4OM5A

Crystal structure of ctx a4 from taiwan cobra (naja naja atra)
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
60
structure length
60
Chain Sequence
RKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords Cytotoxin 4
publication title Endocytotic Routes of Cobra Cardiotoxins Depend on Spatial Distribution of Positively Charged and Hydrophobic Domains to Target Distinct Types of Sulfated Glycoconjugates on Cell Surface.
pubmed doi rcsb
total genus 9
structure length 60
sequence length 60
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-01-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 4om5A00
3U73U 1L4WA 2CDXA 1HAAA 3EBXA 2LCRA 2J8BA 2QC1A 2QJ9C 2HLQA 1RL5A 3FEVA 3NH7A 1KXIA 2PJYB 1KFHA 3QB4B 4RUDA 1LX5B 2JQPA 1ONJA 1RGJA 1IDIA 1TGXA 1VB0A 3BT2U 1IDGA 1ES7B 1COEA 5EBXA 1NYSA 4P7UA 3U74U 3HH7A 2MFAA 1CDTA 1IK8A 1FFJA 1TFSA 3KFDE 1I02A 1F8UB 1KU6B 1JE9A 3PLCA 1FASA 3NEQA 4AEAA 4FAOE 4BIKB 3VTSA 1CB9A 2FD6U 1HC9B 1ABTA 2N99A 5IMTD 1B41B 4UY2C 4BDTB 4LFTA 6EBXA 1DRSA 1CXNA 1NEAA 1CODA 2MJ0A 2H62C 1FF4A 5IMYC 4OM4A 1CDSA 2I9BE 1YWHA 1IJCA 1H0JA 3LAQU 1CCQA 2UWRA 2PJYC 2QJAC 1KL8A 1JGKA 1UG4A 1W6BA 3NDSA 1PLOA 2UX2A 5DU1A 1IQ9A 2BTXA 1LJZA 2HLRA 3EVSC 2X8BB 2H64C 2LA1A 1CDRA 2CRTA 1CXOA 1MAHF 2H7ZB 2H62D 2GOOB 1MR6A 4OM5A 2MJYA 4FAOC 1LSIA 1ERAA 2CCXA 1KC4A 1IDHA 2MUOA 2OFSA 2CRSA 1FRAA 2H8UA 1KTZB 1CTXA 1CRFA 1HOYA 1QKEA 2MUPA 2VLWA 1CHVS 1NORA 1CVOA 1HC9A 1NXBA 5DO6A 1KBSA 2ERAA 1IKCA 1ZADA 2L03A 1KBTA 1FSCA 1M9ZA 4QTIU 1V6PA 4EY8B 1TXBA 2L5SA 4DO8A 1IDLA 2JVEA 1BTEA 1KBAA 1LXHA 2CTXA 1LXGA 1ERGA 3ERAA 1NYUA 1KS6A 2H5FA 5DZ5A 4ZQYA 4XJJA 1HAJA 2MJ4A 1NTXA 1G6MA 1BXPA 2GOOC 3KFDI 4IYEA 1CREA 2NBTA 1JBDA 2ABXA 1QM7A 2BHIA 1CDQA 2K3GA 1NTNA 2H64B 1F94A 1FSSB 1TXAA 3BT1U 1XT3A 2QJBC 2H7ZA 4HQPF 2MHYA 1QKDA 1REWC 1S4YA
chains in the Genus database with same CATH superfamily
