1MR6A

Solution structure of gamma-bungarotoxin:implication for the role of the residues adjacent to rgd in integrin binding
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
68
structure length
68
Chain Sequence
MQCKTCSFYTCPNSETCPDGKNICVKRSWTAVRGDGPKREIRRECAATCPPSKLGLTVFCCTTDNCNH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords neurotoxin
publication title Solution structure of gamma-bungarotoxin: The functional significance of amino acid residues flanking the RGD motif in integrin binding
pubmed doi rcsb
molecule tags Toxin
total genus 10
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2002-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1mr6A00
2HLQA 1CXNA 1CODA 1JE9A 4XJJA 1MR6A 2H7ZB 1KS6A 2NBTA 1CVOA 1M9ZA 1YWHA 2CRTA 2JVEA 1CDTA 2H8UA 2H7ZA 1H0JA 4RUDA 1FSCA 4DO8A 1I02A 3KFDE 4IYEA 4AEAA 1COEA 1ABTA 1ES7B 2ABXA 2GOOB 2H62C 2OFSA 5DZ5A 1NTXA 1ZADA 3BT1U 1KC4A 1QKEA 1FASA 1CREA 3LAQU 4QTIU 1NTNA 1NXBA 1ERAA 2X8BB 1CXOA 4P7UA 1JBDA 2K3GA 1CDSA 1V6PA 2N99A 3EBXA 4OM4A 4FAOC 2MFAA 1ONJA 3BT2U 1CCQA 1FRAA 2GOOC 1TFSA 1LX5B 5IMTD 1CDRA 1TGXA 2MJ0A 1HAAA 1DRSA 5DU1A 1FSSB 2H64B 3HH7A 1LXGA 1KBAA 4FAOE 1HOYA 1G6MA 2QC1A 3EVSC 2FD6U 4BIKB 1IDIA 1FFJA 2LCRA 1NYUA 2MJYA 3ERAA 1QKDA 1IDGA 2H5FA 1REWC 1KL8A 1IDLA 1KBTA 1IQ9A 2CRSA 6EBXA 1LJZA 1CRFA 2VLWA 1IJCA 4ZQYA 1F8UB 1LSIA 4OM5A 1NORA 1KXIA 1LXHA 2PJYB 2H62D 3NH7A 2HLRA 1TXBA 2MJ4A 1KFHA 5DO6A 2QJ9C 1NYSA 2JQPA 1L4WA 2BHIA 1CTXA 1RL5A 1TXAA 1MAHF 2CCXA 3FEVA 2L03A 1NEAA 2BTXA 1HC9B 2LA1A 2PJYC 1F94A 1FF4A 2MHYA 2QJBC 3VTSA 2CDXA 1KBSA 2MUPA 4EY8B 5IMYC 2UX2A 4HQPF 1HC9A 1CB9A 4LFTA 2QJAC 1RGJA 1S4YA 3U74U 2I9BE 1KU6B 2H64C 1W6BA 2L5SA 1BTEA 1KTZB 1VB0A 1ERGA 4UY2C 5EBXA 1CHVS 1HAJA 1B41B 3U73U 1UG4A 1JGKA 1IK8A 1IDHA 3NEQA 3QB4B 4BDTB 2CTXA 2MUOA 1CDQA 1BXPA 1QM7A 1IKCA 1PLOA 2ERAA 3NDSA 3KFDI 1XT3A 3PLCA 2UWRA 2J8BA
chains in the Genus database with same CATH superfamily
