1JQRA

Nmr structure of the african swine fever virus dna polymerase x
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
174
structure length
174
Chain Sequence
MLTLIQGKKIVNHLRSRLAFEYNGQLIKILSKNIVAVGSLRREEKMLNDVDLLIIVPEKKLLKHVLPNIRIKGLSFSVKVCGERKCVLFIEWEKKTYQLDLFTALAEEKPYAIFHFTGPVSYLIRIRAALKKKNYKLNQYGLFKNQTLVPLKITTEKELIKELGFTYRIPKKRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords DNA POLYMERASE BETA-LIKE
publication title Solution structure of a viral DNA polymerase X and evidence for a mutagenic function.
pubmed doi rcsb
source organism African swine fever virus
total genus 32
structure length 174
sequence length 174
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2001-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 1jqrA02
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 1jqrA01
4YMMA 8ICEA 4DOBA 9ICLA 1BPZA 4LVSA 3NYBA 1NOMA 1KNYA 4PHAA 1NO5A 3UXNA 1ZQNA 3HJ4A 4EBKA 1TFWA 4R64A 4KLOA 2FMSA 4I2GA 4M2YA 5J0YA 4Z6DA 3HWTA 4YMOA 4YD1A 9ICSA 3OUYA 5J2CA 2ZH9A 5HHHA 9ICJA 5DB7A 4NM2A 1Q78A 9ICKA 4KLEA 3UQ2A 2ZH3A 4XQ7A 3K75D 8ICYA 1ZQSA 4KLTA 8ICHA 3V7LA 3TFRA 4X4UA 8ICPA 1ZQRA 4RQ8A 4K4GA 2I9GA 3AQMA 2HHPA 4E80A 4YN4A 8ICLA 4XQ8A 1ZQQA 4UD5A 4F5NA 8ICNA 5DBAA 4AT8A 4KLMA 2DR5A 3JPQA 2BCRA 5J0QA 3OV7A 1ZQPA 4IQWA 5BPCA 5HC9A 3AQLA 4WC0A 4I2JA 1JQRA 4ATBA 4QZ9A 3WFOA 2DRAA 4MF2A 5HRLA 4KLHA 2BPCA 1TVAA 1BPXA 5F2VO 1ZJMA 2Q66A 4UBBA 5DBCA 5HHIA 5HRDA 4QZEA 3OUYB 5HRHA 2ZH6A 4FHVA 5CJ7A 3MGIA 4NKUA 5J0RA 3TFSA 8ICUA 3JPOA 4I2EA 4NY8A 4RT2A 8ICAA 4AT9B 4RQ4A 4R63A 4X4VA 2O5AA 4RWPA 4WC1A 4QZHA 5CB1A 4QZ8A 4KLFA 5J2AA 3C2LA 2BCVA 4KLLA 5HRIA 1VFGA 5DBBA 4E7XA 8ICOA 4X4QA 3C5FA 3HIYA 3C18A 1ZQCA 3JZ0A 3V7KA 4RPYA 3WFRE 3RJHA 3OGUA 1MIYA 3UXPA 4RWNA 5J2BA 4P4PA 4I2IA 5CA7A 4I2CA 4UB3A 3ISDA 7ICGA 3PNCA 4WBZA 2PFQA 5J2FA 2IHMA 1BPDA 4I2DA 5J2DA 1ZQTA 9ICOA 1ZQKA 5J0PA 4RQ5A 4KLGA 4ATBB 4WC4A 4TUSA 4I29A 2BE3A 4YD2A 4WCWA 2DR8A 5BOLA 8ICTA 4DOAA 4AT7A 4TUPA 2M2VA 4P2HA 4YCXA 9ICNA 3OVAA 1ZQXA 4X0AA 4FHYA 4KLSA 2ISOA 1ZQWA 1ZQEA 4I2AA 4FH3A 4M9NA 4KLDA 4PHPA 5J0UA 1ZQFA 4NLZA 3C2KA 7ICUA 5J0OA 2PXIA 1JN3A 4F5PA 4UAYA 4FHWA 3RJEA 4RQ7A 5HRKA 4UB5A 9ICFA 8ICZA 4NKTA 7ICQA 3AUOA 1BPBA 3WFSC 4PHDA 5DB6A 2PBEA 4RWQA 4X4NA 4S3NA 7ICEA 8ICCA 5IINA 4WC2A 2RFFA 3B0XA 5J2IA 4XRHA 3JPNA 3JPSA 5HRFA 5DB9A 3H39A 4RQ6A 9ICQA 8ICKA 4TUQA 3OVBA 4X4SA 2M2TA 1XSNA 3AQNA 4MFCA 4DOCA 5HR9A 4QZBA 2PFNA 8ICQA 4Z6CA 3JYYA 2ID1A 4WC3A 3RH5A 4EP7A 4X4RA 9ICEA 3V72A 3JPTA 4UB1A 3C5GA 4UBCA 2ZHBA 8ICIA 5DB8A 4I28A 4FO6A 1FA0A 5TZVA 4KLIA 5CP2A 1ZQIA 5CR0A 7ICLA 3HX0A 4M5DA 9ICGA 1TV9A 4RQ0A 4I2HA 4LZDA 1VJ7A 1ZQYA 2PFPA 3RJFA 3LQCB 3C66A 4IQUA 3RJKA 4UB2A 5DDYA 4M9GA 1YLQA 5BOMA 2BCSA 1ZQOA 1JAJA 4K4HA 2ZH4A 1OU5A 3AU6A 4XUSA 3WFPA 5J2GA 5HRBA 2DVIA 7ICIA 4QZIA 4F5OA 5J0XA 4UB4A 4I2FA 1UETA 3MGHA 3H38A 3ISBA 8ICSA 4O5KA 3PMLA 4M9JA 4QZCA 3H37A 1JMSA 4KLJA 4FH5A 3AU2A 2NRKA 4AT8B 4IQTA 3H3AA 4MF8A 2O1PA 4O5EA 4LT6A 4RWOA 2BCUA 8ICFA 3WFQE 2ZH1A 5DECA 5DKWA 3UQ0A 4M9HA 1PX5A 4R66A 3RJGA 3L9DA 3JPPA 5J29A 3RH4A 1ZQHA 4IG8A 2ZH8A 4PHEA 2DRBA 5J0SA 2ZHAA 4GXIA 4MFAA 9ICPA 4PH5A 9ICTA 1BPEA 7ICRA 4RQ2A 4GXKA 4X5VA 4FHPA 3ISCA 3HJ1A 4I27A 9ICIA 9ICMA 1RZTA 3UPQA 4F5QA 4P4OA 2ISPA 5D4BA 4I2BA 4TURA 3UPSA 1Q79A 1ZJNA 1XSPA 5D46A 4Z6EA 1KEJA 5J2KA 1ZQMA 1BPYA 2PFOA 4RPXA 1F5AA 4X4PA 1ZQJA 5J2EA 4PPXA 4GXJA 2VANA 4M0AA 3C2MA 4QZGA 1V4AA 3HW8A 5IIJA 5IIOA 7ICOA 4QZFA 3PMNA 9ICRA 4JWNA 4PGYA 8ICJA 8ICMA 4NLKA 5IILA 7ICMA 4X4OA 4AT9A 4RQ3A 4X4TA 4P4MA 4NLNA 5DDMA 3MBYA 7ICJA 4QZDA 1R8AA 5IIMA 4M04A 1MQ3A 