1ABTA

Nmr solution structure of an alpha-bungarotoxin(slash)nicotinic receptor peptide complex
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
74
structure length
74
Chain Sequence
IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords ALPHA-BUNGAROTOXIN
publication title NMR solution structure of an alpha-bungarotoxin/nicotinic receptor peptide complex.
pubmed doi rcsb
total genus 9
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 1993-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1abtA00
2UWRA 2H7ZB 4DO8A 4ZQYA 2MUOA 4UY2C 1IDHA 2FD6U 1NYSA 2MFAA 2MJ4A 1I02A 2PJYC 4AEAA 1NEAA 2CRSA 1REWC 1CREA 2H64B 2LCRA 1M9ZA 4FAOE 2NBTA 2LA1A 2OFSA 4OM4A 1BXPA 1FFJA 1G6MA 1NTXA 2QJBC 2CDXA 3U74U 1LXGA 2X8BB 1CXOA 1CVOA 1KBSA 3VTSA 1KL8A 1FRAA 1CRFA 2MJYA 1LJZA 3KFDE 3ERAA 2ABXA 1CXNA 1KC4A 1CB9A 1IDGA 2HLRA 4HQPF 2JQPA 2MUPA 1JGKA 1NXBA 2GOOB 4BIKB 1CDSA 1MAHF 4EY8B 3KFDI 3NH7A 1KXIA 1HC9B 1LSIA 2QJAC 3EVSC 1HOYA 1XT3A 2H62C 1QKDA 2L03A 4LFTA 1RGJA 2H62D 1JBDA 2CTXA 5DZ5A 1CHVS 1KU6B 2L5SA 2I9BE 5DU1A 2H64C 1H0JA 4FAOC 2ERAA 1IKCA 3EBXA 1FSCA 3FEVA 6EBXA 1UG4A 2CCXA 1ERGA 2H5FA 2H7ZA 2HLQA 3NDSA 1BTEA 1F8UB 1FF4A 2K3GA 1COEA 5DO6A 1CDRA 3U73U 1HAJA 3BT1U 3PLCA 3BT2U 3QB4B 1NTNA 2BHIA 1MR6A 1CODA 1V6PA 1NORA 1QM7A 1LX5B 3NEQA 4QTIU 1DRSA 1YWHA 1TXBA 2JVEA 4BDTB 1JE9A 1ES7B 2UX2A 1ERAA 1L4WA 1TGXA 1W6BA 1IDLA 1NYUA 1TXAA 1PLOA 2N99A 1CDQA 1KTZB 1FSSB 5EBXA 4XJJA 2GOOC 2H8UA 3HH7A 1F94A 2J8BA 1VB0A 4P7UA 2QJ9C 1CDTA 1HAAA 1S4YA 1KBAA 1ONJA 2MHYA 1IK8A 1TFSA 2MJ0A 4IYEA 1RL5A 4RUDA 1FASA 5IMTD 1LXHA 1KBTA 1ZADA 2CRTA 2QC1A 1IQ9A 1IJCA 1KFHA 1ABTA 2PJYB 1QKEA 4OM5A 1HC9A 1CTXA 2VLWA 5IMYC 2BTXA 3LAQU 1IDIA 1B41B 1CCQA 1KS6A
chains in the Genus database with same CATH superfamily
