1H0JA

Structural basis of the membrane-induced cardiotoxin a3 oligomerization
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
60
structure length
60
Chain Sequence
LKCNKLVPLFYKTCPAGKNLCYKMFMVATPKVPVKRGCIDVCPKSSLLVKYVCCNTDRCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cardiotoxin
molecule keywords CARDIOTOXIN-3
publication title Structural Basis of Membrane-Induced Cardiotoxin A3 Oligomerization
pubmed doi rcsb
total genus 11
structure length 60
sequence length 60
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2002-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1h0jA00
1RL5A 1LXGA 3NDSA 1FRAA 1W6BA 1YWHA 4RUDA 2L5SA 3HH7A 1IJCA 2OFSA 5DO6A 1NORA 2H5FA 2PJYB 2CRTA 1XT3A 2HLRA 1IDIA 2K3GA 1QM7A 2JQPA 4OM5A 1QKEA 1H0JA 1IDHA 2CRSA 1F94A 1CXOA 2QJ9C 2MJ4A 1F8UB 4IYEA 1FSSB 1KBSA 1UG4A 4DO8A 2MUPA 2N99A 3NH7A 1FSCA 4FAOC 2MFAA 1G6MA 3VTSA 4BDTB 2UWRA 2VLWA 4XJJA 3BT1U 1COEA 3BT2U 1MR6A 1NTXA 2H8UA 2X8BB 1TFSA 1NYSA 2QJBC 3FEVA 2CCXA 1CRFA 2H7ZB 4AEAA 1HC9A 2ERAA 3KFDI 1TXBA 5DZ5A 2GOOC 4QTIU 2CDXA 4ZQYA 1KL8A 1DRSA 1ES7B 2H64C 2MHYA 2H62D 2QC1A 3NEQA 1S4YA 4HQPF 2J8BA 1CREA 1FF4A 2H62C 4P7UA 1B41B 3U73U 5EBXA 2MUOA 1NYUA 1ONJA 2H7ZA 3LAQU 2PJYC 1CB9A 1KS6A 1BTEA 1LJZA 1CHVS 2HLQA 1CDSA 1JE9A 1HAAA 2MJ0A 1ERAA 1KBAA 2ABXA 1NTNA 1L4WA 4LFTA 1FFJA 4FAOE 1KFHA 1JBDA 1KU6B 1M9ZA 1TXAA 2MJYA 1CCQA 3KFDE 2I9BE 1LX5B 1RGJA 2H64B 3QB4B 2NBTA 1PLOA 1LSIA 1CXNA 2L03A 1CVOA 4BIKB 2QJAC 1V6PA 1VB0A 1QKDA 1NEAA 1HOYA 2LCRA 5IMTD 1CTXA 2BTXA 1IKCA 1FASA 1IDLA 1KC4A 1CDQA 1TGXA 1LXHA 2BHIA 1KBTA 1IK8A 1ABTA 1CODA 3EBXA 1BXPA 1KXIA 1IDGA 2LA1A 4OM4A 2CTXA 4EY8B 1HAJA 1CDTA 1HC9B 2FD6U 3U74U 2GOOB 1KTZB 5IMYC 1CDRA 1NXBA 3EVSC 2JVEA 6EBXA 1I02A 1MAHF 1JGKA 2UX2A 3ERAA 4UY2C 1IQ9A 1ZADA 5DU1A 1REWC 1ERGA 3PLCA
chains in the Genus database with same CATH superfamily
