1QM7A

X-ray structure of a three-fingered chimeric protein, stability of a structural scaffold
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
61
structure length
61
Chain Sequence
TMCYSHTTTSRAILTNCPGETNCYKKSRRHPPKMVLGRGCGCPTVAPGIKLNCCTTDKCNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords R-CHII
publication title Stability of a Structural Scaffold Upon Activity Transfer : X-Ray Structure of a Three Fingers Chimeric Protein.
pubmed doi rcsb
source organism Synthetic construct
total genus 10
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 1999-09-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1qm7A00
1MR6A 2H64B 3ERAA 1KBTA 1TXAA 2MHYA 1IDIA 2UX2A 1CXOA 1UG4A 1FF4A 1LX5B 1IDLA 2L5SA 1CREA 2VLWA 1HC9A 2MJ0A 2LA1A 3NH7A 1JE9A 3NEQA 1LJZA 1FASA 1QKDA 3QB4B 4UY2C 2CDXA 3FEVA 1ABTA 1YWHA 2L03A 1F8UB 4RUDA 1LSIA 3KFDE 1ONJA 1CXNA 1JBDA 3HH7A 5DU1A 1CODA 4XJJA 4DO8A 2X8BB 2J8BA 2H64C 1KC4A 1COEA 2HLRA 2H7ZB 6EBXA 2H62C 2QC1A 1NTNA 1CRFA 1FFJA 2CRTA 1VB0A 1ZADA 4OM5A 1IKCA 1CDQA 2ERAA 1IDHA 1ERAA 2I9BE 1RL5A 2CTXA 1PLOA 1IDGA 2HLQA 1ES7B 1IK8A 3BT2U 1KU6B 1CDSA 1F94A 1KFHA 4FAOE 1TXBA 2MJYA 1KXIA 1JGKA 1HC9B 1NORA 2MUOA 1NEAA 1REWC 4OM4A 3NDSA 1XT3A 2BTXA 1HAAA 1H0JA 2H5FA 2LCRA 3LAQU 2JVEA 4LFTA 3BT1U 4QTIU 1HAJA 1NYSA 1HOYA 1LXGA 2CRSA 1S4YA 2H8UA 3VTSA 2GOOC 1NTXA 4IYEA 1KS6A 4EY8B 1NYUA 1L4WA 2ABXA 2GOOB 1CVOA 4FAOC 2MUPA 2NBTA 1I02A 2JQPA 1B41B 1KBAA 2MJ4A 1KBSA 1QM7A 1TFSA 2CCXA 5DZ5A 1CDTA 5IMTD 3U74U 1BTEA 2UWRA 4BDTB 1G6MA 4P7UA 1V6PA 2QJAC 1FSCA 1NXBA 1FSSB 4AEAA 4ZQYA 3KFDI 2PJYC 1LXHA 1CHVS 1CTXA 2PJYB 2FD6U 1W6BA 2N99A 3EBXA 1KTZB 1IQ9A 2MFAA 2BHIA 1DRSA 2QJ9C 5DO6A 1ERGA 1KL8A 3EVSC 3U73U 1CDRA 5IMYC 1QKEA 2OFSA 2K3GA 2QJBC 1MAHF 2H62D 1IJCA 1CCQA 1FRAA 1M9ZA 2H7ZA 1BXPA 1RGJA 1TGXA 4BIKB 4HQPF 5EBXA 1CB9A 3PLCA
chains in the Genus database with same CATH superfamily