4FHXA 4AT7B 1R8BA 2FMQA 1ZQAA 4KLQA 4XA5A 1R8CA 1UEVA 5EOZA 8ICXA 7ICVA 4NXZA 5IIKA 9ICHA 8ICVA 2ZH2A 7ICSA 3RJIA 4IQVA 5CHGA 4Z6FA 4PGXA 3AQKA 1TFYA 3UXOA 4PGQA 1HUOA 9ICBA 1ZQDA 2ZH5A 5J2JA 9ICUA 2DR7A 8ICWA 4RQ1A 1UEUA 1ZQLA 9ICCA 4YMNA 1MIVA 7ICHA 4RT3A 5CWRA 4WBYA 4WC5A 1WOTA 8ICRA 4K4IA 9ICVA 3V7JA 3RH6A 4DO9A 1ZQBA 5IIIA 4UAWA 4JWMA 4O9MA 4KLUA 4LZGA 4M9LA 1XSLA 7ICFA 4M47A 1ZQZA 7ICTA 3MDAA 1MQ2A 8ICBA 4F5RA 2P66A 2M2WA 7ICKA 5HREA 1ZQGA 2GWSA 2BPFA 5HRGA 4X0BA 4WC7A 8ICGA 9ICWA 3RJJA 5D49A 1R89A 4UD4A 3B0YA 4E8FA 4NM1A 2DR9A 1HUZA 5DEDA 5J0TA 2FMPA 7ICNA 4WC6A 2M2UA 9ICXA 5J0WA 1MIWA 3OVSA 1ZQUA 4UAZA 5J2HA 2ZH7A 4QZAA 3GDXA 4MFFA 3JPRA 7ICPA 1RPLA 1ZQVA 9ICAA 4O5CA 2BCQA 4R65A 3MDCA 2W9MA 1KDHA 2BPGA 4RPZA 3LK9A 4EBJA
chains in the Genus database with same CATH superfamily
4XJEA 4WQLA 4NXUA 4YMMA 8ICEA 4DOBA 9ICLA 4LEZA 1BPZA 4LVSA 3NYBA 1NOMA 1KNYA 4PHAA 4HX0A 4OAHA 1NO5A 3UXNA 1ZQNA 3HJ4A 4EBKA 4EEBA 1TFWA 4R64A 4KLOA 2FMSA 4I2GA 4M2YA 5J0YA 4Z6DA 3HWTA 4YMOA 4YD1A 9ICSA 3OUYA 5J2CA 2ZH9A 5HHHA 9ICJA 4WQKA 5DB7A 4NM2A 1Q78A 9ICKA 4KLEA 3UQ2A 2ZH3A 4XQ7A 3K75D 8ICYA 5CFTA 1ZQSA 4KLTA 8ICHA 3V7LA 3TFRA 4LEWA 4X4UA 8ICPA 2B51A 5B3PA 1ZQRA 4RQ8A 4K4GA 2I9GA 3AQMA 2HHPA 4E80A 4YN4A 8ICLA 4XQ8A 2BBHA 1ZQQA 4UD5A 4F5NA 8ICNA 4EV6A 5DBAA 4K98A 4AT8A 4KLMA 4O68A 2DR5A 3JPQA 2BCRA 5J0QA 3OV7A 1ZQPA 4IQWA 5BPCA 5HC9A 3AQLA 4KM5A 4WC0A 4I2JA 1JQRA 4ATBA 4QZ9A 3WFOA 2DRAA 4MF2A 5HRLA 4KLHA 2BPCA 1TVAA 1BPXA 5CFUA 2GA9D 5F2VO 1ZJMA 2Q66A 4UBBA 2BBJA 5DBCA 3EF2A 5HHIA 5HRDA 4QZEA 3OUYB 5HRHA 2ZH6A 4FHVA 3OWGA 5CJ7A 3MGIA 4NKUA 5J0RA 3TFSA 8ICUA 3JPOA 4I2EA 4NY8A 4RT2A 8ICAA 4AT9B 4RQ4A 4R63A 4X4VA 3NVOA 2O5AA 4OAFA 4RWPA 4WC1A 4QZHA 5CB1A 4QZ8A 4KLFA 5J2AA 3C2LA 2BCVA 4KLLA 5HRIA 1VFGA 5DBBA 4JLZA 4E7XA 8ICOA 5D61A 4X4QA 3C5FA 3HIYA 3C18A 3NWIA 1ZQCA 3JZ0A 4LEYA 3V7KA 4RPYA 3WFRE 3RJHA 3OGUA 1MIYA 3UXPA 4RWNA 5J2BA 4K96A 4P4PA 4I2IA 5CA7A 4I2CA 4UB3A 3ISDA 5D62A 7ICGA 4N7RA 4O6AA 3PNCA 4WBZA 2PFQA 5J2FA 2IHMA 1BPDA 4I2DA 5J2DA 1ZQTA 3ERCC 9ICOA 1ZQKA 5J0PA 4RQ5A 4KLGA 4ATBB 4WC4A 4TUSA 4I29A 2BE3A 4YD2A 4WCWA 2DR8A 5BOLA 8ICTA 5B3QA 4DOAA 4AT7A 2GAFD 4TUPA 2M2VA 4P2HA 4YCXA 9ICNA 3OVAA 1ZQXA 4NXVA 4X0AA 4FHYA 4KLSA 2ISOA 1ZQWA 1ZQEA 4I2AA 4FH3A 4M9NA 4KLDA 4PHPA 5J0UA 1ZQFA 4NLZA 3C2KA 2B56A 7ICUA 5J0OA 2PXIA 1JN3A 4F5PA 4UAYA 4FHWA 3RJEA 4RQ7A 5HRKA 4UB5A 9ICFA 8ICZA 4NKTA 7ICQA 3AUOA 1BPBA 3WFSC 4PHDA 5DB6A 2PBEA 4RWQA 4X4NA 4OAGA 4S3NA 7ICEA 8ICCA 5IINA 4WC2A 2RFFA 4EEDA 3B0XA 5J2IA 4XRHA 4JLXA 3JPNA 3JPSA 5HRFA 5DB9A 3H39A 4RQ6A 4K99A 4K9AA 9ICQA 8ICKA 4TUQA 3OVBA 4X4SA 2M2TA 1XSNA 3AQNA 4MFCA 4DOCA 5HR9A 4QZBA 2PFNA 8ICQA 4Z6CA 3JYYA 2ID1A 4WC3A 3RH5A 4EP7A 4X4RA 9ICEA 3V72A 3JPTA 4UB1A 3C5GA 4UBCA 2ZHBA 8ICIA 3JCFA 5DB8A 4I28A 4FO6A 3ER9B 1FA0A 5TZVA 4KLIA 5CP2A 1ZQIA 5CR0A 7ICLA 3HX0A 4M5DA 9ICGA 1TV9A 4RQ0A 4I2HA 4LZDA 1VJ7A 3CK6A 1ZQYA 2PFPA 3RJFA 3LQCB 3C66A 4IQUA 3RJKA 4UB2A 5DDYA 4M9GA 1YLQA 5BOMA 4I0UA 2BCSA 1ZQOA 1JAJA 4K4HA 2ZH4A 5D63A 1OU5A 3AU6A 4XUSA 3WFPA 5J2GA 5HRBA 2DVIA 7ICIA 4QZIA 4F5OA 5J0XA 4UB4A 4I2FA 1UETA 3MGHA 3H38A 3ISBA 2HN1A 4WOYA 8ICSA 4O5KA 3PMLA 4M9JA 4QZCA 3H37A 3NKUA 1JMSA 4KLJA 4FH5A 3AU2A 2NRKA 4AT8B 4IQTA 3PHZA 3H3AA 4MF8A 2O1PA 4O5EA 4LT6A 4RWOA 2BCUA 8ICFA 3WFQE 2ZH1A 5DECA 5DKWA 3UQ0A 4M9HA 1PX5A 4R66A 3RJGA 3L9DA 3JPPA 5J29A 3RH4A 1ZQHA 5CHEA 2ZH8A 4IG8A 4PHEA 2DRBA 5J0SA 2ZHAA 4GXIA 3ER8C 4MFAA 9ICPA 2FCLA 4PH5A 9ICTA 2IUBA 1BPEA 7ICRA 4WH5A 4RQ2A 4GXKA 4X5VA 4FHPA 3ISCA 3HJ1A 4I27A 9ICIA 9ICMA 1RZTA 3UPQA 4F5QA 4P4OA 2ISPA 4O69A 5D4BA 