1RL5A 1LXGA 3NDSA 1FRAA 1W6BA 1YWHA 4RUDA 2L5SA 3HH7A 1IJCA 2OFSA 5DO6A 1NORA 2H5FA 2PJYB 2CRTA 1XT3A 2HLRA 1IDIA 2K3GA 1QM7A 2JQPA 4OM5A 1QKEA 1H0JA 1IDHA 2CRSA 1F94A 1CXOA 2QJ9C 2MJ4A 1F8UB 4IYEA 1FSSB 1KBSA 1UG4A 4DO8A 2MUPA 2N99A 3NH7A 1FSCA 4FAOC 2MFAA 1G6MA 3VTSA 4BDTB 2UWRA 2VLWA 4XJJA 3BT1U 1COEA 3BT2U 1MR6A 1NTXA 2H8UA 2X8BB 1TFSA 1NYSA 2QJBC 3FEVA 2CCXA 1CRFA 2H7ZB 4AEAA 1HC9A 2ERAA 3KFDI 1TXBA 5DZ5A 2GOOC 4QTIU 2CDXA 4ZQYA 1KL8A 1DRSA 1ES7B 2H64C 2MHYA 2H62D 2QC1A 3NEQA 1S4YA 4HQPF 2J8BA 1CREA 1FF4A 2H62C 4P7UA 1B41B 3U73U 4KSNA 5EBXA 2MUOA 1NYUA 1ONJA 2H7ZA 3LAQU 2PJYC 1CB9A 1KS6A 1BTEA 1LJZA 1CHVS 2HLQA 1CDSA 1JE9A 1HAAA 2MJ0A 1ERAA 1KBAA 2ABXA 1NTNA 1L4WA 4LFTA 1FFJA 4FAOE 1KFHA 1JBDA 1KU6B 1M9ZA 1TXAA 2MJYA 1CCQA 3KFDE 2I9BE 1LX5B 1RGJA 2H64B 3QB4B 2NBTA 1PLOA 1LSIA 1CXNA 2L03A 1CVOA 4BIKB 2QJAC 1V6PA 1VB0A 1QKDA 1NEAA 1HOYA 2LCRA 5IMTD 1CTXA 2BTXA 1IKCA 1FASA 1IDLA 1KC4A 1CDQA 1TGXA 1LXHA 2BHIA 1KBTA 1IK8A 1ABTA 1CODA 3EBXA 1BXPA 1KXIA 1IDGA 2LA1A 4OM4A 2CTXA 4EY8B 1HAJA 1CDTA 1HC9B 2FD6U 3U74U 2GOOB 1KTZB 5IMYC 1CDRA 1NXBA 3EVSC 2JVEA 6EBXA 1I02A 1MAHF 1JGKA 2UX2A 3ERAA 4UY2C 1IQ9A 1ZADA 5DU1A 1REWC 1ERGA 3PLCA
chains in the Genus database with same CATH topology
1RL5A 1LXGA 3NDSA 1FRAA 1W6BA 1YWHA 4RUDA 2L5SA 3HH7A 1IJCA 2OFSA 5DO6A 1NORA 2H5FA 2PJYB 2CRTA 1XT3A 2HLRA 1IDIA 2K3GA 1QM7A 2JQPA 4OM5A 1QKEA 1H0JA 1IDHA 2CRSA 1F94A 1CXOA 2QJ9C 2MJ4A 1F8UB 4IYEA 1FSSB 1KBSA 1UG4A 4DO8A 2MUPA 2N99A 3NH7A 1FSCA 4FAOC 2MFAA 1G6MA 3VTSA 4BDTB 2UWRA 2VLWA 4XJJA 3BT1U 1COEA 3BT2U 1MR6A 1NTXA 2H8UA 2X8BB 1TFSA 1NYSA 2QJBC 3FEVA 2CCXA 1CRFA 2H7ZB 4AEAA 1HC9A 2ERAA 3KFDI 1TXBA 5DZ5A 2GOOC 4QTIU 2CDXA 4ZQYA 1KL8A 1DRSA 1ES7B 2H64C 2MHYA 2H62D 2QC1A 3NEQA 1S4YA 4HQPF 2J8BA 1CREA 1FF4A 2H62C 4P7UA 1B41B 3U73U 4KSNA 5EBXA 2MUOA 1NYUA 1ONJA 2H7ZA 3LAQU 2PJYC 1CB9A 1KS6A 1BTEA 1LJZA 1CHVS 2HLQA 1CDSA 1JE9A 1HAAA 2MJ0A 1ERAA 1KBAA 2ABXA 1NTNA 1L4WA 4LFTA 1FFJA 4FAOE 1KFHA 1JBDA 1KU6B 1M9ZA 1TXAA 2MJYA 1CCQA 3KFDE 2I9BE 1LX5B 1RGJA 2H64B 3QB4B 2NBTA 1PLOA 1LSIA 1CXNA 2L03A 