2UWRA 2H7ZB 4DO8A 4ZQYA 2MUOA 4UY2C 1IDHA 2FD6U 1NYSA 2MFAA 2MJ4A 1I02A 2PJYC 4AEAA 1NEAA 2CRSA 1REWC 1CREA 2H64B 2LCRA 1M9ZA 4FAOE 2NBTA 2LA1A 2OFSA 4OM4A 1BXPA 1FFJA 1G6MA 1NTXA 2QJBC 2CDXA 4KSNA 3U74U 1LXGA 2X8BB 1CXOA 1CVOA 1KBSA 3VTSA 1KL8A 1FRAA 1CRFA 2MJYA 1LJZA 3KFDE 3ERAA 2ABXA 1CXNA 1KC4A 1CB9A 1IDGA 2HLRA 4HQPF 2JQPA 2MUPA 1JGKA 1NXBA 2GOOB 4BIKB 1CDSA 1MAHF 4EY8B 3KFDI 3NH7A 1KXIA 1HC9B 1LSIA 2QJAC 3EVSC 1HOYA 1XT3A 2H62C 1QKDA 2L03A 4LFTA 1RGJA 2H62D 1JBDA 2CTXA 5DZ5A 1CHVS 1KU6B 2L5SA 2I9BE 5DU1A 2H64C 1H0JA 4FAOC 2ERAA 1IKCA 3EBXA 1FSCA 3FEVA 6EBXA 1UG4A 2CCXA 1ERGA 2H5FA 2H7ZA 2HLQA 3NDSA 1BTEA 1F8UB 1FF4A 2K3GA 1COEA 5DO6A 1CDRA 3U73U 1HAJA 3BT1U 3PLCA 3BT2U 3QB4B 1NTNA 2BHIA 1MR6A 1CODA 1V6PA 1NORA 1QM7A 1LX5B 3NEQA 4QTIU 1DRSA 1YWHA 1TXBA 2JVEA 4BDTB 1JE9A 1ES7B 2UX2A 1ERAA 1L4WA 1TGXA 1W6BA 1IDLA 1NYUA 1TXAA 1PLOA 2N99A 1CDQA 1KTZB 1FSSB 5EBXA 4XJJA 2GOOC 2H8UA 3HH7A 1F94A 2J8BA 1VB0A 4P7UA 2QJ9C 1CDTA 1HAAA 1S4YA 1KBAA 1ONJA 2MHYA 1IK8A 1TFSA 2MJ0A 4IYEA 1RL5A 4RUDA 1FASA 5IMTD 1LXHA 1KBTA 1ZADA 2CRTA 2QC1A 1IQ9A 1IJCA 1KFHA 1ABTA 2PJYB 1QKEA 4OM5A 1HC9A 1CTXA 2VLWA 5IMYC 2BTXA 3LAQU 1IDIA 1B41B 1CCQA 1KS6A
chains in the Genus database with same CATH topology
2UWRA 2H7ZB 4DO8A 4ZQYA 2MUOA 4UY2C 1IDHA 2FD6U 1NYSA 2MFAA 2MJ4A 1I02A 2PJYC 4AEAA 1NEAA 2CRSA 1REWC 1CREA 2H64B 2LCRA 1M9ZA 4FAOE 2NBTA 2LA1A 2OFSA 4OM4A 1BXPA 1FFJA 1G6MA 1NTXA 2QJBC 2CDXA 4KSNA 3U74U 1LXGA 2X8BB 1CXOA 1CVOA 1KBSA 3VTSA 1KL8A 1FRAA 1CRFA 2MJYA 1LJZA 3KFDE 3ERAA 2ABXA 1CXNA 1KC4A 1CB9A 1IDGA 2HLRA 4HQPF 2JQPA 2MUPA 1JGKA 1NXBA 2GOOB 4BIKB 1CDSA 1MAHF 4EY8B 3KFDI 3NH7A 1KXIA 1HC9B 1LSIA 2QJAC 3EVSC 1HOYA 1XT3A 2H62C 1QKDA 2L03A 4LFTA 1RGJA 2H62D 1JBDA 2CTXA 5DZ5A 1CHVS 1KU6B 2L5SA 2I9BE 5DU1A 2H64C 1H0JA 4FAOC 2ERAA 1IKCA 3EBXA 1FSCA 3FEVA 6EBXA 1UG4A 2CCXA 1ERGA 2H5FA 2H7ZA 2HLQA 3NDSA 1BTEA 1F8UB 1FF4A 2K3GA 1COEA 5DO6A 1CDRA 3U73U 1HAJA 3BT1U 3PLCA 3BT2U 3QB4B 1NTNA 2BHIA 1MR6A 1CODA 1V6PA 1NORA 1QM7A 1LX5B 3NEQA 4QTIU 1DRSA 1YWHA 1TXBA 2JVEA 4BDTB 1JE9A 1ES7B 2UX2A 1ERAA 1L4WA 1TGXA 1W6BA 1IDLA 1NYUA 1TXAA 1PLOA 2N99A 