R8AA 4UB3A 4NXZA 4E80A 2DR7A 4PHPA 4UAZA 5J2CA 2PFPA 5J0SA 4PPXA 4QZHA 4PGXA 1JQRA 4DO9A 3OUYB 1ZQVA 3RJJA 3RJHA 4PGYA 5HRIA 1ZJMA 1R89A 5J2FA 4RT3A 1XSLA 1KEJA 7ICNA 4X0AA 1RZTA 4XQ7A 1ZQZA 4FHWA 1MIVA 4M04A 9ICGA 8ICVA 4YMNA 3UQ0A 1ZQEA 4MFAA 4KLLA 4RQ3A 1HUOA 5IIIA 8ICBA 4FHPA 8ICCA 1ZQWA 2ZH9A 1UETA 3L9DA 4MF8A 4UAWA 2P66A 3C5GA 5J2EA 3AQLA 1BPXA 3GDXA 3RH4A 4M9HA 4I2AA 5F2VO 3C2MA 4TUSA 4YCXA 1TFYA 4I2IA 4RWQA 1VJ7A 4WC7A 7ICPA 2ZH4A 1ZQOA 9ICTA 1ZQDA 4RWOA 4ATBA 4UBCA 7ICTA 5J2HA 9ICUA 9ICLA 4WC6A 3C18A 4EP7A 5DKWA 3ISBA 4QZFA 2BCQA 2ZH8A 5J0WA 7ICGA 4GXKA 1F5AA 3RH6A 3JPOA 3RJKA 8ICOA 4KLHA 3OVBA 4F5OA 4WCWA 4AT8A 4E7XA 5D46A 9ICSA 1JN3A 4UD5A 5D49A 2DR9A 3V7LA 3JYYA 4KLTA 4M9JA 3V7KA 1ZQUA 5CWRA 5J2AA 4LZGA 1Q78A 4UD4A 9ICHA 3H37A 8ICZA 8ICIA 9ICPA 1KDHA 1R8CA 7ICFA 3AQKA 5DB8A 1ZQJA 4RQ4A 4Z6FA 5HRKA 4M9LA 2NRKA 1BPEA 4KLSA 5HHHA 4QZAA 1MQ2A 4MFFA 9ICQA 5DEDA 1BPZA 9ICJA 5J2IA 4KLIA 5DBAA 4AT7B 3AUOA 1ZQGA 3B0YA 5J2DA 4R63A 2ZH3A 3AU6A 2ID1A 4M0AA 2ZH6A 4FHVA 1ZQAA 8ICNA 4RQ0A 4UB1A 1UEUA 3RH5A 3WFPA 2BCSA 9ICCA 1BPYA 7ICVA 4NKTA 2DRAA 7ICJA 2M2WA 4PHEA 4MF2A 3HIYA 4KLGA 5HRLA 1XSNA 5D4BA 2ISOA 4LVSA 4MFCA 4FHXA 4KLFA 4RPYA 7ICIA 5J2GA 4QZ8A 9ICWA 4YMOA 4QZDA 4RQ8A 4E8FA 4XA5A 5DBCA 4QZGA 9ICRA 3K75D 5CA7A 1MIYA 4WC4A 2PBEA 2DVIA 1VFGA 1ZQFA 3V7JA 4X4UA 2M2UA 4FH5A 1ZQIA 4I2EA 5J0PA 4P4MA 2BPCA 3PMLA 3WFQE 1PX5A 1ZQHA 2O5AA 4X4NA 4F5QA 1ZQBA 4F5RA 2W9MA 4UBBA 3LK9A 7ICSA 2BCVA 4I2JA 4NLZA 4I2CA 5HRFA 8ICHA 5J0RA 2M2VA 8ICKA 2PXIA 1FA0A 5HREA 4YD2A 3WFOA 3WFSC 3UXNA 8ICYA 4UB4A 4IQUA 4R64A 2GWSA 3OVAA 4P2HA 4ATBB 4R65A 3C5FA 1NO5A 5CP2A 5IINA 3PNCA 1JMSA 4DOCA 1BPBA 1ZQQA 1ZQKA 2FMSA 4NM1A 7ICKA 1TFWA 1BPDA 8ICXA 3AQMA 3PMNA 7ICMA 4O5EA 9ICNA 3B0XA 4RT2A 5HRDA 4RPZA 1WOTA 4AT8B 3JZ0A 4JWMA 2PFOA 4IG8A 5J0UA 3UQ2A 3C2KA 2BCUA 1ZQYA 4IQVA 3H39A 4K4IA 4X0BA 8ICQA 4FH3A 4I28A 9ICMA 4NLNA 3AU2A 5CB1A 4WC3A 7ICQA 1TVAA 4I29A 7ICHA 2ZH5A 4Z6EA 3H38A 4M47A 8ICFA 4TURA 4KLEA 4M2YA 2BCRA 1ZQPA 4WBYA 4RQ7A 1ZQTA 4F5PA 1ZQNA 1JAJA 2I9GA 5J0YA 2FMQA 4RQ5A 4AT9A 1NOMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P4P A;  9ICX A;  3HJ1 A;  2O1P A;  5EOZ A;  5BOL A;  4O5K A;  5HRG A;  4I2D A;  5DB6 A;  2ZH2 A;  4PHA A;  5DB7 A;  4X4Q A;  2M2T A;  2BE3 A;  5J2K A;  3HWT A;  4K4H A;  2ZH1 A;  4I27 A;  8ICA A;  3UPS A;  