1MR6A

Solution structure of gamma-bungarotoxin:implication for the role of the residues adjacent to rgd in integrin binding
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
68
structure length
68
Chain Sequence
MQCKTCSFYTCPNSETCPDGKNICVKRSWTAVRGDGPKREIRRECAATCPPSKLGLTVFCCTTDNCNH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords neurotoxin
publication title Solution structure of gamma-bungarotoxin: The functional significance of amino acid residues flanking the RGD motif in integrin binding
pubmed doi rcsb
total genus 10
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2002-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1mr6A00
2MUOA 1JE9A 1YWHA 1BTEA 1KC4A 1QKDA 4OM5A 1DRSA 2FD6U 1ES7B 2QJAC 1ERGA 2K3GA 2H64B 1CDTA 2MUPA 4BIKB 1HC9A 2QJ9C 1F8UB 3U73U 1M9ZA 1NYSA 2CRTA 4XJJA 6EBXA 4IYEA 1QM7A 2ABXA 4RUDA 1CCQA 1CREA 2NBTA 2LA1A 1IDIA 5DZ5A 1IDGA 1NTNA 2VLWA 1CRFA 3NEQA 2H64C 1JGKA 1HAJA 1FSSB 4LFTA 2H5FA 3FEVA 5EBXA 1BXPA 1KBTA 1NXBA 4FAOC 1B41B 2CCXA 4UY2C 4ZQYA 1CVOA 1CTXA 2L5SA 3U74U 1KL8A 2H7ZA 2HLRA 1FASA 2H62D 1CODA 1KFHA 3HH7A 2GOOB 4QTIU 1KTZB 2L03A 2UX2A 3NDSA 1TXAA 1NORA 3QB4B 2MHYA 1LXHA 1F94A 1MR6A 2MFAA 4P7UA 1IDLA 2JVEA 1LSIA 1KS6A 3BT1U 3EVSC 1PLOA 1VB0A 2X8BB 1IKCA 1G6MA 5DO6A 2UWRA 1L4WA 2JQPA 1I02A 4DO8A 1UG4A 1ERAA 1HOYA 1LX5B 2GOOC 1CHVS 1S4YA 3NH7A 2I9BE 1MAHF 1NEAA 1IQ9A 1RL5A 2PJYB 4FAOE 2ERAA 3BT2U 1FFJA 3EBXA 1V6PA 5IMYC 1KBAA 1NTXA 1QKEA 1ABTA 2H7ZB 1H0JA 1FF4A 1CDSA 1HC9B 3PLCA 2H8UA 2LCRA 1FSCA 1TXBA 2MJYA 2J8BA 1CB9A 1TGXA 2HLQA 2CTXA 3VTSA 1HAAA 1ZADA 3ERAA 1KU6B 3LAQU 2CDXA 1CDQA 1RGJA 1TFSA 2MJ4A 2QC1A 5DU1A 1FRAA 1IK8A 5IMTD 4EY8B 2PJYC 1LXGA 2H62C 2BHIA 4HQPF 1CDRA 1IDHA 4AEAA 2CRSA 2MJ0A 1JBDA 1KBSA 1NYUA 1REWC 4OM4A 1CXOA 2OFSA 1CXNA 1KXIA 2N99A 3KFDE 2QJBC 1COEA 2BTXA 1LJZA 3KFDI 1ONJA 1XT3A 1W6BA 4BDTB 1IJCA
chains in the Genus database with same CATH superfamily
