1FFJA

Nmr structure of cardiotoxin in dpc-micelle
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
60
structure length
60
Chain Sequence
LKCKKLVPLFSKTCPAGKNLCYKMFMVAAPHVPVKRGCIDVCPKSSLLVKYVCCNTDKCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords CYTOTOXIN 2
publication title Membrane binding motif of the P-type cardiotoxin.
pubmed doi rcsb
total genus 6
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2000-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1ffjA00
4IYEA 4UY2C 1L4WA 2JVEA 1ONJA 1ZADA 1KC4A 1KFHA 2BHIA 3ERAA 2VLWA 1IQ9A 1IKCA 2J8BA 1JBDA 5IMTD 4FAOC 4AEAA 1V6PA 1FASA 2CCXA 2LCRA 1G6MA 1HOYA 1NEAA 2L5SA 4BIKB 1KTZB 2PJYB 1IDGA 3EBXA 1KL8A 3EVSC 1BXPA 1CB9A 1DRSA 1UG4A 4ZQYA 2QC1A 2LA1A 1CXNA 1IDLA 1CRFA 2H7ZB 1CDSA 1LJZA 3LAQU 5DO6A 2MUPA 2GOOC 5DZ5A 1QKEA 3U74U 2H64C 3FEVA 2UWRA 1CODA 1MAHF 1KBTA 1QM7A 1RGJA 1I02A 1TGXA 2QJ9C 1LSIA 2MJ4A 4P7UA 1F94A 2H7ZA 1TXAA 4FAOE 1W6BA 3PLCA 1NYUA 1FSCA 1IDIA 2L03A 1M9ZA 2ERAA 2MHYA 2ABXA 1JGKA 1HAAA 2UX2A 1FFJA 1CXOA 1B41B 3KFDE 3QB4B 2PJYC 2H62C 1CDTA 4RUDA 1PLOA 1KS6A 2JQPA 2MJ0A 2CDXA 2FD6U 1NORA 2OFSA 2X8BB 1YWHA 1COEA 2CTXA 3BT1U 2CRTA 1BTEA 1NTXA 1HC9B 2H8UA 1CCQA 2MFAA 5EBXA 4QTIU 3NH7A 1ERAA 1FRAA 1LXGA 1NTNA 6EBXA 1CREA 1CTXA 1CDQA 1IJCA 1ABTA 4EY8B 1FF4A 5IMYC 2HLRA 1ES7B 4XJJA 2NBTA 2HLQA 1HC9A 1LXHA 1REWC 1ERGA 2MUOA 1IDHA 1LX5B 2I9BE 1TXBA 1CDRA 3VTSA 2H5FA 1IK8A 2QJAC 1HAJA 4BDTB 1JE9A 2BTXA 3NDSA 5DU1A 2QJBC 1KXIA 2H62D 4DO8A 1KBAA 3BT2U 1RL5A 1MR6A 4LFTA 1S4YA 1NYSA 3HH7A 1KBSA 4OM4A 4OM5A 1CVOA 1CHVS 3KFDI 1FSSB 1NXBA 2CRSA 3U73U 3NEQA 1F8UB 1XT3A 2GOOB 4HQPF 1KU6B 1H0JA 1QKDA 2H64B 1VB0A 1TFSA 2MJYA 2N99A 2K3GA
chains in the Genus database with same CATH superfamily
4IYEA 4UY2C 1L4WA 2JVEA 1ONJA 1ZADA 1KC4A 1KFHA 2BHIA 3ERAA 2VLWA 1IQ9A 1IKCA 2J8BA 1JBDA 5IMTD 4FAOC 4AEAA 1V6PA 1FASA 2CCXA 2LCRA 1G6MA 1HOYA 1NEAA 2L5SA 4BIKB 1KTZB 2PJYB 1IDGA 3EBXA 1KL8A 3EVSC 1BXPA 1CB9A 1DRSA 1UG4A 4ZQYA 2QC1A 2LA1A 1CXNA 1IDLA 1CRFA 2H7ZB 1CDSA 1LJZA 3LAQU 5DO6A 2MUPA 2GOOC 5DZ5A 1QKEA 3U74U 2H64C 3FEVA 2UWRA 1CODA 1MAHF 1KBTA 