2HLQA 1CXNA 1CODA 1JE9A 4XJJA 1MR6A 2H7ZB 1KS6A 2NBTA 1CVOA 1M9ZA 1YWHA 2CRTA 2JVEA 1CDTA 2H8UA 2H7ZA 1H0JA 4RUDA 1FSCA 4DO8A 1I02A 3KFDE 4IYEA 4AEAA 1COEA 1ABTA 1ES7B 2ABXA 2GOOB 2H62C 2OFSA 5DZ5A 1NTXA 1ZADA 3BT1U 1KC4A 1QKEA 1FASA 1CREA 3LAQU 4QTIU 1NTNA 1NXBA 1ERAA 2X8BB 1CXOA 4P7UA 1JBDA 2K3GA 1CDSA 1V6PA 2N99A 3EBXA 4OM4A 4FAOC 2MFAA 1ONJA 3BT2U 4KSNA 1CCQA 2GOOC 1FRAA 1TFSA 1LX5B 5IMTD 1CDRA 1TGXA 2MJ0A 1HAAA 1DRSA 5DU1A 1FSSB 2H64B 3HH7A 1LXGA 1KBAA 4FAOE 1HOYA 1G6MA 2QC1A 3EVSC 2FD6U 4BIKB 1IDIA 1FFJA 2LCRA 1NYUA 2MJYA 3ERAA 1QKDA 1IDGA 2H5FA 1REWC 1KL8A 1IDLA 1KBTA 1IQ9A 2CRSA 6EBXA 1LJZA 1CRFA 2VLWA 1IJCA 4ZQYA 1F8UB 1LSIA 4OM5A 1NORA 1KXIA 1LXHA 2PJYB 2H62D 3NH7A 2HLRA 1TXBA 2MJ4A 1KFHA 5DO6A 2QJ9C 1NYSA 2JQPA 1L4WA 2BHIA 1CTXA 1RL5A 1TXAA 1MAHF 2CCXA 3FEVA 2L03A 1NEAA 2BTXA 1HC9B 2LA1A 2PJYC 1F94A 1FF4A 2MHYA 2QJBC 3VTSA 2CDXA 1KBSA 2MUPA 4EY8B 5IMYC 2UX2A 4HQPF 1HC9A 1CB9A 4LFTA 2QJAC 1RGJA 1S4YA 3U74U 2I9BE 1KU6B 2H64C 1W6BA 2L5SA 1BTEA 1KTZB 1VB0A 1ERGA 4UY2C 5EBXA 1CHVS 1HAJA 1B41B 3U73U 1UG4A 1JGKA 1IK8A 1IDHA 3NEQA 3QB4B 4BDTB 2CTXA 2MUOA 1CDQA 1BXPA 1QM7A 1IKCA 1PLOA 2ERAA 3NDSA 3KFDI 1XT3A 3PLCA 2UWRA 2J8BA
chains in the Genus database with same CATH topology
2HLQA 1CXNA 1CODA 1JE9A 4XJJA 1MR6A 2H7ZB 1KS6A 2NBTA 1CVOA 1M9ZA 1YWHA 2CRTA 2JVEA 1CDTA 2H8UA 2H7ZA 1H0JA 4RUDA 1FSCA 4DO8A 1I02A 3KFDE 4IYEA 4AEAA 1COEA 1ABTA 1ES7B 2ABXA 2GOOB 2H62C 2OFSA 5DZ5A 1NTXA 1ZADA 3BT1U 1KC4A 1QKEA 1FASA 1CREA 3LAQU 4QTIU 1NTNA 1NXBA 1ERAA 2X8BB 1CXOA 4P7UA 1JBDA 2K3GA 1CDSA 1V6PA 2N99A 3EBXA 4OM4A 4FAOC 2MFAA 1ONJA 3BT2U 4KSNA 1CCQA 2GOOC 1FRAA 1TFSA 1LX5B 5IMTD 1CDRA 1TGXA 2MJ0A 1HAAA 1DRSA 5DU1A 1FSSB 2H64B 3HH7A 1LXGA 1KBAA 4FAOE 1HOYA 1G6MA 2QC1A 3EVSC 2FD6U 4BIKB 1IDIA 1FFJA 2LCRA 1NYUA 2MJYA 3ERAA 1QKDA 1IDGA 2H5FA 1REWC 1KL8A 1IDLA 1KBTA 1IQ9A 2CRSA 6EBXA 1LJZA 1CRFA 2VLWA 1IJCA 4ZQYA 1F8UB 1LSIA 4OM5A 1NORA 1KXIA 1LXHA 2PJYB 2H62D 3NH7A 2HLRA 1TXBA 2MJ4A 1KFHA 5DO6A 2QJ9C 1NYSA 2JQPA 1L4WA 2BHIA 1CTXA 1RL5A 