1CVOA 4BIKB 2QJAC 1V6PA 1VB0A 1QKDA 1NEAA 1HOYA 2LCRA 5IMTD 1CTXA 2BTXA 1IKCA 1FASA 1IDLA 1KC4A 1CDQA 1TGXA 1LXHA 2BHIA 1KBTA 1IK8A 1ABTA 1CODA 3EBXA 1BXPA 1KXIA 1IDGA 2LA1A 4OM4A 2CTXA 4EY8B 1HAJA 1CDTA 1HC9B 2FD6U 3U74U 2GOOB 1KTZB 5IMYC 1CDRA 1NXBA 3EVSC 2JVEA 6EBXA 1I02A 1MAHF 1JGKA 2UX2A 3ERAA 4UY2C 1IQ9A 1ZADA 5DU1A 1REWC 1ERGA 3PLCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RL5 A;  1LXG A;  3NDS A;  1FRA A;  1W6B A;  1YWH A;  4RUD A;  2L5S A;  3HH7 A;  1IJC A;  2OFS A;  5DO6 A;  1NOR A;  2H5F A;  2PJY B;  2CRT A;  1XT3 A;  2HLR A;  1IDI A;  2K3G A;  1QM7 A;  2JQP A;  4OM5 A;  1QKE A;  1H0J A;  1IDH A;  2CRS A;  1F94 A;  1CXO A;  2QJ9 C;  2MJ4 A;  1F8U B;  4IYE A;  1FSS B;  1KBS A;  1UG4 A;  4DO8 A;  2MUP A;  2N99 A;  3NH7 A;  1FSC A;  4FAO C;  2MFA A;  1G6M A;  3VTS A;  4BDT B;  2UWR A;  2VLW A;  4XJJ A;  3BT1 U;  1COE A;  3BT2 U;  1MR6 A;  1NTX A;  2H8U A;  2X8B B;  1TFS A;  1NYS A;  2QJB C;  3FEV A;  2CCX A;  1CRF A;  2H7Z B;  4AEA A;  1HC9 A;  2ERA A;  3KFD I;  1TXB A;  5DZ5 A;  2GOO C;  4QTI U;  2CDX A;  4ZQY A;  1KL8 A;  1DRS A;  1ES7 B;  2H64 C;  2MHY A;  2H62 D;  2QC1 A;  3NEQ A;  1S4Y A;  4HQP F;  2J8B A;  1CRE A;  1FF4 A;  2H62 C;  4P7U A;  1B41 B;  3U73 U;  5EBX A;  2MUO A;  1NYU A;  1ONJ A;  2H7Z A;  3LAQ U;  2PJY C;  1CB9 A;  1KS6 A;  1BTE A;  1LJZ A;  1CHV S;  2HLQ A;  1CDS A;  1JE9 A;  1HAA A;  2MJ0 A;  1ERA A;  1KBA A;  2ABX A;  1NTN A;  1L4W A;  4LFT A;  1FFJ A;  4FAO E;  1KFH A;  1JBD A;  1KU6 B;  1M9Z A;  1TXA A;  2MJY A;  1CCQ A;  3KFD E;  2I9B E;  1LX5 B;  1RGJ A;  2H64 B;  3QB4 B;  2NBT A;  1PLO A;  1LSI A;  1CXN A;  2L03 A;  1CVO A;  4BIK B;  2QJA C;  1V6P A;  1VB0 A;  1QKD A;  1NEA A;  1HOY A;  2LCR A;  5IMT D;  1CTX A;  2BTX A;  1IKC A;  1FAS A;  1IDL A;  1KC4 A;  1CDQ A;  1TGX A;  1LXH A;  2BHI A;  1KBT A;  1IK8 A;  1ABT A;  1COD A;  3EBX A;  1BXP A;  1KXI A;  1IDG A;  2LA1 A;  4OM4 A;  2CTX A;  4EY8 B;  1HAJ A;  1CDT A;  1HC9 B;  2FD6 U;  3U74 U;  2GOO B;  1KTZ B;  5IMY C;  1CDR A;  1NXB A;  3EVS C;  2JVE A;  6EBX A;  1I02 A;  1MAH F;  1JGK A;  2UX2 A;  3ERA A;  4UY2 C;  1IQ9 A;  1ZAD A;  5DU1 A;  1REW C;  1ERG A;  3PLC A; 
