1ABTA

Nmr solution structure of an alpha-bungarotoxin(slash)nicotinic receptor peptide complex
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
74
structure length
74
Chain Sequence
IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-BUNGAROTOXIN
publication title NMR solution structure of an alpha-bungarotoxin/nicotinic receptor peptide complex.
pubmed doi rcsb
molecule tags Toxin
total genus 9
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 1993-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1abtA00
2K3GA 1MAHF 1F94A 1KTZB 1IDHA 1HOYA 1LX5B 1IQ9A 1FSCA 2LCRA 3FEVA 1XT3A 3EBXA 5DU1A 2H62D 4XJJA 1RL5A 1KBAA 1HAAA 3HH7A 1ABTA 2QJ9C 1CHVS 1KXIA 1IJCA 1KL8A 4OM5A 1F8UB 1NTXA 2QC1A 1NXBA 1CDSA 2ABXA 1L4WA 3U74U 1LXGA 1IK8A 1KU6B 1S4YA 1ERAA 4ZQYA 1CVOA 2NBTA 1V6PA 4FAOE 2PJYB 1NORA 4BDTB 2H62C 1NTNA 2HLQA 1QKDA 1ZADA 1QKEA 2JQPA 2CDXA 1REWC 3LAQU 1ERGA 2VLWA 2MUOA 4RUDA 1RGJA 4QTIU 2BTXA 2H64C 5DO6A 1YWHA 2GOOB 2MFAA 5IMTD 1CDRA 1CDTA 1KC4A 2ERAA 1QM7A 4IYEA 1VB0A 1NYSA 2CCXA 1CODA 5EBXA 1JBDA 1H0JA 1NEAA 3BT1U 1CDQA 1CTXA 2FD6U 1IDGA 5DZ5A 1FRAA 4EY8B 1I02A 1JE9A 6EBXA 2LA1A 3VTSA 1COEA 3KFDE 1IDLA 1LSIA 1IDIA 2L03A 2MJ0A 4P7UA 1CXOA 1TXBA 3ERAA 3NEQA 1KBTA 2UX2A 3KFDI 2MJ4A 1IKCA 3EVSC 1KBSA 2L5SA 2HLRA 2H7ZB 2QJAC 1LJZA 1FF4A 2X8BB 1M9ZA 1ONJA 1W6BA 1UG4A 2OFSA 1CCQA 1HAJA 4UY2C 4HQPF 2UWRA 1HC9B 2MHYA 3BT2U 4AEAA 1BTEA 2BHIA 2PJYC 1TFSA 1KS6A 3NH7A 1FFJA 1BXPA 2CRTA 2I9BE 1FSSB 1TXAA 4FAOC 2H7ZA 1CRFA 5IMYC 1JGKA 1KFHA 2J8BA 1FASA 4DO8A 1ES7B 2H8UA 2JVEA 2N99A 2QJBC 1HC9A 4OM4A 1CREA 2CTXA 1PLOA 4LFTA 2GOOC 2H5FA 1DRSA 3PLCA 1MR6A 3NDSA 3QB4B 1TGXA 3U73U 1LXHA 4BIKB 2H64B 2MJYA 2MUPA 1G6MA 2CRSA 1CXNA 1B41B 1CB9A 1NYUA
chains in the Genus database with same CATH superfamily