1CDQA 1KTZB 1FSSB 5EBXA 4XJJA 2GOOC 2H8UA 3HH7A 1F94A 2J8BA 1VB0A 4P7UA 2QJ9C 1CDTA 1HAAA 1S4YA 1KBAA 1ONJA 2MHYA 1IK8A 1TFSA 2MJ0A 4IYEA 1RL5A 4RUDA 1FASA 5IMTD 1LXHA 1KBTA 1ZADA 2CRTA 2QC1A 1IQ9A 1IJCA 1KFHA 1ABTA 2PJYB 1QKEA 4OM5A 1HC9A 1CTXA 2VLWA 5IMYC 2BTXA 3LAQU 1IDIA 1B41B 1CCQA 1KS6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UWR A;  2H7Z B;  4DO8 A;  4ZQY A;  2MUO A;  4UY2 C;  1IDH A;  2FD6 U;  1NYS A;  2MFA A;  2MJ4 A;  1I02 A;  2PJY C;  4AEA A;  1NEA A;  2CRS A;  1REW C;  1CRE A;  2H64 B;  2LCR A;  1M9Z A;  4FAO E;  2NBT A;  2LA1 A;  2OFS A;  4OM4 A;  1BXP A;  1FFJ A;  1G6M A;  1NTX A;  2QJB C;  2CDX A;  3U74 U;  1LXG A;  2X8B B;  1CXO A;  1CVO A;  1KBS A;  3VTS A;  1KL8 A;  1FRA A;  1CRF A;  2MJY A;  1LJZ A;  3KFD E;  3ERA A;  2ABX A;  1CXN A;  1KC4 A;  1CB9 A;  1IDG A;  2HLR A;  4HQP F;  2JQP A;  2MUP A;  1JGK A;  1NXB A;  2GOO B;  4BIK B;  1CDS A;  1MAH F;  4EY8 B;  3KFD I;  3NH7 A;  1KXI A;  1HC9 B;  1LSI A;  2QJA C;  3EVS C;  1HOY A;  1XT3 A;  2H62 C;  1QKD A;  2L03 A;  4LFT A;  1RGJ A;  2H62 D;  1JBD A;  2CTX A;  5DZ5 A;  1CHV S;  1KU6 B;  2L5S A;  2I9B E;  5DU1 A;  2H64 C;  1H0J A;  4FAO C;  2ERA A;  1IKC A;  3EBX A;  1FSC A;  3FEV A;  6EBX A;  1UG4 A;  2CCX A;  1ERG A;  2H5F A;  2H7Z A;  2HLQ A;  3NDS A;  1BTE A;  1F8U B;  1FF4 A;  2K3G A;  1COE A;  5DO6 A;  1CDR A;  3U73 U;  1HAJ A;  3BT1 U;  3PLC A;  3BT2 U;  3QB4 B;  1NTN A;  2BHI A;  1MR6 A;  1COD A;  1V6P A;  1NOR A;  1QM7 A;  1LX5 B;  3NEQ A;  4QTI U;  1DRS A;  1YWH A;  1TXB A;  2JVE A;  4BDT B;  1JE9 A;  1ES7 B;  2UX2 A;  1ERA A;  1L4W A;  1TGX A;  1W6B A;  1IDL A;  1NYU A;  1TXA A;  1PLO A;  2N99 A;  1CDQ A;  1KTZ B;  1FSS B;  5EBX A;  4XJJ A;  2GOO C;  2H8U A;  3HH7 A;  1F94 A;  2J8B A;  1VB0 A;  4P7U A;  2QJ9 C;  1CDT A;  1HAA A;  1S4Y A;  1KBA A;  1ONJ A;  2MHY A;  1IK8 A;  1TFS A;  2MJ0 A;  4IYE A;  1RL5 A;  4RUD A;  1FAS A;  5IMT D;  1LXH A;  1KBT A;  1ZAD A;  2CRT A;  2QC1 A;  1IQ9 A;  1IJC A;  1KFH A;  1ABT A;  2PJY B;  1QKE A;  4OM5 A;  1HC9 A;  1CTX A;  2VLW A;  5IMY C;  2BTX A;  3LAQ U;  1IDI A;  1B41 B;  1CCQ A;  1KS6 A; 