1TXAA 1MAHF 2CCXA 3FEVA 2L03A 1NEAA 2BTXA 1HC9B 2LA1A 2PJYC 1F94A 1FF4A 2MHYA 2QJBC 3VTSA 2CDXA 1KBSA 2MUPA 4EY8B 5IMYC 2UX2A 4HQPF 1HC9A 1CB9A 4LFTA 2QJAC 1RGJA 1S4YA 3U74U 2I9BE 1KU6B 2H64C 1W6BA 2L5SA 1BTEA 1KTZB 1VB0A 1ERGA 4UY2C 5EBXA 1CHVS 1HAJA 1B41B 3U73U 1UG4A 1JGKA 1IK8A 1IDHA 3NEQA 3QB4B 4BDTB 2CTXA 2MUOA 1CDQA 1BXPA 1QM7A 1IKCA 1PLOA 2ERAA 3NDSA 3KFDI 1XT3A 3PLCA 2UWRA 2J8BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HLQ A;  1CXN A;  1COD A;  1JE9 A;  4XJJ A;  1MR6 A;  2H7Z B;  1KS6 A;  2NBT A;  1CVO A;  1M9Z A;  1YWH A;  2CRT A;  2JVE A;  1CDT A;  2H8U A;  2H7Z A;  1H0J A;  4RUD A;  1FSC A;  4DO8 A;  1I02 A;  3KFD E;  4IYE A;  4AEA A;  1COE A;  1ABT A;  1ES7 B;  2ABX A;  2GOO B;  2H62 C;  2OFS A;  5DZ5 A;  1NTX A;  1ZAD A;  3BT1 U;  1KC4 A;  1QKE A;  1FAS A;  1CRE A;  3LAQ U;  4QTI U;  1NTN A;  1NXB A;  1ERA A;  2X8B B;  1CXO A;  4P7U A;  1JBD A;  2K3G A;  1CDS A;  1V6P A;  2N99 A;  3EBX A;  4OM4 A;  4FAO C;  2MFA A;  1ONJ A;  3BT2 U;  1CCQ A;  1FRA A;  2GOO C;  1TFS A;  1LX5 B;  5IMT D;  1CDR A;  1TGX A;  2MJ0 A;  1HAA A;  1DRS A;  5DU1 A;  1FSS B;  2H64 B;  3HH7 A;  1LXG A;  1KBA A;  4FAO E;  1HOY A;  1G6M A;  2QC1 A;  3EVS C;  2FD6 U;  4BIK B;  1IDI A;  1FFJ A;  2LCR A;  1NYU A;  2MJY A;  3ERA A;  1QKD A;  1IDG A;  2H5F A;  1REW C;  1KL8 A;  1IDL A;  1KBT A;  1IQ9 A;  2CRS A;  6EBX A;  1LJZ A;  1CRF A;  2VLW A;  1IJC A;  4ZQY A;  1F8U B;  1LSI A;  4OM5 A;  1NOR A;  1KXI A;  1LXH A;  2PJY B;  2H62 D;  3NH7 A;  2HLR A;  1TXB A;  2MJ4 A;  1KFH A;  5DO6 A;  2QJ9 C;  1NYS A;  2JQP A;  1L4W A;  2BHI A;  1CTX A;  1RL5 A;  1TXA A;  1MAH F;  2CCX A;  3FEV A;  2L03 A;  1NEA A;  2BTX A;  1HC9 B;  2LA1 A;  2PJY C;  1F94 A;  1FF4 A;  2MHY A;  2QJB C;  3VTS A;  2CDX A;  1KBS A;  2MUP A;  4EY8 B;  5IMY C;  2UX2 A;  4HQP F;  1HC9 A;  1CB9 A;  4LFT A;  2QJA C;  1RGJ A;  1S4Y A;  3U74 U;  2I9B E;  1KU6 B;  2H64 C;  1W6B A;  2L5S A;  1BTE A;  1KTZ B;  1VB0 A;  1ERG A;  4UY2 C;  5EBX A;  1CHV S;  1HAJ A;  1B41 B;  3U73 U;  1UG4 A;  1JGK A;  1IK8 A;  1IDH A;  3NEQ A;  3QB4 B;  4BDT B;  2CTX A;  2MUO A;  1CDQ A;  1BXP A;  1QM7 A;  1IKC A;  1PLO A;  2ERA A;  3NDS A;  3KFD I;  1XT3 A;  3PLC A;  2UWR A;  2J8B A; 