1QM7A 1RGJA 1I02A 1TGXA 2QJ9C 1LSIA 2MJ4A 4P7UA 1F94A 2H7ZA 1TXAA 4FAOE 1W6BA 3PLCA 1NYUA 1FSCA 1IDIA 2L03A 1M9ZA 2ERAA 2MHYA 2ABXA 1JGKA 1HAAA 2UX2A 1FFJA 1CXOA 1B41B 3KFDE 3QB4B 2PJYC 2H62C 1CDTA 4RUDA 1PLOA 1KS6A 2JQPA 4KSNA 2MJ0A 2CDXA 2FD6U 1NORA 2OFSA 2X8BB 1YWHA 1COEA 2CTXA 3BT1U 2CRTA 1BTEA 1NTXA 1HC9B 2H8UA 1CCQA 2MFAA 5EBXA 4QTIU 3NH7A 1ERAA 1FRAA 1LXGA 1NTNA 6EBXA 1CREA 1CTXA 1CDQA 1IJCA 1ABTA 4EY8B 1FF4A 5IMYC 2HLRA 1ES7B 4XJJA 2NBTA 2HLQA 1HC9A 1LXHA 1REWC 1ERGA 2MUOA 1IDHA 1LX5B 2I9BE 1TXBA 1CDRA 3VTSA 2H5FA 1IK8A 2QJAC 1HAJA 4BDTB 1JE9A 2BTXA 3NDSA 5DU1A 2QJBC 1KXIA 2H62D 4DO8A 1KBAA 3BT2U 1RL5A 1MR6A 4LFTA 1S4YA 1NYSA 3HH7A 1KBSA 4OM4A 4OM5A 1CVOA 1CHVS 3KFDI 1FSSB 1NXBA 2CRSA 3U73U 3NEQA 1F8UB 1XT3A 2GOOB 4HQPF 1KU6B 1H0JA 1QKDA 2H64B 1VB0A 1TFSA 2MJYA 2N99A 2K3GA
chains in the Genus database with same CATH topology
4IYEA 4UY2C 1L4WA 2JVEA 1ONJA 1ZADA 1KC4A 1KFHA 2BHIA 3ERAA 2VLWA 1IQ9A 1IKCA 2J8BA 1JBDA 5IMTD 4FAOC 4AEAA 1V6PA 1FASA 2CCXA 2LCRA 1G6MA 1HOYA 1NEAA 2L5SA 4BIKB 1KTZB 2PJYB 1IDGA 3EBXA 1KL8A 3EVSC 1BXPA 1CB9A 1DRSA 1UG4A 4ZQYA 2QC1A 2LA1A 1CXNA 1IDLA 1CRFA 2H7ZB 1CDSA 1LJZA 3LAQU 5DO6A 2MUPA 2GOOC 5DZ5A 1QKEA 3U74U 2H64C 3FEVA 2UWRA 1CODA 1MAHF 1KBTA 1QM7A 1RGJA 1I02A 1TGXA 2QJ9C 1LSIA 2MJ4A 4P7UA 1F94A 2H7ZA 1TXAA 4FAOE 1W6BA 3PLCA 1NYUA 1FSCA 1IDIA 2L03A 1M9ZA 2ERAA 2MHYA 2ABXA 1JGKA 1HAAA 2UX2A 1FFJA 1CXOA 1B41B 3KFDE 3QB4B 2PJYC 2H62C 1CDTA 4RUDA 1PLOA 1KS6A 2JQPA 4KSNA 2MJ0A 2CDXA 2FD6U 1NORA 2OFSA 2X8BB 1YWHA 1COEA 2CTXA 3BT1U 2CRTA 1BTEA 1NTXA 1HC9B 2H8UA 1CCQA 2MFAA 5EBXA 4QTIU 3NH7A 1ERAA 1FRAA 1LXGA 1NTNA 6EBXA 1CREA 1CTXA 1CDQA 1IJCA 1ABTA 4EY8B 1FF4A 5IMYC 2HLRA 1ES7B 4XJJA 2NBTA 2HLQA 1HC9A 1LXHA 1REWC 1ERGA 2MUOA 1IDHA 1LX5B 2I9BE 1TXBA 1CDRA 3VTSA 2H5FA 1IK8A 2QJAC 1HAJA 4BDTB 1JE9A 2BTXA 3NDSA 5DU1A 2QJBC 1KXIA 2H62D 4DO8A 1KBAA 3BT2U 1RL5A 1MR6A 4LFTA 1S4YA 1NYSA 3HH7A 1KBSA 4OM4A 4OM5A 1CVOA 1CHVS 3KFDI 1FSSB 1NXBA 2CRSA 3U73U 3NEQA 1F8UB 1XT3A 2GOOB 4HQPF 1KU6B 1H0JA 1QKDA 2H64B 1VB0A 1TFSA 2MJYA 2N99A 2K3GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IYE