3NYB A;  3AQN A;  4QZE A;  4NY8 A;  4LT6 A;  4M5D A;  4KLJ A;  3ISD A;  9ICK A;  3WFR E;  2BPG A;  3JPR A;  1UEV A;  1HUZ A;  5J2B A;  4RPX A;  8ICW A;  5DB9 A;  3OUY A;  4GXI A;  4X4V A;  3TFS A;  4DOA A;  5DDY A;  4EBK A;  3C2L A;  4RWN A;  8ICR A;  4WC2 A;  4UAY A;  3V72 A;  4M9G A;  9ICA A;  8ICG A;  7ICU A;  5HHI A;  4PHD A;  4O9M A;  4PGQ A;  5DEC A;  5BOM A;  5IIM A;  1XSP A;  4RWP A;  3OVS A;  7ICL A;  1MIW A;  1OU5 A;  8ICE A;  4KLU A;  4S3N A;  4TUQ A;  4NLK A;  4WC5 A;  3UXP A;  1ZQR A;  4KLM A;  5IIO A;  4X4R A;  7ICO A;  3OV7 A;  4DOB A;  3H3A A;  5HC9 A;  5J29 A;  9ICE A;  1ZQC A;  4RQ1 A;  4K4G A;  3UPQ A;  4WC0 A;  4KLD A;  4XQ8 A;  4NKU A;  4I2F A;  1Q79 A;  5HRB A;  4WBZ A;  4YN4 A;  8ICL A;  2IHM A;  3JPS A;  4RQ2 A;  3MGH A;  5CJ7 A;  2DR8 A;  2PFN A;  4PH5 A;  5J0O A;  1ZQX A;  3LQC B;  4KLQ A;  4QZI A;  1ZQS A;  2ISP A;  4QZ9 A;  2DR5 A;  4P4O A;  5HRH A;  3JPQ A;  4YMM A;  1YLQ A;  1KNY A;  2FMP A;  1V4A A;  2ZHB A;  3JPP A;  4JWN A;  5J0T A;  3MGI A;  2Q66 A;  5DBB A;  3TFR A;  1RPL A;  4O5C A;  4X4O A;  4I2H A;  5J0X A;  2ZH7 A;  1R8B A;  4TUP A;  3JPN A;  3OGU A;  4QZB A;  4LZD A;  3C66 A;  8ICS A;  5IIJ A;  5DDM A;  4Z6C A;  4X4P A;  3HW8 A;  3HX0 A;  4XRH A;  1TV9 A;  4IQW A;  4EBJ A;  2PFQ A;  5CHG A;  3RJF A;  2HHP A;  3HJ4 A;  1ZQL A;  2BPF A;  4QZC A;  4RQ6 A;  2ZHA A;  8ICM A;  4FO6 A;  9ICV A;  3MDA A;  4Z6D A;  7ICR A;  1ZQM A;  3ISC A;  4X5V A;  4I2G A;  5TZV A;  4AT7 A;  1MQ3 A;  3RJE A;  8ICT A;  5J2J A;  5IIK A;  8ICU A;  4FHY A;  4UB2 A;  4X4S A;  8ICP A;  4AT9 B;  5J0Q A;  3UXO A;  4R66 A;  3MDC A;  7ICE A;  4M9N A;  9ICF A;  5CR0 A;  8ICJ A;  4UB5 A;  4KLO A;  5BPC A;  3MBY A;  4X4T A;  2DRB A;  4WC1 A;  5IIL A;  5HR9 A;  4I2B A;  4GXJ A;  4XUS A;  4IQT A;  9ICB A;  9ICO A;  3RJG A;  1ZJN A;  2RFF A;  2VAN A;  3RJI A;  4NM2 A;  3JPT A;  4YD1 A;  9ICI A;  4F5N A;  1R8A A;  4UB3 A;  4NXZ A;  4E80 A;  2DR7 A;  4PHP A;  4UAZ A;  5J2C A;  2PFP A;  5J0S A;  4PPX A;  4QZH A;  4PGX A;  1JQR A;  4DO9 A;  3OUY B;  1ZQV A;  3RJJ A;  3RJH A;  4PGY A;  5HRI A;  1ZJM A;  1R89 A;  5J2F A;  4RT3 A;  1XSL A;  1KEJ A;  7ICN A;  4X0A A;  1RZT A;  4XQ7 A;  1ZQZ A;  4FHW A;  1MIV A;  4M04 A;  9ICG A;  8ICV A;  4YMN A;  3UQ0 A;  1ZQE A;  4MFA A;  4KLL A;  4RQ3 A;  1HUO A;  5III A;  8ICB A;  4FHP