#chains in the Genus database with same CATH topology
 2UWR A;  2H7Z B;  4DO8 A;  4ZQY A;  2MUO A;  4UY2 C;  1IDH A;  2FD6 U;  1NYS A;  2MFA A;  2MJ4 A;  1I02 A;  2PJY C;  4AEA A;  1NEA A;  2CRS A;  1REW C;  1CRE A;  2H64 B;  2LCR A;  1M9Z A;  4FAO E;  2NBT A;  2LA1 A;  2OFS A;  4OM4 A;  1BXP A;  1FFJ A;  1G6M A;  1NTX A;  2QJB C;  2CDX A;  4KSN A;  3U74 U;  1LXG A;  2X8B B;  1CXO A;  1CVO A;  1KBS A;  3VTS A;  1KL8 A;  1FRA A;  1CRF A;  2MJY A;  1LJZ A;  3KFD E;  3ERA A;  2ABX A;  1CXN A;  1KC4 A;  1CB9 A;  1IDG A;  2HLR A;  4HQP F;  2JQP A;  2MUP A;  1JGK A;  1NXB A;  2GOO B;  4BIK B;  1CDS A;  1MAH F;  4EY8 B;  3KFD I;  3NH7 A;  1KXI A;  1HC9 B;  1LSI A;  2QJA C;  3EVS C;  1HOY A;  1XT3 A;  2H62 C;  1QKD A;  2L03 A;  4LFT A;  1RGJ A;  2H62 D;  1JBD A;  2CTX A;  5DZ5 A;  1CHV S;  1KU6 B;  2L5S A;  2I9B E;  5DU1 A;  2H64 C;  1H0J A;  4FAO C;  2ERA A;  1IKC A;  3EBX A;  1FSC A;  3FEV A;  6EBX A;  1UG4 A;  2CCX A;  1ERG A;  2H5F A;  2H7Z A;  2HLQ A;  3NDS A;  1BTE A;  1F8U B;  1FF4 A;  2K3G A;  1COE A;  5DO6 A;  1CDR A;  3U73 U;  1HAJ A;  3BT1 U;  3PLC A;  3BT2 U;  3QB4 B;  1NTN A;  2BHI A;  1MR6 A;  1COD A;  1V6P A;  1NOR A;  1QM7 A;  1LX5 B;  3NEQ A;  4QTI U;  1DRS A;  1YWH A;  1TXB A;  2JVE A;  4BDT B;  1JE9 A;  1ES7 B;  2UX2 A;  1ERA A;  1L4W A;  1TGX A;  1W6B A;  1IDL A;  1NYU A;  1TXA A;  1PLO A;  2N99 A;  1CDQ A;  1KTZ B;  1FSS B;  5EBX A;  4XJJ A;  2GOO C;  2H8U A;  3HH7 A;  1F94 A;  2J8B A;  1VB0 A;  4P7U A;  2QJ9 C;  1CDT A;  1HAA A;  1S4Y A;  1KBA A;  1ONJ A;  2MHY A;  1IK8 A;  1TFS A;  2MJ0 A;  4IYE A;  1RL5 A;  4RUD A;  1FAS A;  5IMT D;  1LXH A;  1KBT A;  1ZAD A;  2CRT A;  2QC1 A;  1IQ9 A;  1IJC A;  1KFH A;  1ABT A;  2PJY B;  1QKE A;  4OM5 A;  1HC9 A;  1CTX A;  2VLW A;  5IMY C;  2BTX A;  3LAQ U;  1IDI A;  1B41 B;  1CCQ A;  1KS6 A; 