4I2BA 4K9BA 4TURA 2IHOA 3UPSA 1Q79A 2EWRA 1ZJNA 1XSPA 4K97A 5D46A 4Z6EA 1KEJA 5J2KA 1ZQMA 1BPYA 2PFOA 4RPXA 1F5AA 4X4PA 1ZQJA 4MKPA 5J2EA 1GPJA 4PPXA 4GXJA 2VANA 4M0AA 3C2MA 4QZGA 4FO1A 1V4AA 3HW8A 5IIJA 5IIOA 7ICOA 5CFSA 4QZFA 4O67A 3PMNA 9ICRA 4JWNA 4PGYA 8ICJA 8ICMA 4NLKA 5IILA 7ICMA 4X4OA 4AT9A 4RQ3A 4X4TA 4P4MA 4NLNA 5DDMA 2HN2A 3MBYA 7ICJA 4QZDA 1R8AA 2B4VA 5IIMA 4M04A 1MQ3A 4FHXA 4AT7B 1R8BA 2FMQA 1ZQAA 4KLQA 4XA5A 1R8CA 1UEVA 5EOZA 8ICXA 7ICVA 4NXZA 5IIKA 9ICHA 8ICVA 2ZH2A 7ICSA 3RJIA 3K7DA 4IQVA 5CHGA 4Z6FA 4PGXA 3AQKA 1TFYA 3UXOA 4PGQA 1HUOA 9ICBA 1ZQDA 2ZH5A 5J2JA 4K8VA 9ICUA 2DR7A 4NXWA 4NXTA 8ICWA 4RQ1A 1UEUA 1ZQLA 9ICCA 4YMNA 1MIVA 7ICHA 4RT3A 5CWRA 4WBYA 4WC5A 1WOTA 8ICRA 4K4IA 9ICVA 3V7JA 3RH6A 4DO9A 1ZQBA 5IIIA 4UAWA 4JWMA 4O9MA 4KLUA 4LZGA 4M9LA 1XSLA 7ICFA 4M47A 1ZQZA 7ICTA 3MDAA 1MQ2A 8ICBA 4F5RA 2P66A 2M2WA 7ICKA 5HREA 4NXXA 4EGWA 1ZQGA 2GWSA 2BPFA 5HRGA 4X0BA 4WC7A 8ICGA 9ICWA 3RJJA 5D49A 1R89A 4UD4A 3B0YA 4E8FA 4NM1A 2DR9A 1HUZA 4KB6A 5DEDA 5J0TA 2FMPA 7ICNA 4WC6A 2M2UA 9ICXA 5J0WA 1MIWA 3OVSA 1ZQUA 4UAZA 5J2HA 2ZH7A 4OAIZ 4QZAA 3GDXA 5JTGA 3MCRA 4MFFA 3JPRA 7ICPA 1RPLA 1ZQVA 9ICAA 4O5CA 2BCQA 4LEVA 4R65A 3MDCA 2W9MA 1KDHA 2BPGA 4RPZA 3LK9A 4EBJA
chains in the Genus database with same CATH topology
4YMMA 8ICEA 4DOBA 9ICLA 1BPZA 4LVSA 3NYBA 1NOMA 1KNYA 4PHAA 1NO5A 3UXNA 1ZQNA 3HJ4A 4EBKA 1TFWA 4R64A 4KLOA 2FMSA 4I2GA 4M2YA 5J0YA 4Z6DA 3HWTA 4YMOA 4YD1A 9ICSA 3OUYA 5J2CA 2ZH9A 5HHHA 9ICJA 5DB7A 4NM2A 1Q78A 9ICKA 4KLEA 3UQ2A 2ZH3A 4XQ7A 3K75D 8ICYA 1ZQSA 4KLTA 8ICHA 3V7LA 3TFRA 4X4UA 8ICPA 1ZQRA 4RQ8A 4K4GA 2I9GA 3AQMA 2HHPA 4E80A 4YN4A 8ICLA 4XQ8A 1ZQQA 4UD5A 4F5NA 8ICNA 5DBAA 4AT8A 4KLMA 2DR5A 3JPQA 2BCRA 5J0QA 3OV7A 1ZQPA 4IQWA 5BPCA 5HC9A 3AQLA 4WC0A 4I2JA 1JQRA 4ATBA 4QZ9A 3WFOA 2DRAA 4MF2A 5HRLA 4KLHA 2BPCA 1TVAA 1BPXA 5F2VO 1ZJMA 2Q66A 4UBBA 5DBCA 5HHIA 5HRDA 4QZEA 3OUYB 5HRHA 2ZH6A 4FHVA 5CJ7A 3MGIA 4NKUA 5J0RA 3TFSA 8ICUA 3JPOA 4I2EA 4NY8A 4RT2A 8ICAA 4AT9B 4RQ4A 4R63A 4X4VA 2O5AA 4RWPA 4WC1A 4QZHA 5CB1A 4QZ8A 4KLFA 5J2AA 3C2LA 2BCVA 4KLLA 5HRIA 1VFGA 5DBBA 4E7XA 8ICOA 4X4QA 3C5FA 3HIYA 3C18A 1ZQCA 3JZ0A 3V7KA 4RPYA 3WFRE 3RJHA 3OGUA 1MIYA 3UXPA 4RWNA 5J2BA 4P4PA 4I2IA 5CA7A 4I2CA 4UB3A 3ISDA 7ICGA 3PNCA 4WBZA 2PFQA 5J2FA 2IHMA 1BPDA 4I2DA 5J2DA 1ZQTA 9ICOA 1ZQKA 5J0PA 4RQ5A 4KLGA 4ATBB 4WC4A 4TUSA 4I29A 2BE3A 4YD2A 4WCWA 2DR8A 5BOLA 8ICTA 4DOAA 4AT7A 4TUPA 2M2VA 4P2HA 4YCXA 9ICNA 3OVAA 1ZQXA 4X0AA 4FHYA 4KLSA 2ISOA 1ZQWA 1ZQEA 4I2AA 4FH3A 4M9NA 4KLDA 4PHPA 5J0UA 1ZQFA 4NLZA 3C2KA 7ICUA 5J0OA 2PXIA 1JN3A 4F5PA 4UAYA 4FHWA 3RJEA 4RQ7A 5HRKA 4UB5A 9ICFA 8ICZA 4NKTA 7ICQA 3AUOA 1BPBA 3WFSC 4PHDA 5DB6A 2PBEA 4RWQA 4X4NA 4S3NA 7ICEA 8ICCA 5IINA 4WC2A 2RFFA 3B0XA 5J2IA 4XRHA 3JPNA 3JPSA 5HRFA 5DB9A 3H39A 4RQ6A 9ICQA 8ICKA 4TUQA 3OVBA 4X4SA 2M2TA 1XSNA 3AQNA 4MFCA 4DOCA 5HR9A 4QZBA 2PFNA 8ICQA 4Z6CA 3JYYA 2ID1A 4WC3A 3RH5A 4EP7A 4X4RA 9ICEA 3V72A 3JPTA 4UB1A 3C5GA 4UBCA 2ZHBA 8ICIA 5DB8A 4I28A 4FO6A 1FA0A 5TZVA 4KLIA 5CP2A 1ZQIA 5CR0A 7ICLA 3HX0A 4M5DA 9ICGA 1TV9A 4RQ0A 4I2HA 4LZDA 1VJ7A 1ZQYA 2PFPA 3RJFA 3LQCB 3C66A 4IQUA 3RJKA 4UB2A 5DDYA 4M9GA 1YLQA 5BOMA 2BCSA 1ZQOA 1JAJA 4K4HA 2ZH4A 1OU5A 3AU6A 4XUSA 3WFPA 5J2GA 5HRBA 2DVIA 7ICIA 4QZIA 4F5OA 5J0XA 4UB4A 4I2FA 1UETA 3MGHA 3H38A 3ISBA 8ICSA 4O5KA 3PMLA 4M9JA 4QZCA 3H37A 1JMSA 4KLJA 4FH5A 3AU2A 2NRKA 4AT8B 4IQTA 3H3AA 4MF8A 2O1PA 4O5EA 4LT6A 4RWOA 2BCUA 8ICFA 3WFQE 2ZH1A 5DECA 5DKWA 3UQ0A 4M9HA 1PX5A 4R66A 3RJGA 3L9DA 3JPPA 5J29A 3RH4A 1ZQHA 4IG8A 2ZH8A 4PHEA 2DRBA 5J0SA 2ZHAA 4GXIA 4MFAA 9ICPA 4PH5A 