A;  8ICC A;  1ZQW A;  2ZH9 A;  1UET A;  3L9D A;  4MF8 A;  4UAW A;  2P66 A;  3C5G A;  5J2E A;  3AQL A;  1BPX A;  3GDX A;  3RH4 A;  4M9H A;  4I2A A;  5F2V O;  3C2M A;  4TUS A;  4YCX A;  1TFY A;  4I2I A;  4RWQ A;  1VJ7 A;  4WC7 A;  7ICP A;  2ZH4 A;  1ZQO A;  9ICT A;  1ZQD A;  4RWO A;  4ATB A;  4UBC A;  7ICT A;  5J2H A;  9ICU A;  9ICL A;  4WC6 A;  3C18 A;  4EP7 A;  5DKW A;  3ISB A;  4QZF A;  2BCQ A;  2ZH8 A;  5J0W A;  7ICG A;  4GXK A;  1F5A A;  3RH6 A;  3JPO A;  3RJK A;  8ICO A;  4KLH A;  3OVB A;  4F5O A;  4WCW A;  4AT8 A;  4E7X A;  5D46 A;  9ICS A;  1JN3 A;  4UD5 A;  5D49 A;  2DR9 A;  3V7L A;  3JYY A;  4KLT A;  4M9J A;  3V7K A;  1ZQU A;  5CWR A;  5J2A A;  4LZG A;  1Q78 A;  4UD4 A;  9ICH A;  3H37 A;  8ICZ A;  8ICI A;  9ICP A;  1KDH A;  1R8C A;  7ICF A;  3AQK A;  5DB8 A;  1ZQJ A;  4RQ4 A;  4Z6F A;  5HRK A;  4M9L A;  2NRK A;  1BPE A;  4KLS A;  5HHH A;  4QZA A;  1MQ2 A;  4MFF A;  9ICQ A;  5DED A;  1BPZ A;  9ICJ A;  5J2I A;  4KLI A;  5DBA A;  4AT7 B;  3AUO A;  1ZQG A;  3B0Y A;  5J2D A;  4R63 A;  2ZH3 A;  3AU6 A;  2ID1 A;  4M0A A;  2ZH6 A;  4FHV A;  1ZQA A;  8ICN A;  4RQ0 A;  4UB1 A;  1UEU A;  3RH5 A;  3WFP A;  2BCS A;  9ICC A;  1BPY A;  7ICV A;  4NKT A;  2DRA A;  7ICJ A;  2M2W A;  4PHE A;  4MF2 A;  3HIY A;  4KLG A;  5HRL A;  1XSN A;  5D4B A;  2ISO A;  4LVS A;  4MFC A;  4FHX A;  4KLF A;  4RPY A;  7ICI A;  5J2G A;  4QZ8 A;  9ICW A;  4YMO A;  4QZD A;  4RQ8 A;  4E8F A;  4XA5 A;  5DBC A;  4QZG A;  9ICR A;  3K75 D;  5CA7 A;  1MIY A;  4WC4 A;  2PBE A;  2DVI A;  1VFG A;  1ZQF A;  3V7J A;  4X4U A;  2M2U A;  4FH5 A;  1ZQI A;  4I2E A;  5J0P A;  4P4M A;  2BPC A;  3PML A;  3WFQ E;  1PX5 A;  1ZQH A;  2O5A A;  4X4N A;  4F5Q A;  1ZQB A;  4F5R A;  2W9M A;  4UBB A;  3LK9 A;  7ICS A;  2BCV A;  4I2J A;  4NLZ A;  4I2C A;  5HRF A;  8ICH A;  5J0R A;  2M2V A;  8ICK A;  2PXI A;  1FA0 A;  5HRE A;  4YD2 A;  3WFO A;  3WFS C;  3UXN A;  8ICY A;  4UB4 A;  4IQU A;  4R64 A;  2GWS A;  3OVA A;  4P2H A;  4ATB B;  4R65 A;  3C5F A;  1NO5 A;  5CP2 A;  5IIN A;  3PNC A;  1JMS A;  4DOC A;  1BPB A;  1ZQQ A;  1ZQK A;  2FMS A;  4NM1 A;  7ICK A;  1TFW A;  1BPD A;  8ICX A;  3AQM A;  3PMN A;  7ICM A;  4O5E A;  9ICN A;  3B0X A;  4RT2 A;  5HRD A;  4RPZ A;  1WOT A;  4AT8 B;  3JZ0 A;  4JWM A;  2PFO A;  4IG8 A;  5J0U A;  3UQ2 A;  3C2K A;  2BCU A;  1ZQY A;  4IQV A;  3H39 A;  4K4I A;  4X0B A;  8ICQ A;  4FH3 A;  4I28 A;  9ICM A;  4NLN A;  3AU2 A;  5CB1 A;  4WC3 A;  7ICQ A;  1TVA A;  4I29 A;  7ICH A;  2ZH5 A;  4Z6E A;  3H38 A;  4M47 A;  8ICF A;  4TUR A;  4KLE A;  4M2Y A;  2BCR A;  1ZQP A;  4WBY A;  4RQ7 A;  1ZQT A;  4F5P A;  1ZQN A;  1JAJ A;  2I9G A;  5J0Y A;  2FMQ A;  4RQ5 A;  4AT9 A;  1NOM A; 
