4OM5A

Crystal structure of ctx a4 from taiwan cobra (naja naja atra)
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
60
structure length
60
Chain Sequence
RKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytotoxin 4
publication title Endocytotic Routes of Cobra Cardiotoxins Depend on Spatial Distribution of Positively Charged and Hydrophobic Domains to Target Distinct Types of Sulfated Glycoconjugates on Cell Surface.
pubmed doi rcsb
molecule tags Toxin
total genus 9
structure length 60
sequence length 60
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-01-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 4om5A00
3LAQU 2JVEA 1CDTA 1LXHA 4LFTA 1KXIA 5DU1A 3NEQA 5EBXA 1TXAA 1NYSA 2HLQA 1CVOA 5DZ5A 1IDGA 1HOYA 1REWC 1FSSB 2ERAA 1NXBA 4UY2C 1W6BA 2UWRA 4QTIU 2H62D 2BTXA 1CXNA 1M9ZA 1BXPA 2ABXA 1ONJA 1CHVS 1ERGA 1HAJA 4HQPF 4BIKB 1IJCA 1ABTA 2HLRA 1KTZB 1QM7A 1B41B 1F94A 2GOOC 1IDIA 2MUPA 2UX2A 2X8BB 1KL8A 1KU6B 4AEAA 2MJYA 3U74U 5IMYC 1CRFA 1F8UB 2MJ0A 2CDXA 2OFSA 1KFHA 1CODA 2PJYB 1CDQA 1V6PA 4BDTB 1CREA 3NH7A 2L03A 2VLWA 1FRAA 1QKEA 2K3GA 2H5FA 1KBAA 1NYUA 4IYEA 1JBDA 1XT3A 6EBXA 2I9BE 3KFDE 1LJZA 1UG4A 1COEA 1VB0A 1RL5A 1HC9B 1QKDA 2QJAC 1MR6A 4OM4A 5DO6A 3QB4B 3HH7A 4XJJA 4RUDA 4FAOE 2H7ZB 2CTXA 1HC9A 4DO8A 1JGKA 2H7ZA 1H0JA 1KC4A 1CTXA 1CDSA 1IQ9A 1LX5B 1KBTA 2H8UA 2J8BA 1CB9A 2PJYC 2NBTA 2LCRA 2MUOA 1YWHA 1IDLA 3PLCA 1LXGA 1IK8A 4ZQYA 2LA1A 1PLOA 1JE9A 2BHIA 1ZADA 1FSCA 1KBSA 2H62C 3ERAA 1I02A 3BT1U 1IKCA 2CRSA 2H64B 2QC1A 1NTXA 1BTEA 1TFSA 2QJ9C 2CRTA 1FASA 2H64C 2QJBC 2JQPA 1KS6A 3EBXA 3KFDI 1S4YA 2MHYA 1TGXA 5IMTD 1TXBA 2L5SA 1ERAA 3BT2U 3EVSC 2CCXA 4FAOC 1LSIA 2MJ4A 3NDSA 2FD6U 1G6MA 1DRSA 1RGJA 1NTNA 1IDHA 1NORA 1NEAA 4EY8B 4OM5A 1HAAA 1CCQA 2MFAA 1FFJA 3FEVA 2GOOB 1CDRA 4P7UA 1CXOA 1MAHF 3U73U 1ES7B 2N99A 1FF4A 3VTSA 1L4WA
chains in the Genus database with same CATH superfamily