#chains in the Genus database with same CATH topology
 2HLQ A;  1CXN A;  1COD A;  1JE9 A;  4XJJ A;  1MR6 A;  2H7Z B;  1KS6 A;  2NBT A;  1CVO A;  1M9Z A;  1YWH A;  2CRT A;  2JVE A;  1CDT A;  2H8U A;  2H7Z A;  1H0J A;  4RUD A;  1FSC A;  4DO8 A;  1I02 A;  3KFD E;  4IYE A;  4AEA A;  1COE A;  1ABT A;  1ES7 B;  2ABX A;  2GOO B;  2H62 C;  2OFS A;  5DZ5 A;  1NTX A;  1ZAD A;  3BT1 U;  1KC4 A;  1QKE A;  1FAS A;  1CRE A;  3LAQ U;  4QTI U;  1NTN A;  1NXB A;  1ERA A;  2X8B B;  1CXO A;  4P7U A;  1JBD A;  2K3G A;  1CDS A;  1V6P A;  2N99 A;  3EBX A;  4OM4 A;  4FAO C;  2MFA A;  1ONJ A;  3BT2 U;  4KSN A;  1CCQ A;  2GOO C;  1FRA A;  1TFS A;  1LX5 B;  5IMT D;  1CDR A;  1TGX A;  2MJ0 A;  1HAA A;  1DRS A;  5DU1 A;  1FSS B;  2H64 B;  3HH7 A;  1LXG A;  1KBA A;  4FAO E;  1HOY A;  1G6M A;  2QC1 A;  3EVS C;  2FD6 U;  4BIK B;  1IDI A;  1FFJ A;  2LCR A;  1NYU A;  2MJY A;  3ERA A;  1QKD A;  1IDG A;  2H5F A;  1REW C;  1KL8 A;  1IDL A;  1KBT A;  1IQ9 A;  2CRS A;  6EBX A;  1LJZ A;  1CRF A;  2VLW A;  1IJC A;  4ZQY A;  1F8U B;  1LSI A;  4OM5 A;  1NOR A;  1KXI A;  1LXH A;  2PJY B;  2H62 D;  3NH7 A;  2HLR A;  1TXB A;  2MJ4 A;  1KFH A;  5DO6 A;  2QJ9 C;  1NYS A;  2JQP A;  1L4W A;  2BHI A;  1CTX A;  1RL5 A;  1TXA A;  1MAH F;  2CCX A;  3FEV A;  2L03 A;  1NEA A;  2BTX A;  1HC9 B;  2LA1 A;  2PJY C;  1F94 A;  1FF4 A;  2MHY A;  2QJB C;  3VTS A;  2CDX A;  1KBS A;  2MUP A;  4EY8 B;  5IMY C;  2UX2 A;  4HQP F;  1HC9 A;  1CB9 A;  4LFT A;  2QJA C;  1RGJ A;  1S4Y A;  3U74 U;  2I9B E;  1KU6 B;  2H64 C;  1W6B A;  2L5S A;  1BTE A;  1KTZ B;  1VB0 A;  1ERG A;  4UY2 C;  5EBX A;  1CHV S;  1HAJ A;  1B41 B;  3U73 U;  1UG4 A;  1JGK A;  1IK8 A;  1IDH A;  3NEQ A;  3QB4 B;  4BDT B;  2CTX A;  2MUO A;  1CDQ A;  1BXP A;  1QM7 A;  1IKC A;  1PLO A;  2ERA A;  3NDS A;  3KFD I;  1XT3 A;  3PLC A;  2UWR A;  2J8B A; 