#chains in the Genus database with same CATH topology
 4P4P A;  9ICX A;  3HJ1 A;  2O1P A;  4WOY A;  5EOZ A;  5BOL A;  4O5K A;  5HRG A;  4I2D A;  5DB6 A;  4K99 A;  2ZH2 A;  4PHA A;  5DB7 A;  4X4Q A;  2M2T A;  2BE3 A;  5J2K A;  3HWT A;  4K4H A;  2ZH1 A;  4I27 A;  8ICA A;  3UPS A;  5CFS A;  3NYB A;  3AQN A;  4QZE A;  4NY8 A;  4LT6 A;  4M5D A;  4KLJ A;  3ISD A;  9ICK A;  3WFR E;  2BPG A;  4FO1 A;  3JPR A;  1UEV A;  1HUZ A;  5J2B A;  4RPX A;  8ICW A;  5DB9 A;  5B3P A;  3OUY A;  4GXI A;  4O6A A;  4X4V A;  3TFS A;  4NXX A;  4DOA A;  5DDY A;  4EBK A;  3C2L A;  4RWN A;  4MKP A;  8ICR A;  4WC2 A;  3K7D A;  4UAY A;  3V72 A;  4M9G A;  3MCR A;  9ICA A;  3CK6 A;  8ICG A;  7ICU A;  5HHI A;  4PHD A;  4O9M A;  4PGQ A;  4O67 A;  5DEC A;  5BOM A;  5IIM A;  1XSP A;  4RWP A;  3OVS A;  7ICL A;  1MIW A;  1OU5 A;  8ICE A;  4KLU A;  4S3N A;  4TUQ A;  4NLK A;  4WC5 A;  3UXP A;  1ZQR A;  4WQL A;  5D62 A;  4KLM A;  5IIO A;  4X4R A;  7ICO A;  3OV7 A;  4DOB A;  3H3A A;  5HC9 A;  5J29 A;  3EF2 A;  9ICE A;  1ZQC A;  4RQ1 A;  4K4G A;  3UPQ A;  4WC0 A;  4KLD A;  4XQ8 A;  4NKU A;  4I2F A;  1Q79 A;  5HRB A;  4WBZ A;  4YN4 A;  8ICL A;  2IHM A;  3JPS A;  4RQ2 A;  3MGH A;  5CJ7 A;  2DR8 A;  2PFN A;  4PH5 A;  5J0O A;  1ZQX A;  3LQC B;  4KLQ A;  4QZI A;  4LEV A;  4LEZ A;  1ZQS A;  2ISP A;  4QZ9 A;  2DR5 A;  4P4O A;  5HRH A;  3JPQ A;  4YMM A;  2HN2 A;  5CHE A;  1YLQ A;  1KNY A;  2FMP A;  1V4A A;  2ZHB A;  3JPP A;  4N7R A;  4JWN A;  5J0T A;  3MGI A;  2Q66 A;  5DBB A;  3TFR A;  1RPL A;  4O5C A;  4X4O A;  4I2H A;  5J0X A;  2ZH7 A;  1R8B A;  2B4V A;  4TUP A;  3JPN A;  3OGU A;  4QZB A;  4LZD A;  3C66 A;  8ICS A;  5IIJ A;  3ER8 C;  5DDM A;  4Z6C A;  4X4P A;  3HW8 A;  3HX0 A;  4XRH A;  1TV9 A;  4IQW A;  4EBJ A;  2PFQ A;  5CHG A;  3RJF A;  2HHP A;  3HJ4 A;  1ZQL A;  2BPF A;  4QZC A;  4RQ6 A;  4K9A A;  2ZHA A;  8ICM A;  4FO6 A;  2FCL A;  9ICV A;  3MDA A;  4Z6D A;  7ICR A;  3ERC C;  4EGW A;  1ZQM A;  3ISC A;  4X5V A;  4I2G A;  4XJE A;  5TZV A;  4O68 