9ICTA 1BPEA 7ICRA 4RQ2A 4GXKA 4X5VA 4FHPA 3ISCA 3HJ1A 4I27A 9ICIA 9ICMA 1RZTA 3UPQA 4F5QA 4P4OA 2ISPA 5D4BA 4I2BA 4TURA 3UPSA 1Q79A 1ZJNA 1XSPA 5D46A 4Z6EA 1KEJA 5J2KA 1ZQMA 1BPYA 2PFOA 4RPXA 1F5AA 4X4PA 1ZQJA 5J2EA 4PPXA 4GXJA 2VANA 4M0AA 3C2MA 4QZGA 1V4AA 3HW8A 5IIJA 5IIOA 7ICOA 4QZFA 3PMNA 9ICRA 4JWNA 4PGYA 8ICJA 8ICMA 4NLKA 5IILA 7ICMA 4X4OA 4AT9A 4RQ3A 4X4TA 4P4MA 4NLNA 5DDMA 3MBYA 7ICJA 4QZDA 1R8AA 5IIMA 4M04A 1MQ3A 4FHXA 4AT7B 1R8BA 2FMQA 1ZQAA 4KLQA 4XA5A 1R8CA 1UEVA 5EOZA 8ICXA 7ICVA 4NXZA 5IIKA 9ICHA 8ICVA 2ZH2A 7ICSA 3RJIA 4IQVA 5CHGA 4Z6FA 4PGXA 3AQKA 1TFYA 3UXOA 4PGQA 1HUOA 9ICBA 1ZQDA 2ZH5A 5J2JA 9ICUA 2DR7A 8ICWA 4RQ1A 1UEUA 1ZQLA 9ICCA 4YMNA 1MIVA 7ICHA 4RT3A 5CWRA 4WBYA 4WC5A 1WOTA 8ICRA 4K4IA 9ICVA 3V7JA 3RH6A 4DO9A 1ZQBA 5IIIA 4UAWA 4JWMA 4O9MA 4KLUA 4LZGA 4M9LA 1XSLA 7ICFA 4M47A 1ZQZA 7ICTA 3MDAA 1MQ2A 8ICBA 4F5RA 2P66A 2M2WA 7ICKA 5HREA 1ZQGA 2GWSA 2BPFA 5HRGA 4X0BA 4WC7A 8ICGA 9ICWA 3RJJA 5D49A 1R89A 4UD4A 3B0YA 4E8FA 4NM1A 2DR9A 1HUZA 5DEDA 5J0TA 2FMPA 7ICNA 4WC6A 2M2UA 9ICXA 5J0WA 1MIWA 3OVSA 1ZQUA 4UAZA 5J2HA 2ZH7A 4QZAA 3GDXA 4MFFA 3JPRA 7ICPA 1RPLA 1ZQVA 9ICAA 4O5CA 2BCQA 4R65A 3MDCA 2W9MA 1KDHA 2BPGA 4RPZA 3LK9A 4EBJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YMM A;  8ICE A;  4DOB A;  9ICL A;  1BPZ A;  4LVS A;  3NYB A;  1NOM A;  1KNY A;  4PHA A;  1NO5 A;  3UXN A;  1ZQN A;  3HJ4 A;  4EBK A;  1TFW A;  4R64 A;  4KLO A;  2FMS A;  4I2G A;  4M2Y A;  5J0Y A;  4Z6D A;  3HWT A;  4YMO A;  4YD1 A;  9ICS A;  3OUY A;  5J2C A;  2ZH9 A;  5HHH A;  9ICJ A;  5DB7 A;  4NM2 A;  1Q78 A;  9ICK A;  4KLE A;  3UQ2 A;  2ZH3 A;  4XQ7 A;  3K75 D;  8ICY A;  1ZQS A;  4KLT A;  8ICH A;  3V7L A;  3TFR A;  4X4U A;  8ICP A;  1ZQR A;  4RQ8 A;  4K4G A;  2I9G A;  3AQM A;  2HHP A;  4E80 A;  4YN4 A;  8ICL A;  4XQ8 A;  1ZQQ A;  4UD5 A;  4F5N A;  8ICN A;  5DBA A;  4AT8 A;  4KLM A;  2DR5 A;  3JPQ A;  2BCR A;  5J0Q A;  3OV7 A;  1ZQP A;  4IQW A;  5BPC A;  5HC9 A;  3AQL A;  4WC0 A;  4I2J A;  1JQR A;  4ATB A;  4QZ9 A;  3WFO A;  2DRA A;  4MF2 A;  5HRL A;  4KLH A;  2BPC A;  1TVA A;  1BPX A;  5F2V O;  1ZJM A;  2Q66 A;  4UBB A;  5DBC A;  5HHI A;  5HRD A;  4QZE A;  3OUY B;  5HRH A;  2ZH6 A;  4FHV A;  5CJ7 A;  3MGI A;  4NKU A;  5J0R A;  3TFS A;  8ICU A;  3JPO A;  4I2E A;  4NY8 A;  4RT2 A;  8ICA A;  4AT9 B;  4RQ4 A;  4R63 A;  4X4V A;  2O5A A;  4RWP A;  4WC1 A;  4QZH A;  5CB1 A;  4QZ8 A;  4KLF A;  5J2A A;  3C2L A;  2BCV A;  4KLL A;  5HRI A;  1VFG A;  5DBB A;  4E7X A;  8ICO A;  4X4Q A;  3C5F A;  3HIY A;  3C18 A;  1ZQC A;  3JZ0 A;  3V7K A;  4RPY A;  3WFR E;  3RJH A;  3OGU A;  1MIY A;  3UXP A;  4RWN A;  5J2B A;  4P4P A;  4I2I A;  5CA7 A;  4I2C A;  4UB3 A;  3ISD A;  7ICG A;  3PNC A;  4WBZ A;  2PFQ A;  5J2F A;  2IHM A;  1BPD A;  4I2D A;  5J2D A;  1ZQT A;  9ICO A;  1ZQK A;  5J0P A;  4RQ5 A;  4KLG A;  4ATB B;  4WC4 A;  4TUS A;  4I29 A;  2BE3 A;  4YD2 A;  4WCW A;  2DR8 A;  5BOL A;  8ICT A;  4DOA A;  4AT7 A;  4TUP A;  2M2V A;  4P2H A;  4YCX A;  9ICN A;  3OVA A;  1ZQX A;  4X0A A;  4FHY A;  4KLS A;  2ISO A;  1ZQW A;  1ZQE A;  4I2A A;  4FH3 A;  4M9N A;  4KLD A;  4PHP A;  5J0U A;  1ZQF A;  4NLZ A;  3C2K A;  7ICU A;  5J0O A;  2PXI A;  1JN3 A;  4F5P A;  4UAY A;  4FHW A;  3RJE A;  4RQ7 A;  5HRK A;  4UB5 A;  9ICF A;  8ICZ A;  4NKT A;  7ICQ A;  3AUO A;  1BPB A;  3WFS C;  4PHD A;  5DB6 A;  2PBE A;  4RWQ A;  4X4N A;  4S3N A;  7ICE A;  8ICC A;  5IIN A;  4WC2 A;  2RFF A;  3B0X A;  5J2I A;  4XRH A;  3JPN A;  3JPS A;  5HRF A;  5DB9 A;  3H39 A;  4RQ6 A;  9ICQ A;  8ICK A;  4TUQ A;  3OVB A;  4X4S A;  2M2T A;  1XSN A;  3AQN