#chains in the Genus database with same CATH homology
 2HLQ A;  1CXN A;  1COD A;  1JE9 A;  4XJJ A;  1MR6 A;  2H7Z B;  1KS6 A;  2NBT A;  1CVO A;  1M9Z A;  1YWH A;  2CRT A;  2JVE A;  1CDT A;  2H8U A;  2H7Z A;  1H0J A;  4RUD A;  1FSC A;  4DO8 A;  1I02 A;  3KFD E;  4IYE A;  4AEA A;  1COE A;  1ABT A;  1ES7 B;  2ABX A;  2GOO B;  2H62 C;  2OFS A;  5DZ5 A;  1NTX A;  1ZAD A;  3BT1 U;  1KC4 A;  1QKE A;  1FAS A;  1CRE A;  3LAQ U;  4QTI U;  1NTN A;  1NXB A;  1ERA A;  2X8B B;  1CXO A;  4P7U A;  1JBD A;  2K3G A;  1CDS A;  1V6P A;  2N99 A;  3EBX A;  4OM4 A;  4FAO C;  2MFA A;  1ONJ A;  3BT2 U;  4KSN A;  1CCQ A;  2GOO C;  1FRA A;  1TFS A;  1LX5 B;  5IMT D;  1CDR A;  1TGX A;  2MJ0 A;  1HAA A;  1DRS A;  5DU1 A;  1FSS B;  2H64 B;  3HH7 A;  1LXG A;  1KBA A;  4FAO E;  1HOY A;  1G6M A;  2QC1 A;  3EVS C;  2FD6 U;  4BIK B;  1IDI A;  1FFJ A;  2LCR A;  1NYU A;  2MJY A;  3ERA A;  1QKD A;  1IDG A;  2H5F A;  1REW C;  1KL8 A;  1IDL A;  1KBT A;  1IQ9 A;  2CRS A;  6EBX A;  1LJZ A;  1CRF A;  2VLW A;  1IJC A;  4ZQY A;  1F8U B;  1LSI A;  4OM5 A;  1NOR A;  1KXI A;  1LXH A;  2PJY B;  2H62 D;  3NH7 A;  2HLR A;  1TXB A;  2MJ4 A;  1KFH A;  5DO6 A;  2QJ9 C;  1NYS A;  2JQP A;  1L4W A;  2BHI A;  1CTX A;  1RL5 A;  1TXA A;  1MAH F;  2CCX A;  3FEV A;  2L03 A;  1NEA A;  2BTX A;  1HC9 B;  2LA1 A;  2PJY C;  1F94 A;  1FF4 A;  2MHY A;  2QJB C;  3VTS A;  2CDX A;  1KBS A;  2MUP A;  4EY8 B;  5IMY C;  2UX2 A;  4HQP F;  1HC9 A;  1CB9 A;  4LFT A;  2QJA C;  1RGJ A;  1S4Y A;  3U74 U;  2I9B E;  1KU6 B;  2H64 C;  1W6B A;  2L5S A;  1BTE A;  1KTZ B;  1VB0 A;  1ERG A;  4UY2 C;  5EBX A;  1CHV S;  1HAJ A;  1B41 B;  3U73 U;  1UG4 A;  1JGK A;  1IK8 A;  1IDH A;  3NEQ A;  3QB4 B;  4BDT B;  2CTX A;  2MUO A;  1CDQ A;  1BXP A;  1QM7 A;  1IKC A;  1PLO A;  2ERA A;  3NDS A;  3KFD I;  1XT3 A;  3PLC A;  2UWR A;  2J8B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...