1MR6A 2H64B 3ERAA 1KBTA 1TXAA 2MHYA 1IDIA 2UX2A 1CXOA 1UG4A 1FF4A 1LX5B 1IDLA 2L5SA 1CREA 2VLWA 1HC9A 2MJ0A 2LA1A 3NH7A 1JE9A 3NEQA 1LJZA 1FASA 1QKDA 3QB4B 4UY2C 2CDXA 3FEVA 1ABTA 1YWHA 2L03A 1F8UB 4RUDA 1LSIA 3KFDE 1ONJA 1CXNA 1JBDA 3HH7A 5DU1A 1CODA 4XJJA 4DO8A 2X8BB 2J8BA 2H64C 1KC4A 1COEA 2HLRA 2H7ZB 6EBXA 2H62C 2QC1A 1NTNA 1CRFA 1FFJA 2CRTA 1VB0A 1ZADA 4OM5A 1IKCA 1CDQA 2ERAA 1IDHA 1ERAA 2I9BE 1RL5A 2CTXA 1PLOA 1IDGA 2HLQA 1ES7B 1IK8A 3BT2U 1KU6B 1CDSA 1F94A 1KFHA 4KSNA 4FAOE 1TXBA 2MJYA 1KXIA 1JGKA 1HC9B 1NORA 2MUOA 1NEAA 1REWC 4OM4A 3NDSA 1XT3A 2BTXA 1HAAA 1H0JA 2H5FA 2LCRA 3LAQU 2JVEA 4LFTA 3BT1U 4QTIU 1HAJA 1NYSA 1HOYA 1LXGA 2CRSA 1S4YA 2H8UA 3VTSA 2GOOC 1NTXA 4IYEA 1KS6A 4EY8B 1NYUA 1L4WA 2ABXA 2GOOB 1CVOA 4FAOC 2MUPA 2NBTA 1I02A 2JQPA 1B41B 1KBAA 2MJ4A 1KBSA 1QM7A 1TFSA 2CCXA 5DZ5A 1CDTA 5IMTD 3U74U 1BTEA 2UWRA 4BDTB 1G6MA 4P7UA 1V6PA 2QJAC 1FSCA 1NXBA 1FSSB 4AEAA 4ZQYA 3KFDI 2PJYC 1LXHA 1CHVS 1CTXA 2PJYB 2FD6U 1W6BA 2N99A 3EBXA 1KTZB 1IQ9A 2MFAA 2BHIA 1DRSA 2QJ9C 5DO6A 1ERGA 1KL8A 3EVSC 3U73U 1CDRA 5IMYC 1QKEA 2OFSA 2K3GA 2QJBC 1MAHF 2H62D 1IJCA 1CCQA 1FRAA 1M9ZA 2H7ZA 1BXPA 1RGJA 1TGXA 4BIKB 4HQPF 5EBXA 1CB9A 3PLCA
chains in the Genus database with same CATH topology
1MR6A 2H64B 3ERAA 1KBTA 1TXAA 2MHYA 1IDIA 2UX2A 1CXOA 1UG4A 1FF4A 1LX5B 1IDLA 2L5SA 1CREA 2VLWA 1HC9A 2MJ0A 2LA1A 3NH7A 1JE9A 3NEQA 1LJZA 1FASA 1QKDA 3QB4B 4UY2C 2CDXA 3FEVA 1ABTA 1YWHA 2L03A 1F8UB 4RUDA 1LSIA 3KFDE 1ONJA 1CXNA 1JBDA 3HH7A 5DU1A 1CODA 4XJJA 4DO8A 2X8BB 2J8BA 2H64C 1KC4A 1COEA 2HLRA 2H7ZB 6EBXA 2H62C 2QC1A 1NTNA 1CRFA 1FFJA 2CRTA 1VB0A 1ZADA 4OM5A 1IKCA 1CDQA 2ERAA 1IDHA 1ERAA 2I9BE 1RL5A 2CTXA 1PLOA 1IDGA 2HLQA 1ES7B 1IK8A 3BT2U 1KU6B 1CDSA 1F94A 1KFHA 4KSNA 4FAOE 1TXBA 2MJYA 1KXIA 1JGKA 1HC9B 1NORA 2MUOA 1NEAA 1REWC 4OM4A 3NDSA 1XT3A 2BTXA 1HAAA 1H0JA 2H5FA 2LCRA 3LAQU 2JVEA 4LFTA 3BT1U 4QTIU 1HAJA 1NYSA 1HOYA 1LXGA 2CRSA 1S4YA 2H8UA 3VTSA 2GOOC 1NTXA 4IYEA 1KS6A 4EY8B 1NYUA 1L4WA 2ABXA 2GOOB 1CVOA 4FAOC 2MUPA 2NBTA 1I02A 2JQPA 1B41B 1KBAA 2MJ4A 1KBSA 1QM7A 