3LAQU 2JVEA 1CDTA 1LXHA 4LFTA 1KXIA 5DU1A 3NEQA 5EBXA 1TXAA 1NYSA 2HLQA 1CVOA 5DZ5A 1IDGA 1HOYA 1REWC 1FSSB 2ERAA 1NXBA 4UY2C 1W6BA 2UWRA 4QTIU 2H62D 2BTXA 1CXNA 1M9ZA 1BXPA 2ABXA 1ONJA 1CHVS 1ERGA 1HAJA 4HQPF 4BIKB 1IJCA 1ABTA 2HLRA 1KTZB 1QM7A 1B41B 1F94A 2GOOC 1IDIA 2MUPA 2UX2A 2X8BB 1KL8A 1KU6B 4AEAA 2MJYA 3U74U 5IMYC 1CRFA 1F8UB 2MJ0A 2CDXA 2OFSA 1KFHA 1CODA 2PJYB 1CDQA 1V6PA 4BDTB 1CREA 3NH7A 2L03A 2VLWA 1FRAA 1QKEA 2K3GA 2H5FA 1KBAA 1NYUA 4IYEA 1JBDA 1XT3A 6EBXA 2I9BE 3KFDE 1LJZA 1UG4A 1COEA 1VB0A 1RL5A 1HC9B 1QKDA 2QJAC 1MR6A 4OM4A 5DO6A 3QB4B 3HH7A 4XJJA 4RUDA 4FAOE 2H7ZB 2CTXA 1HC9A 4DO8A 1JGKA 2H7ZA 1H0JA 1KC4A 1CTXA 1CDSA 1IQ9A 1LX5B 1KBTA 2H8UA 2J8BA 1CB9A 2PJYC 2NBTA 2LCRA 2MUOA 1YWHA 1IDLA 3PLCA 1LXGA 1IK8A 4ZQYA 2LA1A 1PLOA 1JE9A 2BHIA 1ZADA 1FSCA 1KBSA 2H62C 3ERAA 1I02A 3BT1U 1IKCA 2CRSA 2H64B 2QC1A 1NTXA 1BTEA 1TFSA 2QJ9C 2CRTA 1FASA 2H64C 2QJBC 2JQPA 1KS6A 3EBXA 3KFDI 1S4YA 2MHYA 1TGXA 5IMTD 1TXBA 2L5SA 1ERAA 3BT2U 3EVSC 2CCXA 4KSNA 1LSIA 4FAOC 2MJ4A 3NDSA 2FD6U 1G6MA 1DRSA 1RGJA 1NTNA 1IDHA 1NORA 1NEAA 4EY8B 4OM5A 1HAAA 1CCQA 2MFAA 1FFJA 3FEVA 2GOOB 1CDRA 4P7UA 1CXOA 1MAHF 3U73U 1ES7B 2N99A 1FF4A 3VTSA 1L4WA
chains in the Genus database with same CATH topology
3LAQU 2JVEA 1CDTA 1LXHA 4LFTA 1KXIA 5DU1A 3NEQA 5EBXA 1TXAA 1NYSA 2HLQA 1CVOA 5DZ5A 1IDGA 1HOYA 1REWC 1FSSB 2ERAA 1NXBA 4UY2C 1W6BA 2UWRA 4QTIU 2H62D 2BTXA 1CXNA 1M9ZA 1BXPA 2ABXA 1ONJA 1CHVS 1ERGA 1HAJA 4HQPF 4BIKB 1IJCA 1ABTA 2HLRA 1KTZB 1QM7A 1B41B 1F94A 2GOOC 1IDIA 2MUPA 2UX2A 2X8BB 1KL8A 1KU6B 4AEAA 2MJYA 3U74U 5IMYC 1CRFA 1F8UB 2MJ0A 2CDXA 2OFSA 1KFHA 1CODA 2PJYB 1CDQA 1V6PA 4BDTB 1CREA 3NH7A 2L03A 2VLWA 1FRAA 1QKEA 2K3GA 2H5FA 1KBAA 1NYUA 4IYEA 1JBDA 1XT3A 6EBXA 2I9BE 3KFDE 1LJZA 1UG4A 1COEA 1VB0A 1RL5A 1HC9B 1QKDA 2QJAC 1MR6A 4OM4A 5DO6A 3QB4B 3HH7A 4XJJA 4RUDA 4FAOE 2H7ZB 2CTXA 1HC9A 4DO8A 1JGKA 2H7ZA 1H0JA 1KC4A 1CTXA 1CDSA 1IQ9A 1LX5B 1KBTA 2H8UA 2J8BA 1CB9A 2PJYC 2NBTA 2LCRA 2MUOA 1YWHA 1IDLA 3PLCA 1LXGA 1IK8A 4ZQYA 2LA1A 1PLOA 1JE9A 2BHIA 1ZADA 1FSCA 1KBSA 