A;  4MFC A;  4DOC A;  5HR9 A;  4QZB A;  2PFN A;  8ICQ A;  4Z6C A;  3JYY A;  2ID1 A;  4WC3 A;  3RH5 A;  4EP7 A;  4X4R A;  9ICE A;  3V72 A;  3JPT A;  4UB1 A;  3C5G A;  4UBC A;  2ZHB A;  8ICI A;  5DB8 A;  4I28 A;  4FO6 A;  1FA0 A;  5TZV A;  4KLI A;  5CP2 A;  1ZQI A;  5CR0 A;  7ICL A;  3HX0 A;  4M5D A;  9ICG A;  1TV9 A;  4RQ0 A;  4I2H A;  4LZD A;  1VJ7 A;  1ZQY A;  2PFP A;  3RJF A;  3LQC B;  3C66 A;  4IQU A;  3RJK A;  4UB2 A;  5DDY A;  4M9G A;  1YLQ A;  5BOM A;  2BCS A;  1ZQO A;  1JAJ A;  4K4H A;  2ZH4 A;  1OU5 A;  3AU6 A;  4XUS A;  3WFP A;  5J2G A;  5HRB A;  2DVI A;  7ICI A;  4QZI A;  4F5O A;  5J0X A;  4UB4 A;  4I2F A;  1UET A;  3MGH A;  3H38 A;  3ISB A;  8ICS A;  4O5K A;  3PML A;  4M9J A;  4QZC A;  3H37 A;  1JMS A;  4KLJ A;  4FH5 A;  3AU2 A;  2NRK A;  4AT8 B;  4IQT A;  3H3A A;  4MF8 A;  2O1P A;  4O5E A;  4LT6 A;  4RWO A;  2BCU A;  8ICF A;  3WFQ E;  2ZH1 A;  5DEC A;  5DKW A;  3UQ0 A;  4M9H A;  1PX5 A;  4R66 A;  3RJG A;  3L9D A;  3JPP A;  5J29 A;  3RH4 A;  1ZQH A;  4IG8 A;  2ZH8 A;  4PHE A;  2DRB A;  5J0S A;  2ZHA A;  4GXI A;  4MFA A;  9ICP A;  4PH5 A;  9ICT A;  1BPE A;  7ICR A;  4RQ2 A;  4GXK A;  4X5V A;  4FHP A;  3ISC A;  3HJ1 A;  4I27 A;  9ICI A;  9ICM A;  1RZT A;  3UPQ A;  4F5Q A;  4P4O A;  2ISP A;  5D4B A;  4I2B A;  4TUR A;  3UPS A;  1Q79 A;  1ZJN A;  1XSP A;  5D46 A;  4Z6E A;  1KEJ A;  5J2K A;  1ZQM A;  1BPY A;  2PFO A;  4RPX A;  1F5A A;  4X4P A;  1ZQJ A;  5J2E A;  4PPX A;  4GXJ A;  2VAN A;  4M0A A;  3C2M A;  4QZG A;  1V4A A;  3HW8 A;  5IIJ A;  5IIO A;  7ICO A;  4QZF A;  3PMN A;  9ICR A;  4JWN A;  4PGY A;  8ICJ A;  8ICM A;  4NLK A;  5IIL A;  7ICM A;  4X4O A;  4AT9 A;  4RQ3 A;  4X4T A;  4P4M A;  4NLN A;  5DDM A;  3MBY A;  7ICJ A;  4QZD A;  1R8A A;  5IIM A;  4M04 A;  1MQ3 A;  4FHX A;  4AT7 B;  1R8B A;  2FMQ A;  1ZQA A;  4KLQ A;  4XA5 A;  1R8C A;  1UEV A;  5EOZ A;  8ICX A;  7ICV A;  4NXZ A;  5IIK A;  9ICH A;  8ICV A;  2ZH2 A;  7ICS A;  3RJI A;  4IQV A;  5CHG A;  4Z6F A;  4PGX A;  3AQK A;  1TFY A;  3UXO A;  4PGQ A;  1HUO A;  9ICB A;  1ZQD A;  2ZH5 A;  5J2J A;  9ICU A;  2DR7 A;  8ICW A;  4RQ1 A;  1UEU A;  1ZQL A;  9ICC A;  4YMN A;  1MIV A;  7ICH A;  4RT3 A;  5CWR A;  4WBY A;  4WC5 A;  1WOT A;  8ICR A;  4K4I A;  9ICV A;  3V7J A;  3RH6 A;  4DO9 A;  1ZQB A;  5III A;  4UAW A;  4JWM A;  4O9M A;  4KLU A;  4LZG A;  4M9L A;  1XSL A;  7ICF A;  4M47 A;  1ZQZ A;  7ICT A;  3MDA A;  1MQ2 A;  8ICB A;  4F5R A;  2P66 A;  2M2W A;  7ICK A;  5HRE A;  1ZQG A;  2GWS A;  2BPF A;  5HRG A;  4X0B A;  4WC7 A;  8ICG A;  9ICW A;  3RJJ A;  5D49 A;  1R89 A;  4UD4 A;  3B0Y A;  4E8F A;  4NM1 A;  2DR9 A;  1HUZ A;  5DED A;  5J0T A;  2FMP A;  7ICN A;  4WC6 A;  2M2U A;  9ICX A;  5J0W A;  1MIW A;  3OVS A;  1ZQU A;  4UAZ A;  5J2H A;  2ZH7 A;  4QZA A;  3GDX A;  4MFF A;  3JPR A;  7ICP A;  1RPL A;  1ZQV A;  9ICA A;  4O5C A;  2BCQ A;  4R65 A;  3MDC A;  2W9M A;  1KDH A;  2BPG A;  4RPZ A;  3LK9 A;  4EBJ A; 
#chains in the Genus database with same CATH topology
 4XJE A;  4WQL A;  4NXU A;  4YMM A;  8ICE A;  4DOB A;  9ICL A;  4LEZ A;  1BPZ A;  4LVS A;  3NYB A;  1NOM A;  1KNY A;  4PHA A;  4HX0 A;  4OAH A;  1NO5 A;  3UXN A;  1ZQN A;  3HJ4 A;  4EBK A;  4EEB A;  1TFW A;  4R64 A;  4KLO A;  2FMS A;  4I2G A;  4M2Y A;  5J0Y A;  4Z6D A;  3HWT A;  4YMO A;  4YD1 A;  9ICS A;  3OUY A;  5J2C A;  2ZH9 A;  5HHH A;  9ICJ A;  4WQK A;  5DB7 A;  4NM2 A;  1Q78 A;  9ICK A;  4KLE A;  3UQ2 A;  2ZH3 A;  4XQ7 A;  3K75 D;  8ICY A;  5CFT A;  1ZQS A;  4KLT A;  8ICH A;  3V7L A;  3TFR A;  4LEW A;  4X4U A;  8ICP A;  2B51 A;  5B3P A;  1ZQR A;  4RQ8 A;  4K4G A;  