2MUOA 1JE9A 1YWHA 1BTEA 1KC4A 1QKDA 4OM5A 1DRSA 2FD6U 1ES7B 2QJAC 1ERGA 2K3GA 2H64B 1CDTA 2MUPA 4BIKB 1HC9A 2QJ9C 1F8UB 3U73U 1M9ZA 1NYSA 2CRTA 4XJJA 6EBXA 4IYEA 1QM7A 2ABXA 4RUDA 1CCQA 1CREA 2NBTA 2LA1A 1IDIA 5DZ5A 4KSNA 1IDGA 1NTNA 2VLWA 1CRFA 3NEQA 2H64C 1JGKA 1HAJA 1FSSB 4LFTA 2H5FA 3FEVA 5EBXA 1BXPA 1KBTA 1NXBA 4FAOC 1B41B 2CCXA 4UY2C 4ZQYA 1CVOA 1CTXA 2L5SA 3U74U 1KL8A 2H7ZA 2HLRA 1FASA 2H62D 1CODA 1KFHA 3HH7A 2GOOB 4QTIU 1KTZB 2L03A 2UX2A 3NDSA 1TXAA 1NORA 3QB4B 2MHYA 1LXHA 1F94A 1MR6A 2MFAA 4P7UA 1IDLA 2JVEA 1LSIA 1KS6A 3BT1U 3EVSC 1PLOA 1VB0A 2X8BB 1IKCA 1G6MA 5DO6A 2UWRA 1L4WA 2JQPA 1I02A 4DO8A 1UG4A 1ERAA 1HOYA 1LX5B 2GOOC 1CHVS 1S4YA 3NH7A 2I9BE 1MAHF 1NEAA 1IQ9A 1RL5A 2PJYB 4FAOE 2ERAA 3BT2U 1FFJA 3EBXA 1V6PA 5IMYC 1KBAA 1NTXA 1QKEA 1ABTA 2H7ZB 1H0JA 1FF4A 1CDSA 1HC9B 3PLCA 2H8UA 2LCRA 1FSCA 1TXBA 2MJYA 2J8BA 1CB9A 1TGXA 2HLQA 2CTXA 3VTSA 1HAAA 1ZADA 3ERAA 1KU6B 3LAQU 2CDXA 1CDQA 1RGJA 1TFSA 2MJ4A 2QC1A 5DU1A 1FRAA 1IK8A 5IMTD 4EY8B 2PJYC 1LXGA 2H62C 2BHIA 4HQPF 1CDRA 1IDHA 4AEAA 2CRSA 2MJ0A 1JBDA 1KBSA 1NYUA 1REWC 4OM4A 1CXOA 2OFSA 1CXNA 1KXIA 2N99A 3KFDE 2QJBC 1COEA 2BTXA 1LJZA 3KFDI 1ONJA 1XT3A 1W6BA 4BDTB 1IJCA
chains in the Genus database with same CATH topology
2MUOA 1JE9A 1YWHA 1BTEA 1KC4A 1QKDA 4OM5A 1DRSA 2FD6U 1ES7B 2QJAC 1ERGA 2K3GA 2H64B 1CDTA 2MUPA 4BIKB 1HC9A 2QJ9C 1F8UB 3U73U 1M9ZA 1NYSA 2CRTA 4XJJA 6EBXA 4IYEA 1QM7A 2ABXA 4RUDA 1CCQA 1CREA 2NBTA 2LA1A 1IDIA 5DZ5A 4KSNA 1IDGA 1NTNA 2VLWA 1CRFA 3NEQA 2H64C 1JGKA 1HAJA 1FSSB 4LFTA 2H5FA 3FEVA 5EBXA 1BXPA 1KBTA 1NXBA 4FAOC 1B41B 2CCXA 4UY2C 4ZQYA 1CVOA 1CTXA 2L5SA 3U74U 1KL8A 2H7ZA 2HLRA 1FASA 2H62D 1CODA 1KFHA 3HH7A 2GOOB 4QTIU 1KTZB 2L03A 2UX2A 3NDSA 1TXAA 1NORA 3QB4B 2MHYA 1LXHA 1F94A 1MR6A 2MFAA 4P7UA 1IDLA 2JVEA 1LSIA 1KS6A 3BT1U 3EVSC 1PLOA 1VB0A 2X8BB 1IKCA 1G6MA 5DO6A 2UWRA 1L4WA 2JQPA 1I02A 4DO8A 1UG4A 1ERAA 1HOYA 1LX5B 2GOOC 1CHVS 1S4YA 3NH7A 2I9BE 1MAHF 1NEAA 1IQ9A 1RL5A 2PJYB 4FAOE 2ERAA 3BT2U 1FFJA 3EBXA 1V6PA 5IMYC 1KBAA 1NTXA 1QKEA 1ABTA 2H7ZB 