1TFSA 2CCXA 5DZ5A 1CDTA 5IMTD 3U74U 1BTEA 2UWRA 4BDTB 1G6MA 4P7UA 1V6PA 2QJAC 1FSCA 1NXBA 1FSSB 4AEAA 4ZQYA 3KFDI 2PJYC 1LXHA 1CHVS 1CTXA 2PJYB 2FD6U 1W6BA 2N99A 3EBXA 1KTZB 1IQ9A 2MFAA 2BHIA 1DRSA 2QJ9C 5DO6A 1ERGA 1KL8A 3EVSC 3U73U 1CDRA 5IMYC 1QKEA 2OFSA 2K3GA 2QJBC 1MAHF 2H62D 1IJCA 1CCQA 1FRAA 1M9ZA 2H7ZA 1BXPA 1RGJA 1TGXA 4BIKB 4HQPF 5EBXA 1CB9A 3PLCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MR6 A;  2H64 B;  3ERA A;  1KBT A;  1TXA A;  2MHY A;  1IDI A;  2UX2 A;  1CXO A;  1UG4 A;  1FF4 A;  1LX5 B;  1IDL A;  2L5S A;  1CRE A;  2VLW A;  1HC9 A;  2MJ0 A;  2LA1 A;  3NH7 A;  1JE9 A;  3NEQ A;  1LJZ A;  1FAS A;  1QKD A;  3QB4 B;  4UY2 C;  2CDX A;  3FEV A;  1ABT A;  1YWH A;  2L03 A;  1F8U B;  4RUD A;  1LSI A;  3KFD E;  1ONJ A;  1CXN A;  1JBD A;  3HH7 A;  5DU1 A;  1COD A;  4XJJ A;  4DO8 A;  2X8B B;  2J8B A;  2H64 C;  1KC4 A;  1COE A;  2HLR A;  2H7Z B;  6EBX A;  2H62 C;  2QC1 A;  1NTN A;  1CRF A;  1FFJ A;  2CRT A;  1VB0 A;  1ZAD A;  4OM5 A;  1IKC A;  1CDQ A;  2ERA A;  1IDH A;  1ERA A;  2I9B E;  1RL5 A;  2CTX A;  1PLO A;  1IDG A;  2HLQ A;  1ES7 B;  1IK8 A;  3BT2 U;  1KU6 B;  1CDS A;  1F94 A;  1KFH A;  4FAO E;  1TXB A;  2MJY A;  1KXI A;  1JGK A;  1HC9 B;  1NOR A;  2MUO A;  1NEA A;  1REW C;  4OM4 A;  3NDS A;  1XT3 A;  2BTX A;  1HAA A;  1H0J A;  2H5F A;  2LCR A;  3LAQ U;  2JVE A;  4LFT A;  3BT1 U;  4QTI U;  1HAJ A;  1NYS A;  1HOY A;  1LXG A;  2CRS A;  1S4Y A;  2H8U A;  3VTS A;  2GOO C;  1NTX A;  4IYE A;  1KS6 A;  4EY8 B;  1NYU A;  1L4W A;  2ABX A;  2GOO B;  1CVO A;  4FAO C;  2MUP A;  2NBT A;  1I02 A;  2JQP A;  1B41 B;  1KBA A;  2MJ4 A;  1KBS A;  1QM7 A;  1TFS A;  2CCX A;  5DZ5 A;  1CDT A;  5IMT D;  3U74 U;  1BTE A;  2UWR A;  4BDT B;  1G6M A;  4P7U A;  1V6P A;  2QJA C;  1FSC A;  1NXB A;  1FSS B;  4AEA A;  4ZQY A;  3KFD I;  2PJY C;  1LXH A;  1CHV S;  1CTX A;  2PJY B;  2FD6 U;  1W6B A;  2N99 A;  3EBX A;  1KTZ B;  1IQ9 A;  2MFA A;  2BHI A;  1DRS A;  2QJ9 C;  5DO6 A;  1ERG A;  1KL8 A;  3EVS C;  3U73 U;  1CDR A;  5IMY C;  1QKE A;  2OFS A;  2K3G A;  2QJB C;  1MAH F;  2H62 D;  1IJC A;  1CCQ A;  1FRA A;  1M9Z A;  2H7Z A;  1BXP A;  1RGJ A;  1TGX A;  4BIK B;  4HQP F;  5EBX A;  1CB9 A;  3PLC A; 