#chains in the Genus database with same CATH topology
 1RL5 A;  1LXG A;  3NDS A;  1FRA A;  1W6B A;  1YWH A;  4RUD A;  2L5S A;  3HH7 A;  1IJC A;  2OFS A;  5DO6 A;  1NOR A;  2H5F A;  2PJY B;  2CRT A;  1XT3 A;  2HLR A;  1IDI A;  2K3G A;  1QM7 A;  2JQP A;  4OM5 A;  1QKE A;  1H0J A;  1IDH A;  2CRS A;  1F94 A;  1CXO A;  2QJ9 C;  2MJ4 A;  1F8U B;  4IYE A;  1FSS B;  1KBS A;  1UG4 A;  4DO8 A;  2MUP A;  2N99 A;  3NH7 A;  1FSC A;  4FAO C;  2MFA A;  1G6M A;  3VTS A;  4BDT B;  2UWR A;  2VLW A;  4XJJ A;  3BT1 U;  1COE A;  3BT2 U;  1MR6 A;  1NTX A;  2H8U A;  2X8B B;  1TFS A;  1NYS A;  2QJB C;  3FEV A;  2CCX A;  1CRF A;  2H7Z B;  4AEA A;  1HC9 A;  2ERA A;  3KFD I;  1TXB A;  5DZ5 A;  2GOO C;  4QTI U;  2CDX A;  4ZQY A;  1KL8 A;  1DRS A;  1ES7 B;  2H64 C;  2MHY A;  2H62 D;  2QC1 A;  3NEQ A;  1S4Y A;  4HQP F;  2J8B A;  1CRE A;  1FF4 A;  2H62 C;  4P7U A;  1B41 B;  3U73 U;  4KSN A;  5EBX A;  2MUO A;  1NYU A;  1ONJ A;  2H7Z A;  3LAQ U;  2PJY C;  1CB9 A;  1KS6 A;  1BTE A;  1LJZ A;  1CHV S;  2HLQ A;  1CDS A;  1JE9 A;  1HAA A;  2MJ0 A;  1ERA A;  1KBA A;  2ABX A;  1NTN A;  1L4W A;  4LFT A;  1FFJ A;  4FAO E;  1KFH A;  1JBD A;  1KU6 B;  1M9Z A;  1TXA A;  2MJY A;  1CCQ A;  3KFD E;  2I9B E;  1LX5 B;  1RGJ A;  2H64 B;  3QB4 B;  2NBT A;  1PLO A;  1LSI A;  1CXN A;  2L03 A;  1CVO A;  4BIK B;  2QJA C;  1V6P A;  1VB0 A;  1QKD A;  1NEA A;  1HOY A;  2LCR A;  5IMT D;  1CTX A;  2BTX A;  1IKC A;  1FAS A;  1IDL A;  1KC4 A;  1CDQ A;  1TGX A;  1LXH A;  2BHI A;  1KBT A;  1IK8 A;  1ABT A;  1COD A;  3EBX A;  1BXP A;  1KXI A;  1IDG A;  2LA1 A;  4OM4 A;  2CTX A;  4EY8 B;  1HAJ A;  1CDT A;  1HC9 B;  2FD6 U;  3U74 U;  2GOO B;  1KTZ B;  5IMY C;  1CDR A;  1NXB A;  3EVS C;  2JVE A;  6EBX A;  1I02 A;  1MAH F;  1JGK A;  2UX2 A;  3ERA A;  4UY2 C;  1IQ9 A;  1ZAD A;  5DU1 A;  1REW C;  1ERG A;  3PLC A; 
