1H0JA

Structural basis of the membrane-induced cardiotoxin a3 oligomerization
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
60
structure length
60
Chain Sequence
LKCNKLVPLFYKTCPAGKNLCYKMFMVATPKVPVKRGCIDVCPKSSLLVKYVCCNTDRCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CARDIOTOXIN-3
publication title Structural Basis of Membrane-Induced Cardiotoxin A3 Oligomerization
pubmed doi rcsb
molecule tags Cardiotoxin
total genus 11
structure length 60
sequence length 60
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2002-06-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1h0jA00
5DZ5A 4OM5A 1ERAA 2L5SA 2H5FA 1XT3A 1TXBA 1ES7B 2MJYA 1FASA 4AEAA 1KBSA 3KFDE 1F8UB 1QKEA 1HOYA 2CRSA 3NH7A 2CCXA 2MFAA 1ABTA 3U73U 2CDXA 3QB4B 2HLRA 2QJ9C 1JE9A 1CDTA 1NEAA 1H0JA 2X8BB 1LXHA 1KTZB 1NYSA 1HC9A 4P7UA 1IJCA 2MJ0A 5IMTD 3FEVA 1ZADA 1JBDA 4FAOE 2H62D 2CRTA 2H8UA 2H64C 1S4YA 4FAOC 1TXAA 1B41B 3VTSA 1IK8A 1CXNA 2NBTA 1HAJA 1KXIA 1QKDA 1BXPA 2N99A 3KFDI 2PJYC 3PLCA 2CTXA 2OFSA 1IQ9A 1TFSA 2LCRA 4BIKB 2VLWA 3EBXA 1KBTA 1FSSB 2GOOC 2J8BA 2H64B 2QJAC 6EBXA 1KS6A 3NEQA 2LA1A 1CDSA 5DO6A 1NTXA 4QTIU 1CB9A 5EBXA 1LJZA 1VB0A 1CDQA 1FFJA 1NYUA 1L4WA 1LSIA 1MAHF 1YWHA 1PLOA 1RL5A 3BT1U 1IDLA 1CRFA 2I9BE 4EY8B 4BDTB 2MUPA 3HH7A 1IKCA 4HQPF 2QJBC 1LX5B 1FF4A 1G6MA 2H7ZB 2UX2A 1KL8A 2BTXA 1M9ZA 1NORA 3EVSC 1HAAA 1CCQA 1ONJA 1REWC 1W6BA 1UG4A 2MHYA 2JVEA 1LXGA 1CVOA 1KC4A 1JGKA 1RGJA 3ERAA 1I02A 3BT2U 2ABXA 1CTXA 3NDSA 1CXOA 4XJJA 1F94A 1CODA 4LFTA 2K3GA 1MR6A 1V6PA 2MJ4A 1COEA 1KFHA 1BTEA 1IDHA 2PJYB 1TGXA 1FRAA 1NXBA 4ZQYA 1FSCA 1HC9B 4IYEA 2FD6U 1IDIA 1KBAA 2UWRA 3U74U 2GOOB 1NTNA 4RUDA 4UY2C 2QC1A 1ERGA 4DO8A 1CHVS 1QM7A 1IDGA 1KU6B 2H62C 5DU1A 5IMYC 1CREA 1DRSA 2JQPA 2MUOA 2H7ZA 2BHIA 2L03A 2HLQA 1CDRA 2ERAA 3LAQU 4OM4A
chains in the Genus database with same CATH superfamily