A;  4AT7 A;  1MQ3 A;  3RJE A;  8ICT A;  5J2J A;  5IIK A;  8ICU A;  4FHY A;  4UB2 A;  4X4S A;  5CFU A;  8ICP A;  4AT9 B;  5J0Q A;  3UXO A;  4R66 A;  3MDC A;  7ICE A;  4M9N A;  3NVO A;  9ICF A;  5CR0 A;  8ICJ A;  2HN1 A;  4UB5 A;  4KLO A;  5BPC A;  3MBY A;  4X4T A;  2DRB A;  4WC1 A;  5IIL A;  4K8V A;  5HR9 A;  3NWI A;  4I2B A;  4GXJ A;  4XUS A;  4NXW A;  4IQT A;  9ICB A;  9ICO A;  3RJG A;  1ZJN A;  3ER9 B;  2RFF A;  2VAN A;  3RJI A;  4NM2 A;  3JPT A;  4YD1 A;  9ICI A;  4F5N A;  1R8A A;  4UB3 A;  4NXZ A;  4E80 A;  2DR7 A;  4PHP A;  4K97 A;  5D63 A;  4UAZ A;  5J2C A;  2PFP A;  5J0S A;  4PPX A;  4QZH A;  4PGX A;  1JQR A;  4DO9 A;  3OUY B;  1ZQV A;  3RJJ A;  3RJH A;  5D61 A;  4PGY A;  5HRI A;  1ZJM A;  1R89 A;  5J2F A;  4RT3 A;  1XSL A;  4I0U A;  1KEJ A;  7ICN A;  4X0A A;  1RZT A;  4XQ7 A;  1ZQZ A;  4FHW A;  1MIV A;  4M04 A;  4WH5 A;  9ICG A;  8ICV A;  2BBJ A;  4YMN A;  3UQ0 A;  1ZQE A;  4MFA A;  4KLL A;  4RQ3 A;  1HUO A;  5III A;  8ICB A;  4FHP A;  8ICC A;  1ZQW A;  2GAF D;  2ZH9 A;  1UET A;  3L9D A;  4OAI Z;  4MF8 A;  4UAW A;  2P66 A;  3C5G A;  5J2E A;  3AQL A;  2IUB A;  4OAG A;  1BPX A;  3GDX A;  3RH4 A;  4M9H A;  4I2A A;  5F2V O;  3C2M A;  4TUS A;  4YCX A;  1TFY A;  4I2I A;  4O69 A;  4RWQ A;  1VJ7 A;  4WC7 A;  7ICP A;  2B51 A;  2ZH4 A;  1ZQO A;  9ICT A;  1ZQD A;  4RWO A;  4ATB A;  4UBC A;  7ICT A;  5J2H A;  9ICU A;  9ICL A;  4WC6 A;  3C18 A;  4EP7 A;  5DKW A;  3ISB A;  4QZF A;  2BCQ A;  2ZH8 A;  5J0W A;  7ICG A;  4GXK A;  1F5A A;  3RH6 A;  3JPO A;  3RJK A;  8ICO A;  4KLH A;  3OVB A;  4JLX A;  4F5O A;  4WCW A;  3PHZ A;  4LEW A;  4AT8 A;  4E7X A;  5D46 A;  9ICS A;  1JN3 A;  4UD5 A;  3OWG A;  5D49 A;  2DR9 A;  3V7L A;  3JYY A;  4KLT A;  4M9J A;  3V7K A;  1ZQU A;  4K9B A;  5CWR A;  5J2A A;  4LZG A;  1Q78 A;  4UD4 A;  9ICH A;  3H37 A;  8ICZ A;  8ICI A;  4OAH A;  9ICP A;  1KDH A;  1R8C A;  7ICF A;  3AQK A;  5DB8 A;  1ZQJ A;  4RQ4 A;  5B3Q A;  4Z6F A;  2B56 A;  5HRK A;  4M9L A;  2NRK A;  1BPE A;  4KLS A;  5HHH A;  4QZA A;  1MQ2 A;  4MFF A;  9ICQ A;  5DED A;  2GA9 D;  1BPZ A;  3NKU A;  9ICJ A;  5J2I A;  4KLI A;  5DBA A;  4AT7 B;  3AUO A;  1ZQG A;  3B0Y A;  5J2D A;  4R63 A;  4JLZ A;  3AU6 A;  2ID1 A;  4M0A A;  2ZH3 A;  1GPJ A;  2ZH6 A;  4FHV A;  1ZQA A;  8ICN A;  4RQ0 A;  4UB1 A;  1UEU A;  3RH5 A;  3WFP A;  2BCS A;  9ICC A;  