2H62C 3ERAA 1I02A 3BT1U 1IKCA 2CRSA 2H64B 2QC1A 1NTXA 1BTEA 1TFSA 2QJ9C 2CRTA 1FASA 2H64C 2QJBC 2JQPA 1KS6A 3EBXA 3KFDI 1S4YA 2MHYA 1TGXA 5IMTD 1TXBA 2L5SA 1ERAA 3BT2U 3EVSC 2CCXA 4KSNA 1LSIA 4FAOC 2MJ4A 3NDSA 2FD6U 1G6MA 1DRSA 1RGJA 1NTNA 1IDHA 1NORA 1NEAA 4EY8B 4OM5A 1HAAA 1CCQA 2MFAA 1FFJA 3FEVA 2GOOB 1CDRA 4P7UA 1CXOA 1MAHF 3U73U 1ES7B 2N99A 1FF4A 3VTSA 1L4WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LAQ U;  2JVE A;  1CDT A;  1LXH A;  4LFT A;  1KXI A;  5DU1 A;  3NEQ A;  5EBX A;  1TXA A;  1NYS A;  2HLQ A;  1CVO A;  5DZ5 A;  1IDG A;  1HOY A;  1REW C;  1FSS B;  2ERA A;  1NXB A;  4UY2 C;  1W6B A;  2UWR A;  4QTI U;  2H62 D;  2BTX A;  1CXN A;  1M9Z A;  1BXP A;  2ABX A;  1ONJ A;  1CHV S;  1ERG A;  1HAJ A;  4HQP F;  4BIK B;  1IJC A;  1ABT A;  2HLR A;  1KTZ B;  1QM7 A;  1B41 B;  1F94 A;  2GOO C;  1IDI A;  2MUP A;  2UX2 A;  2X8B B;  1KL8 A;  1KU6 B;  4AEA A;  2MJY A;  3U74 U;  5IMY C;  1CRF A;  1F8U B;  2MJ0 A;  2CDX A;  2OFS A;  1KFH A;  1COD A;  2PJY B;  1CDQ A;  1V6P A;  4BDT B;  1CRE A;  3NH7 A;  2L03 A;  2VLW A;  1FRA A;  1QKE A;  2K3G A;  2H5F A;  1KBA A;  1NYU A;  4IYE A;  1JBD A;  1XT3 A;  6EBX A;  2I9B E;  3KFD E;  1LJZ A;  1UG4 A;  1COE A;  1VB0 A;  1RL5 A;  1HC9 B;  1QKD A;  2QJA C;  1MR6 A;  4OM4 A;  5DO6 A;  3QB4 B;  3HH7 A;  4XJJ A;  4RUD A;  4FAO E;  2H7Z B;  2CTX A;  1HC9 A;  4DO8 A;  1JGK A;  2H7Z A;  1H0J A;  1KC4 A;  1CTX A;  1CDS A;  1IQ9 A;  1LX5 B;  1KBT A;  2H8U A;  2J8B A;  1CB9 A;  2PJY C;  2NBT A;  2LCR A;  2MUO A;  1YWH A;  1IDL A;  3PLC A;  1LXG A;  1IK8 A;  4ZQY A;  2LA1 A;  1PLO A;  1JE9 A;  2BHI A;  1ZAD A;  1FSC A;  1KBS A;  2H62 C;  3ERA A;  1I02 A;  3BT1 U;  1IKC A;  2CRS A;  2H64 B;  2QC1 A;  1NTX A;  1BTE A;  1TFS A;  2QJ9 C;  2CRT A;  1FAS A;  2H64 C;  2QJB C;  2JQP A;  1KS6 A;  3EBX A;  3KFD I;  1S4Y A;  2MHY A;  1TGX A;  5IMT D;  1TXB A;  2L5S A;  1ERA A;  3BT2 U;  3EVS C;  2CCX A;  4FAO C;  1LSI A;  2MJ4 A;  3NDS A;  2FD6 U;  1G6M A;  1DRS A;  1RGJ A;  1NTN A;  1IDH A;  1NOR A;  1NEA A;  4EY8 B;  4OM5 A;  1HAA A;  1CCQ A;  2MFA A;  1FFJ A;  3FEV A;  2GOO B;  1CDR A;  4P7U A;  1CXO A;  1MAH F;  3U73 U;  1ES7 B;  2N99 A;  1FF4 A;  3VTS A;  1L4W A; 