5DZ5A 4OM5A 1ERAA 2L5SA 2H5FA 1XT3A 1TXBA 1ES7B 2MJYA 1FASA 4AEAA 1KBSA 3KFDE 1F8UB 1QKEA 1HOYA 2CRSA 3NH7A 2CCXA 2MFAA 1ABTA 3U73U 2CDXA 3QB4B 2HLRA 2QJ9C 1JE9A 1CDTA 1NEAA 1H0JA 2X8BB 1LXHA 1KTZB 1NYSA 1HC9A 4P7UA 1IJCA 2MJ0A 5IMTD 3FEVA 1ZADA 1JBDA 4FAOE 2H62D 2CRTA 2H8UA 2H64C 1S4YA 4FAOC 1TXAA 1B41B 3VTSA 1IK8A 1CXNA 2NBTA 1HAJA 1KXIA 1QKDA 1BXPA 2N99A 3KFDI 2PJYC 3PLCA 2CTXA 2OFSA 1IQ9A 1TFSA 2LCRA 4BIKB 2VLWA 3EBXA 1KBTA 1FSSB 2GOOC 2J8BA 2H64B 2QJAC 6EBXA 1KS6A 3NEQA 2LA1A 1CDSA 5DO6A 1NTXA 4QTIU 1CB9A 5EBXA 1LJZA 1VB0A 1CDQA 1FFJA 1NYUA 1L4WA 1LSIA 1MAHF 1YWHA 1PLOA 1RL5A 3BT1U 1IDLA 1CRFA 2I9BE 4EY8B 4BDTB 2MUPA 3HH7A 1IKCA 4HQPF 2QJBC 1LX5B 1FF4A 1G6MA 2H7ZB 2UX2A 1KL8A 2BTXA 1M9ZA 1NORA 3EVSC 1HAAA 1CCQA 1ONJA 1REWC 1W6BA 1UG4A 2MHYA 2JVEA 1LXGA 1CVOA 1KC4A 1JGKA 1RGJA 3ERAA 1I02A 3BT2U 2ABXA 1CTXA 3NDSA 1CXOA 4XJJA 1F94A 1CODA 4LFTA 2K3GA 1MR6A 1V6PA 2MJ4A 1COEA 1KFHA 1BTEA 1IDHA 2PJYB 1TGXA 1FRAA 1NXBA 4ZQYA 1FSCA 1HC9B 4IYEA 2FD6U 1IDIA 1KBAA 2UWRA 3U74U 2GOOB 1NTNA 4RUDA 4UY2C 2QC1A 1ERGA 4DO8A 1CHVS 1QM7A 1IDGA 4KSNA 1KU6B 2H62C 5DU1A 5IMYC 1CREA 1DRSA 2JQPA 2MUOA 2H7ZA 2BHIA 2L03A 2HLQA 1CDRA 2ERAA 3LAQU 4OM4A
chains in the Genus database with same CATH topology
5DZ5A 4OM5A 1ERAA 2L5SA 2H5FA 1XT3A 1TXBA 1ES7B 2MJYA 1FASA 4AEAA 1KBSA 3KFDE 1F8UB 1QKEA 1HOYA 2CRSA 3NH7A 2CCXA 2MFAA 1ABTA 3U73U 2CDXA 3QB4B 2HLRA 2QJ9C 1JE9A 1CDTA 1NEAA 1H0JA 2X8BB 1LXHA 1KTZB 1NYSA 1HC9A 4P7UA 1IJCA 2MJ0A 5IMTD 3FEVA 1ZADA 1JBDA 4FAOE 2H62D 2CRTA 2H8UA 2H64C 1S4YA 4FAOC 1TXAA 1B41B 3VTSA 1IK8A 1CXNA 2NBTA 1HAJA 1KXIA 1QKDA 1BXPA 2N99A 3KFDI 2PJYC 3PLCA 2CTXA 2OFSA 1IQ9A 1TFSA 2LCRA 4BIKB 2VLWA 3EBXA 1KBTA 1FSSB 2GOOC 2J8BA 2H64B 2QJAC 6EBXA 1KS6A 3NEQA 2LA1A 1CDSA 5DO6A 1NTXA 4QTIU 1CB9A 5EBXA 1LJZA 1VB0A 1CDQA 1FFJA 1NYUA 1L4WA 1LSIA 1MAHF 1YWHA 1PLOA 1RL5A 3BT1U 1IDLA 1CRFA 2I9BE 4EY8B 4BDTB 2MUPA 3HH7A 1IKCA 4HQPF 2QJBC 1LX5B 1FF4A 1G6MA 2H7ZB 2UX2A 1KL8A 2BTXA 1M9ZA 1NORA 3EVSC 1HAAA 1CCQA 1ONJA 1REWC 1W6BA 1UG4A 2MHYA 2JVEA 1LXGA 1CVOA 1KC4A 1JGKA 1RGJA 3ERAA 1I02A 