2K3GA 1MAHF 1F94A 1KTZB 1IDHA 1HOYA 1LX5B 1IQ9A 1FSCA 2LCRA 3FEVA 1XT3A 3EBXA 5DU1A 2H62D 4XJJA 1RL5A 1KBAA 1HAAA 3HH7A 1ABTA 2QJ9C 1CHVS 1KXIA 1IJCA 1KL8A 4OM5A 1F8UB 1NTXA 2QC1A 1NXBA 1CDSA 2ABXA 1L4WA 3U74U 1LXGA 1IK8A 1KU6B 1S4YA 1ERAA 4ZQYA 1CVOA 2NBTA 1V6PA 4FAOE 2PJYB 1NORA 4BDTB 2H62C 1NTNA 2HLQA 1QKDA 1ZADA 1QKEA 2JQPA 2CDXA 1REWC 3LAQU 1ERGA 2VLWA 2MUOA 4RUDA 1RGJA 4QTIU 2BTXA 2H64C 5DO6A 1YWHA 2GOOB 2MFAA 5IMTD 1CDRA 1CDTA 1KC4A 2ERAA 1QM7A 4IYEA 1VB0A 1NYSA 2CCXA 1CODA 5EBXA 1JBDA 1H0JA 1NEAA 3BT1U 1CDQA 1CTXA 2FD6U 1IDGA 5DZ5A 1FRAA 4EY8B 1I02A 1JE9A 6EBXA 2LA1A 3VTSA 1COEA 3KFDE 1IDLA 1LSIA 1IDIA 2L03A 2MJ0A 4P7UA 1CXOA 1TXBA 3ERAA 3NEQA 1KBTA 2UX2A 3KFDI 2MJ4A 1IKCA 3EVSC 1KBSA 2L5SA 2HLRA 2H7ZB 2QJAC 1LJZA 1FF4A 2X8BB 1M9ZA 1ONJA 1W6BA 1UG4A 2OFSA 1CCQA 1HAJA 4UY2C 4HQPF 2UWRA 1HC9B 2MHYA 3BT2U 4AEAA 1BTEA 2BHIA 2PJYC 1TFSA 1KS6A 3NH7A 1FFJA 1BXPA 2CRTA 2I9BE 1FSSB 1TXAA 4FAOC 2H7ZA 1CRFA 5IMYC 1JGKA 1KFHA 2J8BA 1FASA 4DO8A 1ES7B 2H8UA 2JVEA 2N99A 2QJBC 1HC9A 4OM4A 1CREA 2CTXA 1PLOA 4KSNA 4LFTA 2GOOC 2H5FA 1DRSA 3PLCA 1MR6A 3NDSA 3QB4B 1TGXA 3U73U 1LXHA 4BIKB 2H64B 2MJYA 2MUPA 1G6MA 2CRSA 1CXNA 1B41B 1CB9A 1NYUA
chains in the Genus database with same CATH topology
2K3GA 1MAHF 1F94A 1KTZB 1IDHA 1HOYA 1LX5B 1IQ9A 1FSCA 2LCRA 3FEVA 1XT3A 3EBXA 5DU1A 2H62D 4XJJA 1RL5A 1KBAA 1HAAA 3HH7A 1ABTA 2QJ9C 1CHVS 1KXIA 1IJCA 1KL8A 4OM5A 1F8UB 1NTXA 2QC1A 1NXBA 1CDSA 2ABXA 1L4WA 3U74U 1LXGA 1IK8A 1KU6B 1S4YA 1ERAA 4ZQYA 1CVOA 2NBTA 1V6PA 4FAOE 2PJYB 1NORA 4BDTB 2H62C 1NTNA 2HLQA 1QKDA 1ZADA 1QKEA 2JQPA 2CDXA 1REWC 3LAQU 1ERGA 2VLWA 2MUOA 4RUDA 1RGJA 4QTIU 2BTXA 2H64C 5DO6A 1YWHA 2GOOB 2MFAA 5IMTD 1CDRA 1CDTA 1KC4A 2ERAA 1QM7A 4IYEA 1VB0A 1NYSA 2CCXA 1CODA 5EBXA 1JBDA 1H0JA 1NEAA 3BT1U 1CDQA 1CTXA 2FD6U 1IDGA 5DZ5A 1FRAA 4EY8B 1I02A 1JE9A 6EBXA 2LA1A 3VTSA 1COEA 3KFDE 1IDLA 1LSIA 1IDIA 2L03A 2MJ0A 4P7UA 1CXOA 1TXBA 3ERAA 3NEQA 1KBTA 2UX2A 3KFDI 2MJ4A 1IKCA 3EVSC 1KBSA 2L5SA 2HLRA 2H7ZB 2QJAC 1LJZA 1FF4A 2X8BB 1M9ZA 1ONJA 1W6BA 1UG4A 2OFSA 1CCQA 1HAJA 4UY2C 4HQPF 2UWRA 1HC9B 2MHYA 3BT2U 4AEAA 1BTEA 2BHIA 2PJYC 