#chains in the Genus database with same CATH homology
 1RL5 A;  1LXG A;  3NDS A;  1FRA A;  1W6B A;  1YWH A;  4RUD A;  2L5S A;  3HH7 A;  1IJC A;  2OFS A;  5DO6 A;  1NOR A;  2H5F A;  2PJY B;  2CRT A;  1XT3 A;  2HLR A;  1IDI A;  2K3G A;  1QM7 A;  2JQP A;  4OM5 A;  1QKE A;  1H0J A;  1IDH A;  2CRS A;  1F94 A;  1CXO A;  2QJ9 C;  2MJ4 A;  1F8U B;  4IYE A;  1FSS B;  1KBS A;  1UG4 A;  4DO8 A;  2MUP A;  2N99 A;  3NH7 A;  1FSC A;  4FAO C;  2MFA A;  1G6M A;  3VTS A;  4BDT B;  2UWR A;  2VLW A;  4XJJ A;  3BT1 U;  1COE A;  3BT2 U;  1MR6 A;  1NTX A;  2H8U A;  2X8B B;  1TFS A;  1NYS A;  2QJB C;  3FEV A;  2CCX A;  1CRF A;  2H7Z B;  4AEA A;  1HC9 A;  2ERA A;  3KFD I;  1TXB A;  5DZ5 A;  2GOO C;  4QTI U;  2CDX A;  4ZQY A;  1KL8 A;  1DRS A;  1ES7 B;  2H64 C;  2MHY A;  2H62 D;  2QC1 A;  3NEQ A;  1S4Y A;  4HQP F;  2J8B A;  1CRE A;  1FF4 A;  2H62 C;  4P7U A;  1B41 B;  3U73 U;  4KSN A;  5EBX A;  2MUO A;  1NYU A;  1ONJ A;  2H7Z A;  3LAQ U;  2PJY C;  1CB9 A;  1KS6 A;  1BTE A;  1LJZ A;  1CHV S;  2HLQ A;  1CDS A;  1JE9 A;  1HAA A;  2MJ0 A;  1ERA A;  1KBA A;  2ABX A;  1NTN A;  1L4W A;  4LFT A;  1FFJ A;  4FAO E;  1KFH A;  1JBD A;  1KU6 B;  1M9Z A;  1TXA A;  2MJY A;  1CCQ A;  3KFD E;  2I9B E;  1LX5 B;  1RGJ A;  2H64 B;  3QB4 B;  2NBT A;  1PLO A;  1LSI A;  1CXN A;  2L03 A;  1CVO A;  4BIK B;  2QJA C;  1V6P A;  1VB0 A;  1QKD A;  1NEA A;  1HOY A;  2LCR A;  5IMT D;  1CTX A;  2BTX A;  1IKC A;  1FAS A;  1IDL A;  1KC4 A;  1CDQ A;  1TGX A;  1LXH A;  2BHI A;  1KBT A;  1IK8 A;  1ABT A;  1COD A;  3EBX A;  1BXP A;  1KXI A;  1IDG A;  2LA1 A;  4OM4 A;  2CTX A;  4EY8 B;  1HAJ A;  1CDT A;  1HC9 B;  2FD6 U;  3U74 U;  2GOO B;  1KTZ B;  5IMY C;  1CDR A;  1NXB A;  3EVS C;  2JVE A;  6EBX A;  1I02 A;  1MAH F;  1JGK A;  2UX2 A;  3ERA A;  4UY2 C;  1IQ9 A;  1ZAD A;  5DU1 A;  1REW C;  1ERG A;  3PLC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...