3U73U 1L4WA 2CDXA 1HAAA 3EBXA 2LCRA 2J8BA 2QC1A 2QJ9C 2HLQA 1RL5A 3FEVA 3NH7A 1KXIA 2PJYB 1KFHA 3QB4B 4RUDA 1LX5B 2JQPA 1ONJA 1RGJA 1IDIA 1TGXA 1VB0A 3BT2U 1IDGA 1ES7B 1COEA 5EBXA 1NYSA 4P7UA 3U74U 3HH7A 2MFAA 1CDTA 1IK8A 1FFJA 1TFSA 3KFDE 1I02A 1F8UB 1KU6B 1JE9A 3PLCA 1FASA 3NEQA 4AEAA 4FAOE 4BIKB 3VTSA 1CB9A 2FD6U 1HC9B 1ABTA 2N99A 5IMTD 1B41B 4UY2C 4BDTB 4LFTA 6EBXA 1DRSA 1CXNA 1NEAA 1CODA 2MJ0A 2H62C 1FF4A 5IMYC 4OM4A 1CDSA 2I9BE 1YWHA 1IJCA 1H0JA 3LAQU 1CCQA 2UWRA 2PJYC 2QJAC 1KL8A 1JGKA 1UG4A 1W6BA 3NDSA 1PLOA 2UX2A 5DU1A 1IQ9A 2BTXA 1LJZA 2HLRA 3EVSC 2X8BB 2H64C 2LA1A 1CDRA 2CRTA 1CXOA 1MAHF 2H7ZB 2H62D 2GOOB 1MR6A 4OM5A 2MJYA 4FAOC 1LSIA 1ERAA 2CCXA 1KC4A 1IDHA 2MUOA 2OFSA 2CRSA 1FRAA 2H8UA 1KTZB 1CTXA 1CRFA 1HOYA 1QKEA 2MUPA 2VLWA 1CHVS 1NORA 1CVOA 1HC9A 1NXBA 5DO6A 1KBSA 2ERAA 1IKCA 1ZADA 2L03A 1KBTA 1FSCA 1M9ZA 4QTIU 1V6PA 4EY8B 1TXBA 2L5SA 4DO8A 1IDLA 2JVEA 1BTEA 1KBAA 1LXHA 2CTXA 1LXGA 1ERGA 3ERAA 1NYUA 1KS6A 2H5FA 5DZ5A 4ZQYA 4XJJA 1HAJA 2MJ4A 1NTXA 1G6MA 1BXPA 2GOOC 3KFDI 4IYEA 1CREA 2NBTA 1JBDA 2ABXA 1QM7A 2BHIA 1CDQA 2K3GA 1NTNA 2H64B 1F94A 1FSSB 1TXAA 3BT1U 1XT3A 4KSNA 2QJBC 2H7ZA 4HQPF 2MHYA 1QKDA 1REWC 1S4YA
chains in the Genus database with same CATH topology
3U73U 1L4WA 2CDXA 1HAAA 3EBXA 2LCRA 2J8BA 2QC1A 2QJ9C 2HLQA 1RL5A 3FEVA 3NH7A 1KXIA 2PJYB 1KFHA 3QB4B 4RUDA 1LX5B 2JQPA 1ONJA 1RGJA 1IDIA 1TGXA 1VB0A 3BT2U 1IDGA 1ES7B 1COEA 5EBXA 1NYSA 4P7UA 3U74U 3HH7A 2MFAA 1CDTA 1IK8A 1FFJA 1TFSA 3KFDE 1I02A 1F8UB 1KU6B 1JE9A 3PLCA 1FASA 3NEQA 4AEAA 4FAOE 4BIKB 3VTSA 1CB9A 2FD6U 1HC9B 1ABTA 2N99A 5IMTD 1B41B 4UY2C 4BDTB 4LFTA 6EBXA 1DRSA 1CXNA 1NEAA 1CODA 2MJ0A 2H62C 1FF4A 5IMYC 4OM4A 1CDSA 2I9BE 1YWHA 1IJCA 1H0JA 3LAQU 1CCQA 2UWRA 2PJYC 2QJAC 1KL8A 1JGKA 1UG4A 1W6BA 3NDSA 1PLOA 2UX2A 5DU1A 1IQ9A 2BTXA 1LJZA 2HLRA 3EVSC 2X8BB 2H64C 2LA1A 1CDRA 2CRTA 1CXOA 1MAHF 2H7ZB 2H62D 2GOOB 1MR6A 4OM5A 2MJYA 4FAOC 1LSIA 1ERAA 2CCXA 1KC4A 1IDHA 2MUOA 2OFSA 2CRSA 1FRAA 2H8UA 1KTZB 1CTXA 1CRFA 1HOYA 1QKEA 2MUPA 2VLWA 1CHVS 1NORA 1CVOA 1HC9A 1NXBA 5DO6A 