1TFSA 1KS6A 3NH7A 1FFJA 1BXPA 2CRTA 2I9BE 1FSSB 1TXAA 4FAOC 2H7ZA 1CRFA 5IMYC 1JGKA 1KFHA 2J8BA 1FASA 4DO8A 1ES7B 2H8UA 2JVEA 2N99A 2QJBC 1HC9A 4OM4A 1CREA 2CTXA 1PLOA 4KSNA 4LFTA 2GOOC 2H5FA 1DRSA 3PLCA 1MR6A 3NDSA 3QB4B 1TGXA 3U73U 1LXHA 4BIKB 2H64B 2MJYA 2MUPA 1G6MA 2CRSA 1CXNA 1B41B 1CB9A 1NYUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K3G A;  1MAH F;  1F94 A;  1KTZ B;  1IDH A;  1HOY A;  1LX5 B;  1IQ9 A;  1FSC A;  2LCR A;  3FEV A;  1XT3 A;  3EBX A;  5DU1 A;  2H62 D;  4XJJ A;  1RL5 A;  1KBA A;  1HAA A;  3HH7 A;  1ABT A;  2QJ9 C;  1CHV S;  1KXI A;  1IJC A;  1KL8 A;  4OM5 A;  1F8U B;  1NTX A;  2QC1 A;  1NXB A;  1CDS A;  2ABX A;  1L4W A;  3U74 U;  1LXG A;  1IK8 A;  1KU6 B;  1S4Y A;  1ERA A;  4ZQY A;  1CVO A;  2NBT A;  1V6P A;  4FAO E;  2PJY B;  1NOR A;  4BDT B;  2H62 C;  1NTN A;  2HLQ A;  1QKD A;  1ZAD A;  1QKE A;  2JQP A;  2CDX A;  1REW C;  3LAQ U;  1ERG A;  2VLW A;  2MUO A;  4RUD A;  1RGJ A;  4QTI U;  2BTX A;  2H64 C;  5DO6 A;  1YWH A;  2GOO B;  2MFA A;  5IMT D;  1CDR A;  1CDT A;  1KC4 A;  2ERA A;  1QM7 A;  4IYE A;  1VB0 A;  1NYS A;  2CCX A;  1COD A;  5EBX A;  1JBD A;  1H0J A;  1NEA A;  3BT1 U;  1CDQ A;  1CTX A;  2FD6 U;  1IDG A;  5DZ5 A;  1FRA A;  4EY8 B;  1I02 A;  1JE9 A;  6EBX A;  2LA1 A;  3VTS A;  1COE A;  3KFD E;  1IDL A;  1LSI A;  1IDI A;  2L03 A;  2MJ0 A;  4P7U A;  1CXO A;  1TXB A;  3ERA A;  3NEQ A;  1KBT A;  2UX2 A;  3KFD I;  2MJ4 A;  1IKC A;  3EVS C;  1KBS A;  2L5S A;  2HLR A;  2H7Z B;  2QJA C;  1LJZ A;  1FF4 A;  2X8B B;  1M9Z A;  1ONJ A;  1W6B A;  1UG4 A;  2OFS A;  1CCQ A;  1HAJ A;  4UY2 C;  4HQP F;  2UWR A;  1HC9 B;  2MHY A;  3BT2 U;  4AEA A;  1BTE A;  2BHI A;  2PJY C;  1TFS A;  1KS6 A;  3NH7 A;  1FFJ A;  1BXP A;  2CRT A;  2I9B E;  1FSS B;  1TXA A;  4FAO C;  2H7Z A;  1CRF A;  5IMY C;  1JGK A;  1KFH A;  2J8B A;  1FAS A;  4DO8 A;  1ES7 B;  2H8U A;  2JVE A;  2N99 A;  2QJB C;  1HC9 A;  4OM4 A;  1CRE A;  2CTX A;  1PLO A;  4LFT A;  2GOO C;  2H5F A;  1DRS A;  3PLC A;  1MR6 A;  3NDS A;  3QB4 B;  1TGX A;  3U73 U;  1LXH A;  4BIK B;  2H64 B;  2MJY A;  2MUP A;  1G6M A;  2CRS A;  1CXN A;  1B41 B;  1CB9 A;  1NYU A; 