1H0JA 1FF4A 1CDSA 1HC9B 3PLCA 2H8UA 2LCRA 1FSCA 1TXBA 2MJYA 2J8BA 1CB9A 1TGXA 2HLQA 2CTXA 3VTSA 1HAAA 1ZADA 3ERAA 1KU6B 3LAQU 2CDXA 1CDQA 1RGJA 1TFSA 2MJ4A 2QC1A 5DU1A 1FRAA 1IK8A 5IMTD 4EY8B 2PJYC 1LXGA 2H62C 2BHIA 4HQPF 1CDRA 1IDHA 4AEAA 2CRSA 2MJ0A 1JBDA 1KBSA 1NYUA 1REWC 4OM4A 1CXOA 2OFSA 1CXNA 1KXIA 2N99A 3KFDE 2QJBC 1COEA 2BTXA 1LJZA 3KFDI 1ONJA 1XT3A 1W6BA 4BDTB 1IJCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MUO A;  1JE9 A;  1YWH A;  1BTE A;  1KC4 A;  1QKD A;  4OM5 A;  1DRS A;  2FD6 U;  1ES7 B;  2QJA C;  1ERG A;  2K3G A;  2H64 B;  1CDT A;  2MUP A;  4BIK B;  1HC9 A;  2QJ9 C;  1F8U B;  3U73 U;  1M9Z A;  1NYS A;  2CRT A;  4XJJ A;  6EBX A;  4IYE A;  1QM7 A;  2ABX A;  4RUD A;  1CCQ A;  1CRE A;  2NBT A;  2LA1 A;  1IDI A;  5DZ5 A;  1IDG A;  1NTN A;  2VLW A;  1CRF A;  3NEQ A;  2H64 C;  1JGK A;  1HAJ A;  1FSS B;  4LFT A;  2H5F A;  3FEV A;  5EBX A;  1BXP A;  1KBT A;  1NXB A;  4FAO C;  1B41 B;  2CCX A;  4UY2 C;  4ZQY A;  1CVO A;  1CTX A;  2L5S A;  3U74 U;  1KL8 A;  2H7Z A;  2HLR A;  1FAS A;  2H62 D;  1COD A;  1KFH A;  3HH7 A;  2GOO B;  4QTI U;  1KTZ B;  2L03 A;  2UX2 A;  3NDS A;  1TXA A;  1NOR A;  3QB4 B;  2MHY A;  1LXH A;  1F94 A;  1MR6 A;  2MFA A;  4P7U A;  1IDL A;  2JVE A;  1LSI A;  1KS6 A;  3BT1 U;  3EVS C;  1PLO A;  1VB0 A;  2X8B B;  1IKC A;  1G6M A;  5DO6 A;  2UWR A;  1L4W A;  2JQP A;  1I02 A;  4DO8 A;  1UG4 A;  1ERA A;  1HOY A;  1LX5 B;  2GOO C;  1CHV S;  1S4Y A;  3NH7 A;  2I9B E;  1MAH F;  1NEA A;  1IQ9 A;  1RL5 A;  2PJY B;  4FAO E;  2ERA A;  3BT2 U;  1FFJ A;  3EBX A;  1V6P A;  5IMY C;  1KBA A;  1NTX A;  1QKE A;  1ABT A;  2H7Z B;  1H0J A;  1FF4 A;  1CDS A;  1HC9 B;  3PLC A;  2H8U A;  2LCR A;  1FSC A;  1TXB A;  2MJY A;  2J8B A;  1CB9 A;  1TGX A;  2HLQ A;  2CTX A;  3VTS A;  1HAA A;  1ZAD A;  3ERA A;  1KU6 B;  3LAQ U;  2CDX A;  1CDQ A;  1RGJ A;  1TFS A;  2MJ4 A;  2QC1 A;  5DU1 A;  1FRA A;  1IK8 A;  5IMT D;  4EY8 B;  2PJY C;  1LXG A;  2H62 C;  2BHI A;  4HQP F;  1CDR A;  1IDH A;  4AEA A;  2CRS A;  2MJ0 A;  1JBD A;  1KBS A;  1NYU A;  1REW C;  4OM4 A;  1CXO A;  2OFS A;  1CXN A;  1KXI A;  2N99 A;  3KFD E;  2QJB C;  1COE A;  2BTX A;  1LJZ A;  3KFD I;  1ONJ A;  1XT3 A;  1W6B A;  4BDT B;  1IJC A; 