1BPY A;  7ICV A;  4OAF A;  4NKT A;  2DRA A;  7ICJ A;  2M2W A;  4PHE A;  4MF2 A;  4K98 A;  3HIY A;  4KLG A;  4KB6 A;  5HRL A;  1XSN A;  5D4B A;  4WQK A;  2ISO A;  4LVS A;  4MFC A;  4FHX A;  4KLF A;  4RPY A;  7ICI A;  4HX0 A;  5J2G A;  4QZ8 A;  9ICW A;  4YMO A;  4QZD A;  4NXU A;  4RQ8 A;  4E8F A;  4XA5 A;  5DBC A;  4QZG A;  9ICR A;  3K75 D;  5CA7 A;  1MIY A;  4WC4 A;  2PBE A;  2DVI A;  1VFG A;  4NXV A;  1ZQF A;  3V7J A;  4NXT A;  4X4U A;  2M2U A;  4FH5 A;  1ZQI A;  4I2E A;  5J0P A;  5JTG A;  2BBH A;  4P4M A;  2BPC A;  3PML A;  3WFQ E;  1PX5 A;  1ZQH A;  2O5A A;  4X4N A;  4F5Q A;  2IHO A;  1ZQB A;  4F5R A;  2W9M A;  4UBB A;  3LK9 A;  7ICS A;  2BCV A;  4I2J A;  4NLZ A;  4I2C A;  5HRF A;  8ICH A;  5J0R A;  2M2V A;  8ICK A;  2PXI A;  1FA0 A;  5HRE A;  4LEY A;  4YD2 A;  3JCF A;  3WFO A;  3WFS C;  3UXN A;  8ICY A;  4UB4 A;  4IQU A;  4R64 A;  2GWS A;  3OVA A;  4P2H A;  4ATB B;  4R65 A;  3C5F A;  1NO5 A;  5CP2 A;  5IIN A;  3PNC A;  1JMS A;  4DOC A;  1BPB A;  1ZQQ A;  4EED A;  1ZQK A;  2FMS A;  4NM1 A;  7ICK A;  1TFW A;  1BPD A;  8ICX A;  3AQM A;  3PMN A;  7ICM A;  4O5E A;  9ICN A;  3B0X A;  4RT2 A;  5HRD A;  4RPZ A;  1WOT A;  4AT8 B;  3JZ0 A;  4K96 A;  4JWM A;  2PFO A;  4IG8 A;  5J0U A;  3UQ2 A;  3C2K A;  2BCU A;  1ZQY A;  4IQV A;  3H39 A;  4K4I A;  4X0B A;  8ICQ A;  4FH3 A;  4I28 A;  9ICM A;  4EV6 A;  4NLN A;  3AU2 A;  5CB1 A;  4WC3 A;  7ICQ A;  1TVA A;  4I29 A;  4EEB A;  7ICH A;  2ZH5 A;  4Z6E A;  3H38 A;  5CFT A;  2EWR A;  4M47 A;  8ICF A;  4TUR A;  4KLE A;  4M2Y A;  2BCR A;  1ZQP A;  4WBY A;  4RQ7 A;  1ZQT A;  4KM5 A;  4F5P A;  1ZQN A;  1JAJ A;  2I9G A;  5J0Y A;  2FMQ A;  4RQ5 A;  4AT9 A;  1NOM A; 
#chains in the Genus database with same CATH homology
 4P4P A;  9ICX A;  3HJ1 A;  2O1P A;  5EOZ A;  5BOL A;  4O5K A;  5HRG A;  4I2D A;  5DB6 A;  2ZH2 A;  4PHA A;  5DB7 A;  4X4Q A;  2M2T A;  2BE3 A;  5J2K A;  3HWT A;  4K4H A;  2ZH1 A;  4I27 A;  8ICA A;  3UPS A;  3NYB A;  3AQN A;  4QZE A;  4NY8 A;  4LT6 A;  4M5D A;  4KLJ A;  3ISD A;  9ICK A;  3WFR E;  2BPG A;  3JPR A;  1UEV A;  1HUZ A;  5J2B A;  4RPX A;  8ICW A;  5DB9 A;  3OUY A;  4GXI A;  4X4V A;  3TFS A;  4DOA A;  5DDY A;  4EBK A;  3C2L A;  4RWN A;  8ICR A;  4WC2 A;  4UAY A;  3V72 A;  4M9G A;  9ICA A;  8ICG A;  7ICU A;  5HHI A;  4PHD A;  4O9M A;  4PGQ A;  5DEC A;  5BOM A;  5IIM