#chains in the Genus database with same CATH topology
 3LAQ U;  2JVE A;  1CDT A;  1LXH A;  4LFT A;  1KXI A;  5DU1 A;  3NEQ A;  5EBX A;  1TXA A;  1NYS A;  2HLQ A;  1CVO A;  5DZ5 A;  1IDG A;  1HOY A;  1REW C;  1FSS B;  2ERA A;  1NXB A;  4UY2 C;  1W6B A;  2UWR A;  4QTI U;  2H62 D;  2BTX A;  1CXN A;  1M9Z A;  1BXP A;  2ABX A;  1ONJ A;  1CHV S;  1ERG A;  1HAJ A;  4HQP F;  4BIK B;  1IJC A;  1ABT A;  2HLR A;  1KTZ B;  1QM7 A;  1B41 B;  1F94 A;  2GOO C;  1IDI A;  2MUP A;  2UX2 A;  2X8B B;  1KL8 A;  1KU6 B;  4AEA A;  2MJY A;  3U74 U;  5IMY C;  1CRF A;  1F8U B;  2MJ0 A;  2CDX A;  2OFS A;  1KFH A;  1COD A;  2PJY B;  1CDQ A;  1V6P A;  4BDT B;  1CRE A;  3NH7 A;  2L03 A;  2VLW A;  1FRA A;  1QKE A;  2K3G A;  2H5F A;  1KBA A;  1NYU A;  4IYE A;  1JBD A;  1XT3 A;  6EBX A;  2I9B E;  3KFD E;  1LJZ A;  1UG4 A;  1COE A;  1VB0 A;  1RL5 A;  1HC9 B;  1QKD A;  2QJA C;  1MR6 A;  4OM4 A;  5DO6 A;  3QB4 B;  3HH7 A;  4XJJ A;  4RUD A;  4FAO E;  2H7Z B;  2CTX A;  1HC9 A;  4DO8 A;  1JGK A;  2H7Z A;  1H0J A;  1KC4 A;  1CTX A;  1CDS A;  1IQ9 A;  1LX5 B;  1KBT A;  2H8U A;  2J8B A;  1CB9 A;  2PJY C;  2NBT A;  2LCR A;  2MUO A;  1YWH A;  1IDL A;  3PLC A;  1LXG A;  1IK8 A;  4ZQY A;  2LA1 A;  1PLO A;  1JE9 A;  2BHI A;  1ZAD A;  1FSC A;  1KBS A;  2H62 C;  3ERA A;  1I02 A;  3BT1 U;  1IKC A;  2CRS A;  2H64 B;  2QC1 A;  1NTX A;  1BTE A;  1TFS A;  2QJ9 C;  2CRT A;  1FAS A;  2H64 C;  2QJB C;  2JQP A;  1KS6 A;  3EBX A;  3KFD I;  1S4Y A;  2MHY A;  1TGX A;  5IMT D;  1TXB A;  2L5S A;  1ERA A;  3BT2 U;  3EVS C;  2CCX A;  4KSN A;  1LSI A;  4FAO C;  2MJ4 A;  3NDS A;  2FD6 U;  1G6M A;  1DRS A;  1RGJ A;  1NTN A;  1IDH A;  1NOR A;  1NEA A;  4EY8 B;  4OM5 A;  1HAA A;  1CCQ A;  2MFA A;  1FFJ A;  3FEV A;  2GOO B;  1CDR A;  4P7U A;  1CXO A;  1MAH F;  3U73 U;  1ES7 B;  2N99 A;  1FF4 A;  3VTS A;  1L4W A; 