3BT2U 2ABXA 1CTXA 3NDSA 1CXOA 4XJJA 1F94A 1CODA 4LFTA 2K3GA 1MR6A 1V6PA 2MJ4A 1COEA 1KFHA 1BTEA 1IDHA 2PJYB 1TGXA 1FRAA 1NXBA 4ZQYA 1FSCA 1HC9B 4IYEA 2FD6U 1IDIA 1KBAA 2UWRA 3U74U 2GOOB 1NTNA 4RUDA 4UY2C 2QC1A 1ERGA 4DO8A 1CHVS 1QM7A 1IDGA 4KSNA 1KU6B 2H62C 5DU1A 5IMYC 1CREA 1DRSA 2JQPA 2MUOA 2H7ZA 2BHIA 2L03A 2HLQA 1CDRA 2ERAA 3LAQU 4OM4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DZ5 A;  4OM5 A;  1ERA A;  2L5S A;  2H5F A;  1XT3 A;  1TXB A;  1ES7 B;  2MJY A;  1FAS A;  4AEA A;  1KBS A;  3KFD E;  1F8U B;  1QKE A;  1HOY A;  2CRS A;  3NH7 A;  2CCX A;  2MFA A;  1ABT A;  3U73 U;  2CDX A;  3QB4 B;  2HLR A;  2QJ9 C;  1JE9 A;  1CDT A;  1NEA A;  1H0J A;  2X8B B;  1LXH A;  1KTZ B;  1NYS A;  1HC9 A;  4P7U A;  1IJC A;  2MJ0 A;  5IMT D;  3FEV A;  1ZAD A;  1JBD A;  4FAO E;  2H62 D;  2CRT A;  2H8U A;  2H64 C;  1S4Y A;  4FAO C;  1TXA A;  1B41 B;  3VTS A;  1IK8 A;  1CXN A;  2NBT A;  1HAJ A;  1KXI A;  1QKD A;  1BXP A;  2N99 A;  3KFD I;  2PJY C;  3PLC A;  2CTX A;  2OFS A;  1IQ9 A;  1TFS A;  2LCR A;  4BIK B;  2VLW A;  3EBX A;  1KBT A;  1FSS B;  2GOO C;  2J8B A;  2H64 B;  2QJA C;  6EBX A;  1KS6 A;  3NEQ A;  2LA1 A;  1CDS A;  5DO6 A;  1NTX A;  4QTI U;  1CB9 A;  5EBX A;  1LJZ A;  1VB0 A;  1CDQ A;  1FFJ A;  1NYU A;  1L4W A;  1LSI A;  1MAH F;  1YWH A;  1PLO A;  1RL5 A;  3BT1 U;  1IDL A;  1CRF A;  2I9B E;  4EY8 B;  4BDT B;  2MUP A;  3HH7 A;  1IKC A;  4HQP F;  2QJB C;  1LX5 B;  1FF4 A;  1G6M A;  2H7Z B;  2UX2 A;  1KL8 A;  2BTX A;  1M9Z A;  1NOR A;  3EVS C;  1HAA A;  1CCQ A;  1ONJ A;  1REW C;  1W6B A;  1UG4 A;  2MHY A;  2JVE A;  1LXG A;  1CVO A;  1KC4 A;  1JGK A;  1RGJ A;  3ERA A;  1I02 A;  3BT2 U;  2ABX A;  1CTX A;  3NDS A;  1CXO A;  4XJJ A;  1F94 A;  1COD A;  4LFT A;  2K3G A;  1MR6 A;  1V6P A;  2MJ4 A;  1COE A;  1KFH A;  1BTE A;  1IDH A;  2PJY B;  1TGX A;  1FRA A;  1NXB A;  4ZQY A;  1FSC A;  1HC9 B;  4IYE A;  2FD6 U;  1IDI A;  1KBA A;  2UWR A;  3U74 U;  2GOO B;  1NTN A;  4RUD A;  4UY2 C;  2QC1 A;  1ERG A;  4DO8 A;  1CHV S;  1QM7 A;  1IDG A;  1KU6 B;  2H62 C;  5DU1 A;  5IMY C;  1CRE A;  1DRS A;  2JQP A;  2MUO A;  2H7Z A;  2BHI A;  2L03 A;  2HLQ A;  1CDR A;  2ERA A;  3LAQ U;  4OM4 A; 