#chains in the Genus database with same CATH topology
 2K3G A;  1MAH F;  1F94 A;  1KTZ B;  1IDH A;  1HOY A;  1LX5 B;  1IQ9 A;  1FSC A;  2LCR A;  3FEV A;  1XT3 A;  3EBX A;  5DU1 A;  2H62 D;  4XJJ A;  1RL5 A;  1KBA A;  1HAA A;  3HH7 A;  1ABT A;  2QJ9 C;  1CHV S;  1KXI A;  1IJC A;  1KL8 A;  4OM5 A;  1F8U B;  1NTX A;  2QC1 A;  1NXB A;  1CDS A;  2ABX A;  1L4W A;  3U74 U;  1LXG A;  1IK8 A;  1KU6 B;  1S4Y A;  1ERA A;  4ZQY A;  1CVO A;  2NBT A;  1V6P A;  4FAO E;  2PJY B;  1NOR A;  4BDT B;  2H62 C;  1NTN A;  2HLQ A;  1QKD A;  1ZAD A;  1QKE A;  2JQP A;  2CDX A;  1REW C;  3LAQ U;  1ERG A;  2VLW A;  2MUO A;  4RUD A;  1RGJ A;  4QTI U;  2BTX A;  2H64 C;  5DO6 A;  1YWH A;  2GOO B;  2MFA A;  5IMT D;  1CDR A;  1CDT A;  1KC4 A;  2ERA A;  1QM7 A;  4IYE A;  1VB0 A;  1NYS A;  2CCX A;  1COD A;  5EBX A;  1JBD A;  1H0J A;  1NEA A;  3BT1 U;  1CDQ A;  1CTX A;  2FD6 U;  1IDG A;  5DZ5 A;  1FRA A;  4EY8 B;  1I02 A;  1JE9 A;  6EBX A;  2LA1 A;  3VTS A;  1COE A;  3KFD E;  1IDL A;  1LSI A;  1IDI A;  2L03 A;  2MJ0 A;  4P7U A;  1CXO A;  1TXB A;  3ERA A;  3NEQ A;  1KBT A;  2UX2 A;  3KFD I;  2MJ4 A;  1IKC A;  3EVS C;  1KBS A;  2L5S A;  2HLR A;  2H7Z B;  2QJA C;  1LJZ A;  1FF4 A;  2X8B B;  1M9Z A;  1ONJ A;  1W6B A;  1UG4 A;  2OFS A;  1CCQ A;  1HAJ A;  4UY2 C;  4HQP F;  2UWR A;  1HC9 B;  2MHY A;  3BT2 U;  4AEA A;  1BTE A;  2BHI A;  2PJY C;  1TFS A;  1KS6 A;  3NH7 A;  1FFJ A;  1BXP A;  2CRT A;  2I9B E;  1FSS B;  1TXA A;  4FAO C;  2H7Z A;  1CRF A;  5IMY C;  1JGK A;  1KFH A;  2J8B A;  1FAS A;  4DO8 A;  1ES7 B;  2H8U A;  2JVE A;  2N99 A;  2QJB C;  1HC9 A;  4OM4 A;  1CRE A;  2CTX A;  1PLO A;  4KSN A;  4LFT A;  2GOO C;  2H5F A;  1DRS A;  3PLC A;  1MR6 A;  3NDS A;  3QB4 B;  1TGX A;  3U73 U;  1LXH A;  4BIK B;  2H64 B;  2MJY A;  2MUP A;  1G6M A;  2CRS A;  1CXN A;  1B41 B;  1CB9 A;  1NYU A; 