2I9G A;  3AQM A;  2HHP A;  4E80 A;  4YN4 A;  8ICL A;  4XQ8 A;  2BBH A;  1ZQQ A;  4UD5 A;  4F5N A;  8ICN A;  4EV6 A;  5DBA A;  4K98 A;  4AT8 A;  4KLM A;  4O68 A;  2DR5 A;  3JPQ A;  2BCR A;  5J0Q A;  3OV7 A;  1ZQP A;  4IQW A;  5BPC A;  5HC9 A;  3AQL A;  4KM5 A;  4WC0 A;  4I2J A;  1JQR A;  4ATB A;  4QZ9 A;  3WFO A;  2DRA A;  4MF2 A;  5HRL A;  4KLH A;  2BPC A;  1TVA A;  1BPX A;  5CFU A;  2GA9 D;  5F2V O;  1ZJM A;  2Q66 A;  4UBB A;  2BBJ A;  5DBC A;  3EF2 A;  5HHI A;  5HRD A;  4QZE A;  3OUY B;  5HRH A;  2ZH6 A;  4FHV A;  3OWG A;  5CJ7 A;  3MGI A;  4NKU A;  5J0R A;  3TFS A;  8ICU A;  3JPO A;  4I2E A;  4NY8 A;  4RT2 A;  8ICA A;  4AT9 B;  4RQ4 A;  4R63 A;  4X4V A;  3NVO A;  2O5A A;  4OAF A;  4RWP A;  4WC1 A;  4QZH A;  5CB1 A;  4QZ8 A;  4KLF A;  5J2A A;  3C2L A;  2BCV A;  4KLL A;  5HRI A;  1VFG A;  5DBB A;  4JLZ A;  4E7X A;  8ICO A;  5D61 A;  4X4Q A;  3C5F A;  3HIY A;  3C18 A;  3NWI A;  1ZQC A;  3JZ0 A;  4LEY A;  3V7K A;  4RPY A;  3WFR E;  3RJH A;  3OGU A;  1MIY A;  3UXP A;  4RWN A;  5J2B A;  4K96 A;  4P4P A;  4I2I A;  5CA7 A;  4I2C A;  4UB3 A;  3ISD A;  5D62 A;  7ICG A;  4N7R A;  4O6A A;  3PNC A;  4WBZ A;  2PFQ A;  5J2F A;  2IHM A;  1BPD A;  4I2D A;  5J2D A;  1ZQT A;  3ERC C;  9ICO A;  1ZQK A;  5J0P A;  4RQ5 A;  4KLG A;  4ATB B;  4WC4 A;  4TUS A;  4I29 A;  2BE3 A;  4YD2 A;  4WCW A;  2DR8 A;  5BOL A;  8ICT A;  5B3Q A;  4DOA A;  4AT7 A;  2GAF D;  4TUP A;  2M2V A;  4P2H A;  4YCX A;  9ICN A;  3OVA A;  1ZQX A;  4NXV A;  4X0A A;  4FHY A;  4KLS A;  2ISO A;  1ZQW A;  1ZQE A;  4I2A A;  4FH3 A;  4M9N A;  4KLD A;  4PHP A;  5J0U A;  1ZQF A;  4NLZ A;  3C2K A;  2B56 A;  7ICU A;  5J0O A;  2PXI A;  1JN3 A;  4F5P A;  4UAY A;  4FHW A;  3RJE A;  4RQ7 A;  5HRK A;  4UB5 A;  9ICF A;  8ICZ A;  4NKT A;  7ICQ A;  3AUO A;  1BPB A;  3WFS C;  4PHD A;  5DB6 A;  2PBE A;  4RWQ A;  4X4N A;  4OAG A;  4S3N A;  7ICE A;  8ICC A;  5IIN A;  4WC2 A;  2RFF A;  4EED A;  3B0X A;  5J2I A;  4XRH A;  4JLX A;  3JPN A;  3JPS A;  5HRF A;  5DB9 A;  3H39 A;  4RQ6 A;  4K99 A;  4K9A A;  9ICQ A;  8ICK A;  4TUQ A;  3OVB A;  4X4S A;  2M2T A;  1XSN A;  3AQN A;  4MFC A;  4DOC A;  5HR9 A;  4QZB A;  2PFN A;  8ICQ A;  4Z6C A;  3JYY A;  2ID1 A;  4WC3 A;  3RH5 A;  4EP7 A;  4X4R A;  9ICE A;  3V72 A;  3JPT A;  4UB1 A;  3C5G A;  4UBC A;  2ZHB A;  8ICI A;  3JCF A;  5DB8 A;  4I28 A;  4FO6 A;  3ER9 B;  1FA0 A;  5TZV A;  4KLI A;  5CP2 A;  1ZQI A;  5CR0 A;  7ICL A;  3HX0 A;  4M5D A;  9ICG A;  1TV9 A;  4RQ0 A;  4I2H A;  4LZD A;  1VJ7 A;  3CK6 A;  1ZQY A;  2PFP A;  3RJF A;  3LQC B;  3C66 A;  4IQU A;  3RJK A;  4UB2 A;  5DDY A;  4M9G A;  1YLQ A;  5BOM A;  4I0U A;  2BCS A;  1ZQO A;  1JAJ A;  4K4H A;  2ZH4 A;  5D63 A;  1OU5 A;  3AU6 A;  4XUS A;  3WFP A;  5J2G A;  5HRB A;  2DVI A;  7ICI A;  4QZI A;  4F5O A;  5J0X A;  4UB4 A;  4I2F A;  1UET A;  3MGH A;  3H38 A;  3ISB A;  2HN1 A;  4WOY A;  8ICS A;  4O5K A;  3PML A;  4M9J A;  4QZC A;  3H37 A;  3NKU A;  1JMS A;  4KLJ A;  4FH5 A;  3AU2 A;  2NRK A;  4AT8 B;  4IQT A;  3PHZ A;  3H3A A;  4MF8 A;  2O1P A;  4O5E A;  4LT6 A;  4RWO A;  2BCU A;  8ICF A;  3WFQ E;  2ZH1 A;  5DEC A;  5DKW A;  3UQ0 A;  4M9H A;  1PX5 A;  4R66 A;  3RJG A;  3L9D A;  3JPP A;  5J29 A;  3RH4 A;  1ZQH A;  5CHE A;  2ZH8 A;  4IG8 A;  4PHE A;  2DRB A;  5J0S A;  2ZHA A;  4GXI A;  3ER8 C;  4MFA A;  9ICP A;  2FCL A;  4PH5 A;  9ICT A;  2IUB A;  1BPE A;  7ICR A;  4WH5 A;  4RQ2 A;  4GXK A;  4X5V A;  4FHP A;  3ISC A;  3HJ1 A;  4I27 A;  9ICI A;  9ICM A;  1RZT A;  3UPQ A;  4F5Q A;  4P4O A;  2ISP A;  4O69 A;  5D4B A;  4I2B A;  4K9B A;  4TUR A;  2IHO A;  3UPS A;  