#chains in the Genus database with same CATH topology
 2MUO A;  1JE9 A;  1YWH A;  1BTE A;  1KC4 A;  1QKD A;  4OM5 A;  1DRS A;  2FD6 U;  1ES7 B;  2QJA C;  1ERG A;  2K3G A;  2H64 B;  1CDT A;  2MUP A;  4BIK B;  1HC9 A;  2QJ9 C;  1F8U B;  3U73 U;  1M9Z A;  1NYS A;  2CRT A;  4XJJ A;  6EBX A;  4IYE A;  1QM7 A;  2ABX A;  4RUD A;  1CCQ A;  1CRE A;  2NBT A;  2LA1 A;  1IDI A;  5DZ5 A;  4KSN A;  1IDG A;  1NTN A;  2VLW A;  1CRF A;  3NEQ A;  2H64 C;  1JGK A;  1HAJ A;  1FSS B;  4LFT A;  2H5F A;  3FEV A;  5EBX A;  1BXP A;  1KBT A;  1NXB A;  4FAO C;  1B41 B;  2CCX A;  4UY2 C;  4ZQY A;  1CVO A;  1CTX A;  2L5S A;  3U74 U;  1KL8 A;  2H7Z A;  2HLR A;  1FAS A;  2H62 D;  1COD A;  1KFH A;  3HH7 A;  2GOO B;  4QTI U;  1KTZ B;  2L03 A;  2UX2 A;  3NDS A;  1TXA A;  1NOR A;  3QB4 B;  2MHY A;  1LXH A;  1F94 A;  1MR6 A;  2MFA A;  4P7U A;  1IDL A;  2JVE A;  1LSI A;  1KS6 A;  3BT1 U;  3EVS C;  1PLO A;  1VB0 A;  2X8B B;  1IKC A;  1G6M A;  5DO6 A;  2UWR A;  1L4W A;  2JQP A;  1I02 A;  4DO8 A;  1UG4 A;  1ERA A;  1HOY A;  1LX5 B;  2GOO C;  1CHV S;  1S4Y A;  3NH7 A;  2I9B E;  1MAH F;  1NEA A;  1IQ9 A;  1RL5 A;  2PJY B;  4FAO E;  2ERA A;  3BT2 U;  1FFJ A;  3EBX A;  1V6P A;  5IMY C;  1KBA A;  1NTX A;  1QKE A;  1ABT A;  2H7Z B;  1H0J A;  1FF4 A;  1CDS A;  1HC9 B;  3PLC A;  2H8U A;  2LCR A;  1FSC A;  1TXB A;  2MJY A;  2J8B A;  1CB9 A;  1TGX A;  2HLQ A;  2CTX A;  3VTS A;  1HAA A;  1ZAD A;  3ERA A;  1KU6 B;  3LAQ U;  2CDX A;  1CDQ A;  1RGJ A;  1TFS A;  2MJ4 A;  2QC1 A;  5DU1 A;  1FRA A;  1IK8 A;  5IMT D;  4EY8 B;  2PJY C;  1LXG A;  2H62 C;  2BHI A;  4HQP F;  1CDR A;  1IDH A;  4AEA A;  2CRS A;  2MJ0 A;  1JBD A;  1KBS A;  1NYU A;  1REW C;  4OM4 A;  1CXO A;  2OFS A;  1CXN A;  1KXI A;  2N99 A;  3KFD E;  2QJB C;  1COE A;  2BTX A;  1LJZ A;  3KFD I;  1ONJ A;  1XT3 A;  1W6B A;  4BDT B;  1IJC A; 