1KBSA 2ERAA 1IKCA 1ZADA 2L03A 1KBTA 1FSCA 1M9ZA 4QTIU 1V6PA 4EY8B 1TXBA 2L5SA 4DO8A 1IDLA 2JVEA 1BTEA 1KBAA 1LXHA 2CTXA 1LXGA 1ERGA 3ERAA 1NYUA 1KS6A 2H5FA 5DZ5A 4ZQYA 4XJJA 1HAJA 2MJ4A 1NTXA 1G6MA 1BXPA 2GOOC 3KFDI 4IYEA 1CREA 2NBTA 1JBDA 2ABXA 1QM7A 2BHIA 1CDQA 2K3GA 1NTNA 2H64B 1F94A 1FSSB 1TXAA 3BT1U 1XT3A 4KSNA 2QJBC 2H7ZA 4HQPF 2MHYA 1QKDA 1REWC 1S4YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U73 U;  1L4W A;  2CDX A;  1HAA A;  3EBX A;  2LCR A;  2J8B A;  2QC1 A;  2QJ9 C;  2HLQ A;  1RL5 A;  3FEV A;  3NH7 A;  1KXI A;  2PJY B;  1KFH A;  3QB4 B;  4RUD A;  1LX5 B;  2JQP A;  1ONJ A;  1RGJ A;  1IDI A;  1TGX A;  1VB0 A;  3BT2 U;  1IDG A;  1ES7 B;  1COE A;  5EBX A;  1NYS A;  4P7U A;  3U74 U;  3HH7 A;  2MFA A;  1CDT A;  1IK8 A;  1FFJ A;  1TFS A;  3KFD E;  1I02 A;  1F8U B;  1KU6 B;  1JE9 A;  3PLC A;  1FAS A;  3NEQ A;  4AEA A;  4FAO E;  4BIK B;  3VTS A;  1CB9 A;  2FD6 U;  1HC9 B;  1ABT A;  2N99 A;  5IMT D;  1B41 B;  4UY2 C;  4BDT B;  4LFT A;  6EBX A;  1DRS A;  1CXN A;  1NEA A;  1COD A;  2MJ0 A;  2H62 C;  1FF4 A;  5IMY C;  4OM4 A;  1CDS A;  2I9B E;  1YWH A;  1IJC A;  1H0J A;  3LAQ U;  1CCQ A;  2UWR A;  2PJY C;  2QJA C;  1KL8 A;  1JGK A;  1UG4 A;  1W6B A;  3NDS A;  1PLO A;  2UX2 A;  5DU1 A;  1IQ9 A;  2BTX A;  1LJZ A;  2HLR A;  3EVS C;  2X8B B;  2H64 C;  2LA1 A;  1CDR A;  2CRT A;  1CXO A;  1MAH F;  2H7Z B;  2H62 D;  2GOO B;  1MR6 A;  4OM5 A;  2MJY A;  4FAO C;  1LSI A;  1ERA A;  2CCX A;  1KC4 A;  1IDH A;  2MUO A;  2OFS A;  2CRS A;  1FRA A;  2H8U A;  1KTZ B;  1CTX A;  1CRF A;  1HOY A;  1QKE A;  2MUP A;  2VLW A;  1CHV S;  1NOR A;  1CVO A;  1HC9 A;  1NXB A;  5DO6 A;  1KBS A;  2ERA A;  1IKC A;  1ZAD A;  2L03 A;  1KBT A;  1FSC A;  1M9Z A;  4QTI U;  1V6P A;  4EY8 B;  1TXB A;  2L5S A;  4DO8 A;  1IDL A;  2JVE A;  1BTE A;  1KBA A;  1LXH A;  2CTX A;  1LXG A;  1ERG A;  3ERA A;  1NYU A;  1KS6 A;  2H5F A;  5DZ5 A;  4ZQY A;  4XJJ A;  1HAJ A;  2MJ4 A;  1NTX A;  1G6M A;  1BXP A;  2GOO C;  3KFD I;  4IYE A;  1CRE A;  2NBT A;  1JBD A;  2ABX A;  1QM7 A;  2BHI A;  1CDQ A;  2K3G A;  1NTN A;  2H64 B;  1F94 A;  1FSS B;  1TXA A;  3BT1 U;  1XT3 A;  2QJB C;  2H7Z A;  4HQP F;  2MHY A;  1QKD A;  1REW C;  1S4Y A; 