#chains in the Genus database with same CATH homology
 2K3G A;  1MAH F;  1F94 A;  1KTZ B;  1IDH A;  1HOY A;  1LX5 B;  1IQ9 A;  1FSC A;  2LCR A;  3FEV A;  1XT3 A;  3EBX A;  5DU1 A;  2H62 D;  4XJJ A;  1RL5 A;  1KBA A;  1HAA A;  3HH7 A;  1ABT A;  2QJ9 C;  1CHV S;  1KXI A;  1IJC A;  1KL8 A;  4OM5 A;  1F8U B;  1NTX A;  2QC1 A;  1NXB A;  1CDS A;  2ABX A;  1L4W A;  3U74 U;  1LXG A;  1IK8 A;  1KU6 B;  1S4Y A;  1ERA A;  4ZQY A;  1CVO A;  2NBT A;  1V6P A;  4FAO E;  2PJY B;  1NOR A;  4BDT B;  2H62 C;  1NTN A;  2HLQ A;  1QKD A;  1ZAD A;  1QKE A;  2JQP A;  2CDX A;  1REW C;  3LAQ U;  1ERG A;  2VLW A;  2MUO A;  4RUD A;  1RGJ A;  4QTI U;  2BTX A;  2H64 C;  5DO6 A;  1YWH A;  2GOO B;  2MFA A;  5IMT D;  1CDR A;  1CDT A;  1KC4 A;  2ERA A;  1QM7 A;  4IYE A;  1VB0 A;  1NYS A;  2CCX A;  1COD A;  5EBX A;  1JBD A;  1H0J A;  1NEA A;  3BT1 U;  1CDQ A;  1CTX A;  2FD6 U;  1IDG A;  5DZ5 A;  1FRA A;  4EY8 B;  1I02 A;  1JE9 A;  6EBX A;  2LA1 A;  3VTS A;  1COE A;  3KFD E;  1IDL A;  1LSI A;  1IDI A;  2L03 A;  2MJ0 A;  4P7U A;  1CXO A;  1TXB A;  3ERA A;  3NEQ A;  1KBT A;  2UX2 A;  3KFD I;  2MJ4 A;  1IKC A;  3EVS C;  1KBS A;  2L5S A;  2HLR A;  2H7Z B;  2QJA C;  1LJZ A;  1FF4 A;  2X8B B;  1M9Z A;  1ONJ A;  1W6B A;  1UG4 A;  2OFS A;  1CCQ A;  1HAJ A;  4UY2 C;  4HQP F;  2UWR A;  1HC9 B;  2MHY A;  3BT2 U;  4AEA A;  1BTE A;  2BHI A;  2PJY C;  1TFS A;  1KS6 A;  3NH7 A;  1FFJ A;  1BXP A;  2CRT A;  2I9B E;  1FSS B;  1TXA A;  4FAO C;  2H7Z A;  1CRF A;  5IMY C;  1JGK A;  1KFH A;  2J8B A;  1FAS A;  4DO8 A;  1ES7 B;  2H8U A;  2JVE A;  2N99 A;  2QJB C;  1HC9 A;  4OM4 A;  1CRE A;  2CTX A;  1PLO A;  4KSN A;  4LFT A;  2GOO C;  2H5F A;  1DRS A;  3PLC A;  1MR6 A;  3NDS A;  3QB4 B;  1TGX A;  3U73 U;  1LXH A;  4BIK B;  2H64 B;  2MJY A;  2MUP A;  1G6M A;  2CRS A;  1CXN A;  1B41 B;  1CB9 A;  1NYU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...