#chains in the Genus database with same CATH homology
 2UWR A;  2H7Z B;  4DO8 A;  4ZQY A;  2MUO A;  4UY2 C;  1IDH A;  2FD6 U;  1NYS A;  2MFA A;  2MJ4 A;  1I02 A;  2PJY C;  4AEA A;  1NEA A;  2CRS A;  1REW C;  1CRE A;  2H64 B;  2LCR A;  1M9Z A;  4FAO E;  2NBT A;  2LA1 A;  2OFS A;  4OM4 A;  1BXP A;  1FFJ A;  1G6M A;  1NTX A;  2QJB C;  2CDX A;  4KSN A;  3U74 U;  1LXG A;  2X8B B;  1CXO A;  1CVO A;  1KBS A;  3VTS A;  1KL8 A;  1FRA A;  1CRF A;  2MJY A;  1LJZ A;  3KFD E;  3ERA A;  2ABX A;  1CXN A;  1KC4 A;  1CB9 A;  1IDG A;  2HLR A;  4HQP F;  2JQP A;  2MUP A;  1JGK A;  1NXB A;  2GOO B;  4BIK B;  1CDS A;  1MAH F;  4EY8 B;  3KFD I;  3NH7 A;  1KXI A;  1HC9 B;  1LSI A;  2QJA C;  3EVS C;  1HOY A;  1XT3 A;  2H62 C;  1QKD A;  2L03 A;  4LFT A;  1RGJ A;  2H62 D;  1JBD A;  2CTX A;  5DZ5 A;  1CHV S;  1KU6 B;  2L5S A;  2I9B E;  5DU1 A;  2H64 C;  1H0J A;  4FAO C;  2ERA A;  1IKC A;  3EBX A;  1FSC A;  3FEV A;  6EBX A;  1UG4 A;  2CCX A;  1ERG A;  2H5F A;  2H7Z A;  2HLQ A;  3NDS A;  1BTE A;  1F8U B;  1FF4 A;  2K3G A;  1COE A;  5DO6 A;  1CDR A;  3U73 U;  1HAJ A;  3BT1 U;  3PLC A;  3BT2 U;  3QB4 B;  1NTN A;  2BHI A;  1MR6 A;  1COD A;  1V6P A;  1NOR A;  1QM7 A;  1LX5 B;  3NEQ A;  4QTI U;  1DRS A;  1YWH A;  1TXB A;  2JVE A;  4BDT B;  1JE9 A;  1ES7 B;  2UX2 A;  1ERA A;  1L4W A;  1TGX A;  1W6B A;  1IDL A;  1NYU A;  1TXA A;  1PLO A;  2N99 A;  1CDQ A;  1KTZ B;  1FSS B;  5EBX A;  4XJJ A;  2GOO C;  2H8U A;  3HH7 A;  1F94 A;  2J8B A;  1VB0 A;  4P7U A;  2QJ9 C;  1CDT A;  1HAA A;  1S4Y A;  1KBA A;  1ONJ A;  2MHY A;  1IK8 A;  1TFS A;  2MJ0 A;  4IYE A;  1RL5 A;  4RUD A;  1FAS A;  5IMT D;  1LXH A;  1KBT A;  1ZAD A;  2CRT A;  2QC1 A;  1IQ9 A;  1IJC A;  1KFH A;  1ABT A;  2PJY B;  1QKE A;  4OM5 A;  1HC9 A;  1CTX A;  2VLW A;  5IMY C;  2BTX A;  3LAQ U;  1IDI A;  1B41 B;  1CCQ A;  1KS6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...