#chains in the Genus database with same CATH topology
 5DZ5 A;  4OM5 A;  1ERA A;  2L5S A;  2H5F A;  1XT3 A;  1TXB A;  1ES7 B;  2MJY A;  1FAS A;  4AEA A;  1KBS A;  3KFD E;  1F8U B;  1QKE A;  1HOY A;  2CRS A;  3NH7 A;  2CCX A;  2MFA A;  1ABT A;  3U73 U;  2CDX A;  3QB4 B;  2HLR A;  2QJ9 C;  1JE9 A;  1CDT A;  1NEA A;  1H0J A;  2X8B B;  1LXH A;  1KTZ B;  1NYS A;  1HC9 A;  4P7U A;  1IJC A;  2MJ0 A;  5IMT D;  3FEV A;  1ZAD A;  1JBD A;  4FAO E;  2H62 D;  2CRT A;  2H8U A;  2H64 C;  1S4Y A;  4FAO C;  1TXA A;  1B41 B;  3VTS A;  1IK8 A;  1CXN A;  2NBT A;  1HAJ A;  1KXI A;  1QKD A;  1BXP A;  2N99 A;  3KFD I;  2PJY C;  3PLC A;  2CTX A;  2OFS A;  1IQ9 A;  1TFS A;  2LCR A;  4BIK B;  2VLW A;  3EBX A;  1KBT A;  1FSS B;  2GOO C;  2J8B A;  2H64 B;  2QJA C;  6EBX A;  1KS6 A;  3NEQ A;  2LA1 A;  1CDS A;  5DO6 A;  1NTX A;  4QTI U;  1CB9 A;  5EBX A;  1LJZ A;  1VB0 A;  1CDQ A;  1FFJ A;  1NYU A;  1L4W A;  1LSI A;  1MAH F;  1YWH A;  1PLO A;  1RL5 A;  3BT1 U;  1IDL A;  1CRF A;  2I9B E;  4EY8 B;  4BDT B;  2MUP A;  3HH7 A;  1IKC A;  4HQP F;  2QJB C;  1LX5 B;  1FF4 A;  1G6M A;  2H7Z B;  2UX2 A;  1KL8 A;  2BTX A;  1M9Z A;  1NOR A;  3EVS C;  1HAA A;  1CCQ A;  1ONJ A;  1REW C;  1W6B A;  1UG4 A;  2MHY A;  2JVE A;  1LXG A;  1CVO A;  1KC4 A;  1JGK A;  1RGJ A;  3ERA A;  1I02 A;  3BT2 U;  2ABX A;  1CTX A;  3NDS A;  1CXO A;  4XJJ A;  1F94 A;  1COD A;  4LFT A;  2K3G A;  1MR6 A;  1V6P A;  2MJ4 A;  1COE A;  1KFH A;  1BTE A;  1IDH A;  2PJY B;  1TGX A;  1FRA A;  1NXB A;  4ZQY A;  1FSC A;  1HC9 B;  4IYE A;  2FD6 U;  1IDI A;  1KBA A;  2UWR A;  3U74 U;  2GOO B;  1NTN A;  4RUD A;  4UY2 C;  2QC1 A;  1ERG A;  4DO8 A;  1CHV S;  1QM7 A;  1IDG A;  4KSN A;  1KU6 B;  2H62 C;  5DU1 A;  5IMY C;  1CRE A;  1DRS A;  2JQP A;  2MUO A;  2H7Z A;  2BHI A;  2L03 A;  2HLQ A;  1CDR A;  2ERA A;  3LAQ U;  4OM4 A; 