1Q79 A;  2EWR A;  1ZJN A;  1XSP A;  4K97 A;  5D46 A;  4Z6E A;  1KEJ A;  5J2K A;  1ZQM A;  1BPY A;  2PFO A;  4RPX A;  1F5A A;  4X4P A;  1ZQJ A;  4MKP A;  5J2E A;  1GPJ A;  4PPX A;  4GXJ A;  2VAN A;  4M0A A;  3C2M A;  4QZG A;  4FO1 A;  1V4A A;  3HW8 A;  5IIJ A;  5IIO A;  7ICO A;  5CFS A;  4QZF A;  4O67 A;  3PMN A;  9ICR A;  4JWN A;  4PGY A;  8ICJ A;  8ICM A;  4NLK A;  5IIL A;  7ICM A;  4X4O A;  4AT9 A;  4RQ3 A;  4X4T A;  4P4M A;  4NLN A;  5DDM A;  2HN2 A;  3MBY A;  7ICJ A;  4QZD A;  1R8A A;  2B4V A;  5IIM A;  4M04 A;  1MQ3 A;  4FHX A;  4AT7 B;  1R8B A;  2FMQ A;  1ZQA A;  4KLQ A;  4XA5 A;  1R8C A;  1UEV A;  5EOZ A;  8ICX A;  7ICV A;  4NXZ A;  5IIK A;  9ICH A;  8ICV A;  2ZH2 A;  7ICS A;  3RJI A;  3K7D A;  4IQV A;  5CHG A;  4Z6F A;  4PGX A;  3AQK A;  1TFY A;  3UXO A;  4PGQ A;  1HUO A;  9ICB A;  1ZQD A;  2ZH5 A;  5J2J A;  4K8V A;  9ICU A;  2DR7 A;  4NXW A;  4NXT A;  8ICW A;  4RQ1 A;  1UEU A;  1ZQL A;  9ICC A;  4YMN A;  1MIV A;  7ICH A;  4RT3 A;  5CWR A;  4WBY A;  4WC5 A;  1WOT A;  8ICR A;  4K4I A;  9ICV A;  3V7J A;  3RH6 A;  4DO9 A;  1ZQB A;  5III A;  4UAW A;  4JWM A;  4O9M A;  4KLU A;  4LZG A;  4M9L A;  1XSL A;  7ICF A;  4M47 A;  1ZQZ A;  7ICT A;  3MDA A;  1MQ2 A;  8ICB A;  4F5R A;  2P66 A;  2M2W A;  7ICK A;  5HRE A;  4NXX A;  4EGW A;  1ZQG A;  2GWS A;  2BPF A;  5HRG A;  4X0B A;  4WC7 A;  8ICG A;  9ICW A;  3RJJ A;  5D49 A;  1R89 A;  4UD4 A;  3B0Y A;  4E8F A;  4NM1 A;  2DR9 A;  1HUZ A;  4KB6 A;  5DED A;  5J0T A;  2FMP A;  7ICN A;  4WC6 A;  2M2U A;  9ICX A;  5J0W A;  1MIW A;  3OVS A;  1ZQU A;  4UAZ A;  5J2H A;  2ZH7 A;  4OAI Z;  4QZA A;  3GDX A;  5JTG A;  3MCR A;  4MFF A;  3JPR A;  7ICP A;  1RPL A;  1ZQV A;  9ICA A;  4O5C A;  2BCQ A;  4LEV A;  4R65 A;  3MDC A;  2W9M A;  1KDH A;  2BPG A;  4RPZ A;  3LK9 A;  4EBJ A; 
#chains in the Genus database with same CATH homology
 4YMM A;  8ICE A;  4DOB A;  9ICL A;  1BPZ A;  4LVS A;  3NYB A;  1NOM A;  1KNY A;  4PHA A;  1NO5 A;  3UXN A;  1ZQN A;  3HJ4 A;  4EBK A;  1TFW A;  4R64 A;  4KLO A;  2FMS A;  4I2G A;  4M2Y A;  5J0Y A;  4Z6D A;  3HWT A;  4YMO A;  4YD1 A;  9ICS A;  3OUY A;  5J2C A;  2ZH9 A;  5HHH A;  9ICJ A;  5DB7 A;  4NM2 A;  1Q78 A;  9ICK A;  4KLE A;  3UQ2 A;  2ZH3 A;  4XQ7 A;  3K75 D;  8ICY A;  1ZQS A;  4KLT A;  8ICH A;  3V7L A;  3TFR A;  4X4U A;  8ICP A;  1ZQR A;  4RQ8 A;  4K4G A;  2I9G A;  3AQM A;  2HHP A;  4E80 A;  4YN4 A;  8ICL A;  4XQ8 A;  1ZQQ A;  4UD5 A;  4F5N A;  8ICN A;  5DBA A;  4AT8 A;  4KLM A;  2DR5 A;  3JPQ A;  2BCR A;  5J0Q A;  3OV7 A;  1ZQP A;  4IQW A;  5BPC A;  5HC9 A;  3AQL A;  4WC0 A;  4I2J A;  1JQR A;  4ATB A;  4QZ9 A;  3WFO A;  2DRA A;  4MF2 A;  5HRL A;  4KLH A;  2BPC A;  1TVA A;  1BPX A;  5F2V O;  1ZJM A;  2Q66 A;  4UBB A;  5DBC A;  5HHI A;  5HRD A;  4QZE A;  3OUY B;  5HRH A;  2ZH6 A;  4FHV A;  5CJ7 A;  3MGI A;  4NKU A;  5J0R A;  3TFS A;  8ICU A;  3JPO A;  4I2E A;  4NY8 A;  4RT2 A;  8ICA A;  4AT9 B;  4RQ4 A;  4R63 A;  4X4V A;  2O5A A;  4RWP A;  4WC1 A;  4QZH A;  5CB1 A;  4QZ8 A;  4KLF A;  5J2A A;  3C2L A;  2BCV A;  4KLL A;  5HRI A;  1VFG A;  5DBB A;  4E7X A;  8ICO A;  4X4Q A;  3C5F A;  3HIY A;  3C18 A;  1ZQC A;  3JZ0 A;  3V7K A;  4RPY A;  3WFR E;  3RJH A;  3OGU A;  1MIY A;  3UXP A;  4RWN A;  5J2B A;  4P4P A;  4I2I A;  5CA7 A;  4I2C A;  4UB3 A;  3ISD A;  7ICG A;  3PNC A;  4WBZ A;  2PFQ A;  5J2F A;  2IHM A;  1BPD A;  4I2D A;  5J2D A;  1ZQT A;  9ICO A;  1ZQK A;  5J0P A;  4RQ5 A;  4KLG A;  4ATB B;  4WC4 A;  4TUS A;  4I29 A;  2BE3 A;  4YD2 A;  4WCW A;  2DR8 A;  5BOL A;  8ICT A;  4DOA A;  4AT7 A;  4TUP A;  2M2V A;  4P2H A;  4YCX