#chains in the Genus database with same CATH topology
 3U73 U;  1L4W A;  2CDX A;  1HAA A;  3EBX A;  2LCR A;  2J8B A;  2QC1 A;  2QJ9 C;  2HLQ A;  1RL5 A;  3FEV A;  3NH7 A;  1KXI A;  2PJY B;  1KFH A;  3QB4 B;  4RUD A;  1LX5 B;  2JQP A;  1ONJ A;  1RGJ A;  1IDI A;  1TGX A;  1VB0 A;  3BT2 U;  1IDG A;  1ES7 B;  1COE A;  5EBX A;  1NYS A;  4P7U A;  3U74 U;  3HH7 A;  2MFA A;  1CDT A;  1IK8 A;  1FFJ A;  1TFS A;  3KFD E;  1I02 A;  1F8U B;  1KU6 B;  1JE9 A;  3PLC A;  1FAS A;  3NEQ A;  4AEA A;  4FAO E;  4BIK B;  3VTS A;  1CB9 A;  2FD6 U;  1HC9 B;  1ABT A;  2N99 A;  5IMT D;  1B41 B;  4UY2 C;  4BDT B;  4LFT A;  6EBX A;  1DRS A;  1CXN A;  1NEA A;  1COD A;  2MJ0 A;  2H62 C;  1FF4 A;  5IMY C;  4OM4 A;  1CDS A;  2I9B E;  1YWH A;  1IJC A;  1H0J A;  3LAQ U;  1CCQ A;  2UWR A;  2PJY C;  2QJA C;  1KL8 A;  1JGK A;  1UG4 A;  1W6B A;  3NDS A;  1PLO A;  2UX2 A;  5DU1 A;  1IQ9 A;  2BTX A;  1LJZ A;  2HLR A;  3EVS C;  2X8B B;  2H64 C;  2LA1 A;  1CDR A;  2CRT A;  1CXO A;  1MAH F;  2H7Z B;  2H62 D;  2GOO B;  1MR6 A;  4OM5 A;  2MJY A;  4FAO C;  1LSI A;  1ERA A;  2CCX A;  1KC4 A;  1IDH A;  2MUO A;  2OFS A;  2CRS A;  1FRA A;  2H8U A;  1KTZ B;  1CTX A;  1CRF A;  1HOY A;  1QKE A;  2MUP A;  2VLW A;  1CHV S;  1NOR A;  1CVO A;  1HC9 A;  1NXB A;  5DO6 A;  1KBS A;  2ERA A;  1IKC A;  1ZAD A;  2L03 A;  1KBT A;  1FSC A;  1M9Z A;  4QTI U;  1V6P A;  4EY8 B;  1TXB A;  2L5S A;  4DO8 A;  1IDL A;  2JVE A;  1BTE A;  1KBA A;  1LXH A;  2CTX A;  1LXG A;  1ERG A;  3ERA A;  1NYU A;  1KS6 A;  2H5F A;  5DZ5 A;  4ZQY A;  4XJJ A;  1HAJ A;  2MJ4 A;  1NTX A;  1G6M A;  1BXP A;  2GOO C;  3KFD I;  4IYE A;  1CRE A;  2NBT A;  1JBD A;  2ABX A;  1QM7 A;  2BHI A;  1CDQ A;  2K3G A;  1NTN A;  2H64 B;  1F94 A;  1FSS B;  1TXA A;  3BT1 U;  1XT3 A;  4KSN A;  2QJB C;  2H7Z A;  4HQP F;  2MHY A;  1QKD A;  1REW C;  1S4Y A; 