#chains in the Genus database with same CATH topology
 1MR6 A;  2H64 B;  3ERA A;  1KBT A;  1TXA A;  2MHY A;  1IDI A;  2UX2 A;  1CXO A;  1UG4 A;  1FF4 A;  1LX5 B;  1IDL A;  2L5S A;  1CRE A;  2VLW A;  1HC9 A;  2MJ0 A;  2LA1 A;  3NH7 A;  1JE9 A;  3NEQ A;  1LJZ A;  1FAS A;  1QKD A;  3QB4 B;  4UY2 C;  2CDX A;  3FEV A;  1ABT A;  1YWH A;  2L03 A;  1F8U B;  4RUD A;  1LSI A;  3KFD E;  1ONJ A;  1CXN A;  1JBD A;  3HH7 A;  5DU1 A;  1COD A;  4XJJ A;  4DO8 A;  2X8B B;  2J8B A;  2H64 C;  1KC4 A;  1COE A;  2HLR A;  2H7Z B;  6EBX A;  2H62 C;  2QC1 A;  1NTN A;  1CRF A;  1FFJ A;  2CRT A;  1VB0 A;  1ZAD A;  4OM5 A;  1IKC A;  1CDQ A;  2ERA A;  1IDH A;  1ERA A;  2I9B E;  1RL5 A;  2CTX A;  1PLO A;  1IDG A;  2HLQ A;  1ES7 B;  1IK8 A;  3BT2 U;  1KU6 B;  1CDS A;  1F94 A;  1KFH A;  4KSN A;  4FAO E;  1TXB A;  2MJY A;  1KXI A;  1JGK A;  1HC9 B;  1NOR A;  2MUO A;  1NEA A;  1REW C;  4OM4 A;  3NDS A;  1XT3 A;  2BTX A;  1HAA A;  1H0J A;  2H5F A;  2LCR A;  3LAQ U;  2JVE A;  4LFT A;  3BT1 U;  4QTI U;  1HAJ A;  1NYS A;  1HOY A;  1LXG A;  2CRS A;  1S4Y A;  2H8U A;  3VTS A;  2GOO C;  1NTX A;  4IYE A;  1KS6 A;  4EY8 B;  1NYU A;  1L4W A;  2ABX A;  2GOO B;  1CVO A;  4FAO C;  2MUP A;  2NBT A;  1I02 A;  2JQP A;  1B41 B;  1KBA A;  2MJ4 A;  1KBS A;  1QM7 A;  1TFS A;  2CCX A;  5DZ5 A;  1CDT A;  5IMT D;  3U74 U;  1BTE A;  2UWR A;  4BDT B;  1G6M A;  4P7U A;  1V6P A;  2QJA C;  1FSC A;  1NXB A;  1FSS B;  4AEA A;  4ZQY A;  3KFD I;  2PJY C;  1LXH A;  1CHV S;  1CTX A;  2PJY B;  2FD6 U;  1W6B A;  2N99 A;  3EBX A;  1KTZ B;  1IQ9 A;  2MFA A;  2BHI A;  1DRS A;  2QJ9 C;  5DO6 A;  1ERG A;  1KL8 A;  3EVS C;  3U73 U;  1CDR A;  5IMY C;  1QKE A;  2OFS A;  2K3G A;  2QJB C;  1MAH F;  2H62 D;  1IJC A;  1CCQ A;  1FRA A;  1M9Z A;  2H7Z A;  1BXP A;  1RGJ A;  1TGX A;  4BIK B;  4HQP F;  5EBX A;  1CB9 A;  3PLC A; 