A;  1XSP A;  4RWP A;  3OVS A;  7ICL A;  1MIW A;  1OU5 A;  8ICE A;  4KLU A;  4S3N A;  4TUQ A;  4NLK A;  4WC5 A;  3UXP A;  1ZQR A;  4KLM A;  5IIO A;  4X4R A;  7ICO A;  3OV7 A;  4DOB A;  3H3A A;  5HC9 A;  5J29 A;  9ICE A;  1ZQC A;  4RQ1 A;  4K4G A;  3UPQ A;  4WC0 A;  4KLD A;  4XQ8 A;  4NKU A;  4I2F A;  1Q79 A;  5HRB A;  4WBZ A;  4YN4 A;  8ICL A;  2IHM A;  3JPS A;  4RQ2 A;  3MGH A;  5CJ7 A;  2DR8 A;  2PFN A;  4PH5 A;  5J0O A;  1ZQX A;  3LQC B;  4KLQ A;  4QZI A;  1ZQS A;  2ISP A;  4QZ9 A;  2DR5 A;  4P4O A;  5HRH A;  3JPQ A;  4YMM A;  1YLQ A;  1KNY A;  2FMP A;  1V4A A;  2ZHB A;  3JPP A;  4JWN A;  5J0T A;  3MGI A;  2Q66 A;  5DBB A;  3TFR A;  1RPL A;  4O5C A;  4X4O A;  4I2H A;  5J0X A;  2ZH7 A;  1R8B A;  4TUP A;  3JPN A;  3OGU A;  4QZB A;  4LZD A;  3C66 A;  8ICS A;  5IIJ A;  5DDM A;  4Z6C A;  4X4P A;  3HW8 A;  3HX0 A;  4XRH A;  1TV9 A;  4IQW A;  4EBJ A;  2PFQ A;  5CHG A;  3RJF A;  2HHP A;  3HJ4 A;  1ZQL A;  2BPF A;  4QZC A;  4RQ6 A;  2ZHA A;  8ICM A;  4FO6 A;  9ICV A;  3MDA A;  4Z6D A;  7ICR A;  1ZQM A;  3ISC A;  4X5V A;  4I2G A;  5TZV A;  4AT7 A;  1MQ3 A;  3RJE A;  8ICT A;  5J2J A;  5IIK A;  8ICU A;  4FHY A;  4UB2 A;  4X4S A;  8ICP A;  4AT9 B;  5J0Q A;  3UXO A;  4R66 A;  3MDC A;  7ICE A;  4M9N A;  9ICF A;  5CR0 A;  8ICJ A;  4UB5 A;  4KLO A;  5BPC A;  3MBY A;  4X4T A;  2DRB A;  4WC1 A;  5IIL A;  5HR9 A;  4I2B A;  4GXJ A;  4XUS A;  4IQT A;  9ICB A;  9ICO A;  3RJG A;  1ZJN A;  2RFF A;  2VAN A;  3RJI A;  4NM2 A;  3JPT A;  4YD1 A;  9ICI A;  4F5N A;  1R8A A;  4UB3 A;  4NXZ A;  4E80 A;  2DR7 A;  4PHP A;  4UAZ A;  5J2C A;  2PFP A;  5J0S A;  4PPX A;  4QZH A;  4PGX A;  1JQR A;  4DO9 A;  3OUY B;  1ZQV A;  3RJJ A;  3RJH A;  4PGY A;  5HRI A;  1ZJM A;  1R89 A;  5J2F A;  4RT3 A;  1XSL A;  1KEJ A;  7ICN A;  4X0A A;  1RZT A;  4XQ7 A;  1ZQZ A;  4FHW A;  1MIV A;  4M04 A;  9ICG A;  8ICV A;  4YMN A;  3UQ0 A;  1ZQE A;  4MFA A;  4KLL A;  4RQ3 A;  1HUO A;  5III A;  8ICB A;  4FHP A;  8ICC A;  1ZQW A;  2ZH9 A;  1UET A;  3L9D A;  4MF8 A;  4UAW A;  2P66 A;  3C5G A;  5J2E A;  3AQL A;  1BPX A;  3GDX A;  3RH4 A;  4M9H A;  4I2A A;  5F2V O;  3C2M A;  4TUS A;  4YCX A;  1TFY A;  4I2I A;  4RWQ A;  1VJ7 A;  4WC7 A;  7ICP A;  2ZH4 A;  1ZQO A;  9ICT A;  1ZQD A;  4RWO A;  4ATB A;  4UBC A;  7ICT A;  5J2H A;  9ICU A;  9ICL A;  4WC6 A;  3C18 A;  4EP7 A;  5DKW A;  