#chains in the Genus database with same CATH homology
 3U73 U;  1L4W A;  2CDX A;  1HAA A;  3EBX A;  2LCR A;  2J8B A;  2QC1 A;  2QJ9 C;  2HLQ A;  1RL5 A;  3FEV A;  3NH7 A;  1KXI A;  2PJY B;  1KFH A;  3QB4 B;  4RUD A;  1LX5 B;  2JQP A;  1ONJ A;  1RGJ A;  1IDI A;  1TGX A;  1VB0 A;  3BT2 U;  1IDG A;  1ES7 B;  1COE A;  5EBX A;  1NYS A;  4P7U A;  3U74 U;  3HH7 A;  2MFA A;  1CDT A;  1IK8 A;  1FFJ A;  1TFS A;  3KFD E;  1I02 A;  1F8U B;  1KU6 B;  1JE9 A;  3PLC A;  1FAS A;  3NEQ A;  4AEA A;  4FAO E;  4BIK B;  3VTS A;  1CB9 A;  2FD6 U;  1HC9 B;  1ABT A;  2N99 A;  5IMT D;  1B41 B;  4UY2 C;  4BDT B;  4LFT A;  6EBX A;  1DRS A;  1CXN A;  1NEA A;  1COD A;  2MJ0 A;  2H62 C;  1FF4 A;  5IMY C;  4OM4 A;  1CDS A;  2I9B E;  1YWH A;  1IJC A;  1H0J A;  3LAQ U;  1CCQ A;  2UWR A;  2PJY C;  2QJA C;  1KL8 A;  1JGK A;  1UG4 A;  1W6B A;  3NDS A;  1PLO A;  2UX2 A;  5DU1 A;  1IQ9 A;  2BTX A;  1LJZ A;  2HLR A;  3EVS C;  2X8B B;  2H64 C;  2LA1 A;  1CDR A;  2CRT A;  1CXO A;  1MAH F;  2H7Z B;  2H62 D;  2GOO B;  1MR6 A;  4OM5 A;  2MJY A;  4FAO C;  1LSI A;  1ERA A;  2CCX A;  1KC4 A;  1IDH A;  2MUO A;  2OFS A;  2CRS A;  1FRA A;  2H8U A;  1KTZ B;  1CTX A;  1CRF A;  1HOY A;  1QKE A;  2MUP A;  2VLW A;  1CHV S;  1NOR A;  1CVO A;  1HC9 A;  1NXB A;  5DO6 A;  1KBS A;  2ERA A;  1IKC A;  1ZAD A;  2L03 A;  1KBT A;  1FSC A;  1M9Z A;  4QTI U;  1V6P A;  4EY8 B;  1TXB A;  2L5S A;  4DO8 A;  1IDL A;  2JVE A;  1BTE A;  1KBA A;  1LXH A;  2CTX A;  1LXG A;  1ERG A;  3ERA A;  1NYU A;  1KS6 A;  2H5F A;  5DZ5 A;  4ZQY A;  4XJJ A;  1HAJ A;  2MJ4 A;  1NTX A;  1G6M A;  1BXP A;  2GOO C;  3KFD I;  4IYE A;  1CRE A;  2NBT A;  1JBD A;  2ABX A;  1QM7 A;  2BHI A;  1CDQ A;  2K3G A;  1NTN A;  2H64 B;  1F94 A;  1FSS B;  1TXA A;  3BT1 U;  1XT3 A;  4KSN A;  2QJB C;  2H7Z A;  4HQP F;  2MHY A;  1QKD A;  1REW C;  1S4Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...