#chains in the Genus database with same CATH homology
 5DZ5 A;  4OM5 A;  1ERA A;  2L5S A;  2H5F A;  1XT3 A;  1TXB A;  1ES7 B;  2MJY A;  1FAS A;  4AEA A;  1KBS A;  3KFD E;  1F8U B;  1QKE A;  1HOY A;  2CRS A;  3NH7 A;  2CCX A;  2MFA A;  1ABT A;  3U73 U;  2CDX A;  3QB4 B;  2HLR A;  2QJ9 C;  1JE9 A;  1CDT A;  1NEA A;  1H0J A;  2X8B B;  1LXH A;  1KTZ B;  1NYS A;  1HC9 A;  4P7U A;  1IJC A;  2MJ0 A;  5IMT D;  3FEV A;  1ZAD A;  1JBD A;  4FAO E;  2H62 D;  2CRT A;  2H8U A;  2H64 C;  1S4Y A;  4FAO C;  1TXA A;  1B41 B;  3VTS A;  1IK8 A;  1CXN A;  2NBT A;  1HAJ A;  1KXI A;  1QKD A;  1BXP A;  2N99 A;  3KFD I;  2PJY C;  3PLC A;  2CTX A;  2OFS A;  1IQ9 A;  1TFS A;  2LCR A;  4BIK B;  2VLW A;  3EBX A;  1KBT A;  1FSS B;  2GOO C;  2J8B A;  2H64 B;  2QJA C;  6EBX A;  1KS6 A;  3NEQ A;  2LA1 A;  1CDS A;  5DO6 A;  1NTX A;  4QTI U;  1CB9 A;  5EBX A;  1LJZ A;  1VB0 A;  1CDQ A;  1FFJ A;  1NYU A;  1L4W A;  1LSI A;  1MAH F;  1YWH A;  1PLO A;  1RL5 A;  3BT1 U;  1IDL A;  1CRF A;  2I9B E;  4EY8 B;  4BDT B;  2MUP A;  3HH7 A;  1IKC A;  4HQP F;  2QJB C;  1LX5 B;  1FF4 A;  1G6M A;  2H7Z B;  2UX2 A;  1KL8 A;  2BTX A;  1M9Z A;  1NOR A;  3EVS C;  1HAA A;  1CCQ A;  1ONJ A;  1REW C;  1W6B A;  1UG4 A;  2MHY A;  2JVE A;  1LXG A;  1CVO A;  1KC4 A;  1JGK A;  1RGJ A;  3ERA A;  1I02 A;  3BT2 U;  2ABX A;  1CTX A;  3NDS A;  1CXO A;  4XJJ A;  1F94 A;  1COD A;  4LFT A;  2K3G A;  1MR6 A;  1V6P A;  2MJ4 A;  1COE A;  1KFH A;  1BTE A;  1IDH A;  2PJY B;  1TGX A;  1FRA A;  1NXB A;  4ZQY A;  1FSC A;  1HC9 B;  4IYE A;  2FD6 U;  1IDI A;  1KBA A;  2UWR A;  3U74 U;  2GOO B;  1NTN A;  4RUD A;  4UY2 C;  2QC1 A;  1ERG A;  4DO8 A;  1CHV S;  1QM7 A;  1IDG A;  4KSN A;  1KU6 B;  2H62 C;  5DU1 A;  5IMY C;  1CRE A;  1DRS A;  2JQP A;  2MUO A;  2H7Z A;  2BHI A;  2L03 A;  2HLQ A;  1CDR A;  2ERA A;  3LAQ U;  4OM4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...