#chains in the Genus database with same CATH homology
 3LAQ U;  2JVE A;  1CDT A;  1LXH A;  4LFT A;  1KXI A;  5DU1 A;  3NEQ A;  5EBX A;  1TXA A;  1NYS A;  2HLQ A;  1CVO A;  5DZ5 A;  1IDG A;  1HOY A;  1REW C;  1FSS B;  2ERA A;  1NXB A;  4UY2 C;  1W6B A;  2UWR A;  4QTI U;  2H62 D;  2BTX A;  1CXN A;  1M9Z A;  1BXP A;  2ABX A;  1ONJ A;  1CHV S;  1ERG A;  1HAJ A;  4HQP F;  4BIK B;  1IJC A;  1ABT A;  2HLR A;  1KTZ B;  1QM7 A;  1B41 B;  1F94 A;  2GOO C;  1IDI A;  2MUP A;  2UX2 A;  2X8B B;  1KL8 A;  1KU6 B;  4AEA A;  2MJY A;  3U74 U;  5IMY C;  1CRF A;  1F8U B;  2MJ0 A;  2CDX A;  2OFS A;  1KFH A;  1COD A;  2PJY B;  1CDQ A;  1V6P A;  4BDT B;  1CRE A;  3NH7 A;  2L03 A;  2VLW A;  1FRA A;  1QKE A;  2K3G A;  2H5F A;  1KBA A;  1NYU A;  4IYE A;  1JBD A;  1XT3 A;  6EBX A;  2I9B E;  3KFD E;  1LJZ A;  1UG4 A;  1COE A;  1VB0 A;  1RL5 A;  1HC9 B;  1QKD A;  2QJA C;  1MR6 A;  4OM4 A;  5DO6 A;  3QB4 B;  3HH7 A;  4XJJ A;  4RUD A;  4FAO E;  2H7Z B;  2CTX A;  1HC9 A;  4DO8 A;  1JGK A;  2H7Z A;  1H0J A;  1KC4 A;  1CTX A;  1CDS A;  1IQ9 A;  1LX5 B;  1KBT A;  2H8U A;  2J8B A;  1CB9 A;  2PJY C;  2NBT A;  2LCR A;  2MUO A;  1YWH A;  1IDL A;  3PLC A;  1LXG A;  1IK8 A;  4ZQY A;  2LA1 A;  1PLO A;  1JE9 A;  2BHI A;  1ZAD A;  1FSC A;  1KBS A;  2H62 C;  3ERA A;  1I02 A;  3BT1 U;  1IKC A;  2CRS A;  2H64 B;  2QC1 A;  1NTX A;  1BTE A;  1TFS A;  2QJ9 C;  2CRT A;  1FAS A;  2H64 C;  2QJB C;  2JQP A;  1KS6 A;  3EBX A;  3KFD I;  1S4Y A;  2MHY A;  1TGX A;  5IMT D;  1TXB A;  2L5S A;  1ERA A;  3BT2 U;  3EVS C;  2CCX A;  4KSN A;  1LSI A;  4FAO C;  2MJ4 A;  3NDS A;  2FD6 U;  1G6M A;  1DRS A;  1RGJ A;  1NTN A;  1IDH A;  1NOR A;  1NEA A;  4EY8 B;  4OM5 A;  1HAA A;  1CCQ A;  2MFA A;  1FFJ A;  3FEV A;  2GOO B;  1CDR A;  4P7U A;  1CXO A;  1MAH F;  3U73 U;  1ES7 B;  2N99 A;  1FF4 A;  3VTS A;  1L4W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...