#chains in the Genus database with same CATH homology
 2MUO A;  1JE9 A;  1YWH A;  1BTE A;  1KC4 A;  1QKD A;  4OM5 A;  1DRS A;  2FD6 U;  1ES7 B;  2QJA C;  1ERG A;  2K3G A;  2H64 B;  1CDT A;  2MUP A;  4BIK B;  1HC9 A;  2QJ9 C;  1F8U B;  3U73 U;  1M9Z A;  1NYS A;  2CRT A;  4XJJ A;  6EBX A;  4IYE A;  1QM7 A;  2ABX A;  4RUD A;  1CCQ A;  1CRE A;  2NBT A;  2LA1 A;  1IDI A;  5DZ5 A;  4KSN A;  1IDG A;  1NTN A;  2VLW A;  1CRF A;  3NEQ A;  2H64 C;  1JGK A;  1HAJ A;  1FSS B;  4LFT A;  2H5F A;  3FEV A;  5EBX A;  1BXP A;  1KBT A;  1NXB A;  4FAO C;  1B41 B;  2CCX A;  4UY2 C;  4ZQY A;  1CVO A;  1CTX A;  2L5S A;  3U74 U;  1KL8 A;  2H7Z A;  2HLR A;  1FAS A;  2H62 D;  1COD A;  1KFH A;  3HH7 A;  2GOO B;  4QTI U;  1KTZ B;  2L03 A;  2UX2 A;  3NDS A;  1TXA A;  1NOR A;  3QB4 B;  2MHY A;  1LXH A;  1F94 A;  1MR6 A;  2MFA A;  4P7U A;  1IDL A;  2JVE A;  1LSI A;  1KS6 A;  3BT1 U;  3EVS C;  1PLO A;  1VB0 A;  2X8B B;  1IKC A;  1G6M A;  5DO6 A;  2UWR A;  1L4W A;  2JQP A;  1I02 A;  4DO8 A;  1UG4 A;  1ERA A;  1HOY A;  1LX5 B;  2GOO C;  1CHV S;  1S4Y A;  3NH7 A;  2I9B E;  1MAH F;  1NEA A;  1IQ9 A;  1RL5 A;  2PJY B;  4FAO E;  2ERA A;  3BT2 U;  1FFJ A;  3EBX A;  1V6P A;  5IMY C;  1KBA A;  1NTX A;  1QKE A;  1ABT A;  2H7Z B;  1H0J A;  1FF4 A;  1CDS A;  1HC9 B;  3PLC A;  2H8U A;  2LCR A;  1FSC A;  1TXB A;  2MJY A;  2J8B A;  1CB9 A;  1TGX A;  2HLQ A;  2CTX A;  3VTS A;  1HAA A;  1ZAD A;  3ERA A;  1KU6 B;  3LAQ U;  2CDX A;  1CDQ A;  1RGJ A;  1TFS A;  2MJ4 A;  2QC1 A;  5DU1 A;  1FRA A;  1IK8 A;  5IMT D;  4EY8 B;  2PJY C;  1LXG A;  2H62 C;  2BHI A;  4HQP F;  1CDR A;  1IDH A;  4AEA A;  2CRS A;  2MJ0 A;  1JBD A;  1KBS A;  1NYU A;  1REW C;  4OM4 A;  1CXO A;  2OFS A;  1CXN A;  1KXI A;  2N99 A;  3KFD E;  2QJB C;  1COE A;  2BTX A;  1LJZ A;  3KFD I;  1ONJ A;  1XT3 A;  1W6B A;  4BDT B;  1IJC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...