3ISB A;  4QZF A;  2BCQ A;  2ZH8 A;  5J0W A;  7ICG A;  4GXK A;  1F5A A;  3RH6 A;  3JPO A;  3RJK A;  8ICO A;  4KLH A;  3OVB A;  4F5O A;  4WCW A;  4AT8 A;  4E7X A;  5D46 A;  9ICS A;  1JN3 A;  4UD5 A;  5D49 A;  2DR9 A;  3V7L A;  3JYY A;  4KLT A;  4M9J A;  3V7K A;  1ZQU A;  5CWR A;  5J2A A;  4LZG A;  1Q78 A;  4UD4 A;  9ICH A;  3H37 A;  8ICZ A;  8ICI A;  9ICP A;  1KDH A;  1R8C A;  7ICF A;  3AQK A;  5DB8 A;  1ZQJ A;  4RQ4 A;  4Z6F A;  5HRK A;  4M9L A;  2NRK A;  1BPE A;  4KLS A;  5HHH A;  4QZA A;  1MQ2 A;  4MFF A;  9ICQ A;  5DED A;  1BPZ A;  9ICJ A;  5J2I A;  4KLI A;  5DBA A;  4AT7 B;  3AUO A;  1ZQG A;  3B0Y A;  5J2D A;  4R63 A;  2ZH3 A;  3AU6 A;  2ID1 A;  4M0A A;  2ZH6 A;  4FHV A;  1ZQA A;  8ICN A;  4RQ0 A;  4UB1 A;  1UEU A;  3RH5 A;  3WFP A;  2BCS A;  9ICC A;  1BPY A;  7ICV A;  4NKT A;  2DRA A;  7ICJ A;  2M2W A;  4PHE A;  4MF2 A;  3HIY A;  4KLG A;  5HRL A;  1XSN A;  5D4B A;  2ISO A;  4LVS A;  4MFC A;  4FHX A;  4KLF A;  4RPY A;  7ICI A;  5J2G A;  4QZ8 A;  9ICW A;  4YMO A;  4QZD A;  4RQ8 A;  4E8F A;  4XA5 A;  5DBC A;  4QZG A;  9ICR A;  3K75 D;  5CA7 A;  1MIY A;  4WC4 A;  2PBE A;  2DVI A;  1VFG A;  1ZQF A;  3V7J A;  4X4U A;  2M2U A;  4FH5 A;  1ZQI A;  4I2E A;  5J0P A;  4P4M A;  2BPC A;  3PML A;  3WFQ E;  1PX5 A;  1ZQH A;  2O5A A;  4X4N A;  4F5Q A;  1ZQB A;  4F5R A;  2W9M A;  4UBB A;  3LK9 A;  7ICS A;  2BCV A;  4I2J A;  4NLZ A;  4I2C A;  5HRF A;  8ICH A;  5J0R A;  2M2V A;  8ICK A;  2PXI A;  1FA0 A;  5HRE A;  4YD2 A;  3WFO A;  3WFS C;  3UXN A;  8ICY A;  4UB4 A;  4IQU A;  4R64 A;  2GWS A;  3OVA A;  4P2H A;  4ATB B;  4R65 A;  3C5F A;  1NO5 A;  5CP2 A;  5IIN A;  3PNC A;  1JMS A;  4DOC A;  1BPB A;  1ZQQ A;  1ZQK A;  2FMS A;  4NM1 A;  7ICK A;  1TFW A;  1BPD A;  8ICX A;  3AQM A;  3PMN A;  7ICM A;  4O5E A;  9ICN A;  3B0X A;  4RT2 A;  5HRD A;  4RPZ A;  1WOT A;  4AT8 B;  3JZ0 A;  4JWM A;  2PFO A;  4IG8 A;  5J0U A;  3UQ2 A;  3C2K A;  2BCU A;  1ZQY A;  4IQV A;  3H39 A;  4K4I A;  4X0B A;  8ICQ A;  4FH3 A;  4I28 A;  9ICM A;  4NLN A;  3AU2 A;  5CB1 A;  4WC3 A;  7ICQ A;  1TVA A;  4I29 A;  7ICH A;  2ZH5 A;  4Z6E A;  3H38 A;  4M47 A;  8ICF A;  4TUR A;  4KLE A;  4M2Y A;  2BCR A;  1ZQP A;  4WBY A;  4RQ7 A;  1ZQT A;  4F5P A;  1ZQN A;  1JAJ A;  2I9G A;  5J0Y A;  2FMQ A;  4RQ5 A;  4AT9 A;  1NOM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...