#chains in the Genus database with same CATH homology
 1MR6 A;  2H64 B;  3ERA A;  1KBT A;  1TXA A;  2MHY A;  1IDI A;  2UX2 A;  1CXO A;  1UG4 A;  1FF4 A;  1LX5 B;  1IDL A;  2L5S A;  1CRE A;  2VLW A;  1HC9 A;  2MJ0 A;  2LA1 A;  3NH7 A;  1JE9 A;  3NEQ A;  1LJZ A;  1FAS A;  1QKD A;  3QB4 B;  4UY2 C;  2CDX A;  3FEV A;  1ABT A;  1YWH A;  2L03 A;  1F8U B;  4RUD A;  1LSI A;  3KFD E;  1ONJ A;  1CXN A;  1JBD A;  3HH7 A;  5DU1 A;  1COD A;  4XJJ A;  4DO8 A;  2X8B B;  2J8B A;  2H64 C;  1KC4 A;  1COE A;  2HLR A;  2H7Z B;  6EBX A;  2H62 C;  2QC1 A;  1NTN A;  1CRF A;  1FFJ A;  2CRT A;  1VB0 A;  1ZAD A;  4OM5 A;  1IKC A;  1CDQ A;  2ERA A;  1IDH A;  1ERA A;  2I9B E;  1RL5 A;  2CTX A;  1PLO A;  1IDG A;  2HLQ A;  1ES7 B;  1IK8 A;  3BT2 U;  1KU6 B;  1CDS A;  1F94 A;  1KFH A;  4KSN A;  4FAO E;  1TXB A;  2MJY A;  1KXI A;  1JGK A;  1HC9 B;  1NOR A;  2MUO A;  1NEA A;  1REW C;  4OM4 A;  3NDS A;  1XT3 A;  2BTX A;  1HAA A;  1H0J A;  2H5F A;  2LCR A;  3LAQ U;  2JVE A;  4LFT A;  3BT1 U;  4QTI U;  1HAJ A;  1NYS A;  1HOY A;  1LXG A;  2CRS A;  1S4Y A;  2H8U A;  3VTS A;  2GOO C;  1NTX A;  4IYE A;  1KS6 A;  4EY8 B;  1NYU A;  1L4W A;  2ABX A;  2GOO B;  1CVO A;  4FAO C;  2MUP A;  2NBT A;  1I02 A;  2JQP A;  1B41 B;  1KBA A;  2MJ4 A;  1KBS A;  1QM7 A;  1TFS A;  2CCX A;  5DZ5 A;  1CDT A;  5IMT D;  3U74 U;  1BTE A;  2UWR A;  4BDT B;  1G6M A;  4P7U A;  1V6P A;  2QJA C;  1FSC A;  1NXB A;  1FSS B;  4AEA A;  4ZQY A;  3KFD I;  2PJY C;  1LXH A;  1CHV S;  1CTX A;  2PJY B;  2FD6 U;  1W6B A;  2N99 A;  3EBX A;  1KTZ B;  1IQ9 A;  2MFA A;  2BHI A;  1DRS A;  2QJ9 C;  5DO6 A;  1ERG A;  1KL8 A;  3EVS C;  3U73 U;  1CDR A;  5IMY C;  1QKE A;  2OFS A;  2K3G A;  2QJB C;  1MAH F;  2H62 D;  1IJC A;  1CCQ A;  1FRA A;  1M9Z A;  2H7Z A;  1BXP A;  1RGJ A;  1TGX A;  4BIK B;  4HQP F;  5EBX A;  1CB9 A;  3PLC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...