A;  4UY2 C;  1L4W A;  2JVE A;  1ONJ A;  1ZAD A;  1KC4 A;  1KFH A;  2BHI A;  3ERA A;  2VLW A;  1IQ9 A;  1IKC A;  2J8B A;  1JBD A;  5IMT D;  4FAO C;  4AEA A;  1V6P A;  1FAS A;  2CCX A;  2LCR A;  1G6M A;  1HOY A;  1NEA A;  2L5S A;  4BIK B;  1KTZ B;  2PJY B;  1IDG A;  3EBX A;  1KL8 A;  3EVS C;  1BXP A;  1CB9 A;  1DRS A;  1UG4 A;  4ZQY A;  2QC1 A;  2LA1 A;  1CXN A;  1IDL A;  1CRF A;  2H7Z B;  1CDS A;  1LJZ A;  3LAQ U;  5DO6 A;  2MUP A;  2GOO C;  5DZ5 A;  1QKE A;  3U74 U;  2H64 C;  3FEV A;  2UWR A;  1COD A;  1MAH F;  1KBT A;  1QM7 A;  1RGJ A;  1I02 A;  1TGX A;  2QJ9 C;  1LSI A;  2MJ4 A;  4P7U A;  1F94 A;  2H7Z A;  1TXA A;  4FAO E;  1W6B A;  3PLC A;  1NYU A;  1FSC A;  1IDI A;  2L03 A;  1M9Z A;  2ERA A;  2MHY A;  2ABX A;  1JGK A;  1HAA A;  2UX2 A;  1FFJ A;  1CXO A;  1B41 B;  3KFD E;  3QB4 B;  2PJY C;  2H62 C;  1CDT A;  4RUD A;  1PLO A;  1KS6 A;  2JQP A;  2MJ0 A;  2CDX A;  2FD6 U;  1NOR A;  2OFS A;  2X8B B;  1YWH A;  1COE A;  2CTX A;  3BT1 U;  2CRT A;  1BTE A;  1NTX A;  1HC9 B;  2H8U A;  1CCQ A;  2MFA A;  5EBX A;  4QTI U;  3NH7 A;  1ERA A;  1FRA A;  1LXG A;  1NTN A;  6EBX A;  1CRE A;  1CTX A;  1CDQ A;  1IJC A;  1ABT A;  4EY8 B;  1FF4 A;  5IMY C;  2HLR A;  1ES7 B;  4XJJ A;  2NBT A;  2HLQ A;  1HC9 A;  1LXH A;  1REW C;  1ERG A;  2MUO A;  1IDH A;  1LX5 B;  2I9B E;  1TXB A;  1CDR A;  3VTS A;  2H5F A;  1IK8 A;  2QJA C;  1HAJ A;  4BDT B;  1JE9 A;  2BTX A;  3NDS A;  5DU1 A;  2QJB C;  1KXI A;  2H62 D;  4DO8 A;  1KBA A;  3BT2 U;  1RL5 A;  1MR6 A;  4LFT A;  1S4Y A;  1NYS A;  3HH7 A;  1KBS A;  4OM4 A;  4OM5 A;  1CVO A;  1CHV S;  3KFD I;  1FSS B;  1NXB A;  2CRS A;  3U73 U;  3NEQ A;  1F8U B;  1XT3 A;  2GOO B;  4HQP F;  1KU6 B;  1H0J A;  1QKD A;  2H64 B;  1VB0 A;  1TFS A;  2MJY A;  2N99 A;  2K3G A; 
#chains in the Genus database with same CATH topology