A;  9ICN A;  3OVA A;  1ZQX A;  4X0A A;  4FHY A;  4KLS A;  2ISO A;  1ZQW A;  1ZQE A;  4I2A A;  4FH3 A;  4M9N A;  4KLD A;  4PHP A;  5J0U A;  1ZQF A;  4NLZ A;  3C2K A;  7ICU A;  5J0O A;  2PXI A;  1JN3 A;  4F5P A;  4UAY A;  4FHW A;  3RJE A;  4RQ7 A;  5HRK A;  4UB5 A;  9ICF A;  8ICZ A;  4NKT A;  7ICQ A;  3AUO A;  1BPB A;  3WFS C;  4PHD A;  5DB6 A;  2PBE A;  4RWQ A;  4X4N A;  4S3N A;  7ICE A;  8ICC A;  5IIN A;  4WC2 A;  2RFF A;  3B0X A;  5J2I A;  4XRH A;  3JPN A;  3JPS A;  5HRF A;  5DB9 A;  3H39 A;  4RQ6 A;  9ICQ A;  8ICK A;  4TUQ A;  3OVB A;  4X4S A;  2M2T A;  1XSN A;  3AQN A;  4MFC A;  4DOC A;  5HR9 A;  4QZB A;  2PFN A;  8ICQ A;  4Z6C A;  3JYY A;  2ID1 A;  4WC3 A;  3RH5 A;  4EP7 A;  4X4R A;  9ICE A;  3V72 A;  3JPT A;  4UB1 A;  3C5G A;  4UBC A;  2ZHB A;  8ICI A;  5DB8 A;  4I28 A;  4FO6 A;  1FA0 A;  5TZV A;  4KLI A;  5CP2 A;  1ZQI A;  5CR0 A;  7ICL A;  3HX0 A;  4M5D A;  9ICG A;  1TV9 A;  4RQ0 A;  4I2H A;  4LZD A;  1VJ7 A;  1ZQY A;  2PFP A;  3RJF A;  3LQC B;  3C66 A;  4IQU A;  3RJK A;  4UB2 A;  5DDY A;  4M9G A;  1YLQ A;  5BOM A;  2BCS A;  1ZQO A;  1JAJ A;  4K4H A;  2ZH4 A;  1OU5 A;  3AU6 A;  4XUS A;  3WFP A;  5J2G A;  5HRB A;  2DVI A;  7ICI A;  4QZI A;  4F5O A;  5J0X A;  4UB4 A;  4I2F A;  1UET A;  3MGH A;  3H38 A;  3ISB A;  8ICS A;  4O5K A;  3PML A;  4M9J A;  4QZC A;  3H37 A;  1JMS A;  4KLJ A;  4FH5 A;  3AU2 A;  2NRK A;  4AT8 B;  4IQT A;  3H3A A;  4MF8 A;  2O1P A;  4O5E A;  4LT6 A;  4RWO A;  2BCU A;  8ICF A;  3WFQ E;  2ZH1 A;  5DEC A;  5DKW A;  3UQ0 A;  4M9H A;  1PX5 A;  4R66 A;  3RJG A;  3L9D A;  3JPP A;  5J29 A;  3RH4 A;  1ZQH A;  4IG8 A;  2ZH8 A;  4PHE A;  2DRB A;  5J0S A;  2ZHA A;  4GXI A;  4MFA A;  9ICP A;  4PH5 A;  9ICT A;  1BPE A;  7ICR A;  4RQ2 A;  4GXK A;  4X5V A;  4FHP A;  3ISC A;  3HJ1 A;  4I27 A;  9ICI A;  9ICM A;  1RZT A;  3UPQ A;  4F5Q A;  4P4O A;  2ISP A;  5D4B A;  4I2B A;  4TUR A;  3UPS A;  1Q79 A;  1ZJN A;  1XSP A;  5D46 A;  4Z6E A;  1KEJ A;  5J2K A;  1ZQM A;  1BPY A;  2PFO A;  4RPX A;  1F5A A;  4X4P A;  1ZQJ A;  5J2E A;  4PPX A;  4GXJ A;  2VAN A;  4M0A A;  3C2M A;  4QZG A;  1V4A A;  3HW8 A;  5IIJ A;  5IIO A;  7ICO A;  4QZF A;  3PMN A;  9ICR A;  4JWN A;  4PGY A;  8ICJ A;  8ICM A;  4NLK A;  5IIL A;  7ICM A;  4X4O A;  4AT9 A;  4RQ3 A;  4X4T A;  4P4M A;  4NLN A;  5DDM A;  3MBY A;  7ICJ A;  4QZD A;  1R8A A;  5IIM A;  4M04 A;  1MQ3 A;  4FHX A;  4AT7 B;  1R8B A;  2FMQ A;  1ZQA A;  4KLQ A;  4XA5 A;  1R8C A;  1UEV A;  5EOZ A;  8ICX A;  7ICV A;  4NXZ A;  5IIK A;  9ICH A;  8ICV A;  2ZH2 A;  7ICS A;  3RJI A;  4IQV A;  5CHG A;  4Z6F A;  4PGX A;  3AQK A;  1TFY A;  3UXO A;  4PGQ A;  1HUO A;  9ICB A;  1ZQD A;  2ZH5 A;  5J2J A;  9ICU A;  2DR7 A;  8ICW A;  4RQ1 A;  1UEU A;  1ZQL A;  9ICC A;  4YMN A;  1MIV A;  7ICH A;  4RT3 A;  5CWR A;  4WBY A;  4WC5 A;  1WOT A;  8ICR A;  4K4I A;  9ICV A;  3V7J A;  3RH6 A;  4DO9 A;  1ZQB A;  5III A;  4UAW A;  4JWM A;  4O9M A;  4KLU A;  4LZG A;  4M9L A;  1XSL A;  7ICF A;  4M47 A;  1ZQZ A;  7ICT A;  3MDA A;  1MQ2 A;  8ICB A;  4F5R A;  2P66 A;  2M2W A;  7ICK A;  5HRE A;  1ZQG A;  2GWS A;  2BPF A;  5HRG A;  4X0B A;  4WC7 A;  8ICG A;  9ICW A;  3RJJ A;  5D49 A;  1R89 A;  4UD4 A;  3B0Y A;  4E8F A;  4NM1 A;  2DR9 A;  1HUZ A;  5DED A;  5J0T A;  2FMP A;  7ICN A;  4WC6 A;  2M2U A;  9ICX A;  5J0W A;  1MIW A;  3OVS A;  1ZQU A;  4UAZ A;  5J2H A;  2ZH7 A;  4QZA A;  3GDX A;  4MFF A;  3JPR A;  7ICP A;  1RPL A;  1ZQV A;  9ICA A;  4O5C A;  2BCQ A;  4R65 A;  3MDC A;  2W9M A;  1KDH A;  2BPG A;  4RPZ A;  3LK9 A;  4EBJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...