 4IYE A;  4UY2 C;  1L4W A;  2JVE A;  1ONJ A;  1ZAD A;  1KC4 A;  1KFH A;  2BHI A;  3ERA A;  2VLW A;  1IQ9 A;  1IKC A;  2J8B A;  1JBD A;  5IMT D;  4FAO C;  4AEA A;  1V6P A;  1FAS A;  2CCX A;  2LCR A;  1G6M A;  1HOY A;  1NEA A;  2L5S A;  4BIK B;  1KTZ B;  2PJY B;  1IDG A;  3EBX A;  1KL8 A;  3EVS C;  1BXP A;  1CB9 A;  1DRS A;  1UG4 A;  4ZQY A;  2QC1 A;  2LA1 A;  1CXN A;  1IDL A;  1CRF A;  2H7Z B;  1CDS A;  1LJZ A;  3LAQ U;  5DO6 A;  2MUP A;  2GOO C;  5DZ5 A;  1QKE A;  3U74 U;  2H64 C;  3FEV A;  2UWR A;  1COD A;  1MAH F;  1KBT A;  1QM7 A;  1RGJ A;  1I02 A;  1TGX A;  2QJ9 C;  1LSI A;  2MJ4 A;  4P7U A;  1F94 A;  2H7Z A;  1TXA A;  4FAO E;  1W6B A;  3PLC A;  1NYU A;  1FSC A;  1IDI A;  2L03 A;  1M9Z A;  2ERA A;  2MHY A;  2ABX A;  1JGK A;  1HAA A;  2UX2 A;  1FFJ A;  1CXO A;  1B41 B;  3KFD E;  3QB4 B;  2PJY C;  2H62 C;  1CDT A;  4RUD A;  1PLO A;  1KS6 A;  2JQP A;  4KSN A;  2MJ0 A;  2CDX A;  2FD6 U;  1NOR A;  2OFS A;  2X8B B;  1YWH A;  1COE A;  2CTX A;  3BT1 U;  2CRT A;  1BTE A;  1NTX A;  1HC9 B;  2H8U A;  1CCQ A;  2MFA A;  5EBX A;  4QTI U;  3NH7 A;  1ERA A;  1FRA A;  1LXG A;  1NTN A;  6EBX A;  1CRE A;  1CTX A;  1CDQ A;  1IJC A;  1ABT A;  4EY8 B;  1FF4 A;  5IMY C;  2HLR A;  1ES7 B;  4XJJ A;  2NBT A;  2HLQ A;  1HC9 A;  1LXH A;  1REW C;  1ERG A;  2MUO A;  1IDH A;  1LX5 B;  2I9B E;  1TXB A;  1CDR A;  3VTS A;  2H5F A;  1IK8 A;  2QJA C;  1HAJ A;  4BDT B;  1JE9 A;  2BTX A;  3NDS A;  5DU1 A;  2QJB C;  1KXI A;  2H62 D;  4DO8 A;  1KBA A;  3BT2 U;  1RL5 A;  1MR6 A;  4LFT A;  1S4Y A;  1NYS A;  3HH7 A;  1KBS A;  4OM4 A;  4OM5 A;  1CVO A;  1CHV S;  3KFD I;  1FSS B;  1NXB A;  2CRS A;  3U73 U;  3NEQ A;  1F8U B;  1XT3 A;  2GOO B;  4HQP F;  1KU6 B;  1H0J A;  1QKD A;  2H64 B;  1VB0 A;  1TFS A;  2MJY A;  2N99 A;  2K3G A; 
#chains in the Genus database with same CATH homology
 4IYE A;  4UY2 C;  1L4W A;  2JVE A;  1ONJ A;  1ZAD A;  1KC4 A;  1KFH A;  2BHI A;  3ERA A;  2VLW A;  1IQ9 A;  1IKC A;  2J8B A;  1JBD A;  5IMT D;  4FAO C;  4AEA A;  1V6P A;  1FAS A;  2CCX A;  2LCR A;  1G6M A;  1HOY A;  1NEA A;  2L5S A;  4BIK B;  1KTZ B;  2PJY B;  1IDG A;  3EBX A;  1KL8 A;  3EVS C;  1BXP A;  1CB9 A;  1DRS A;  1UG4 A;  4ZQY A;  2QC1 A;  2LA1 A;  1CXN A;  1IDL A;  1CRF A;  2H7Z B;  1CDS A;  1LJZ A;  3LAQ U;  5DO6 A;  2MUP A;  2GOO C;  5DZ5 A;  1QKE A;  3U74 U;  2H64 C;  3FEV A;  2UWR A;  1COD A;  1MAH F;  1KBT A;  1QM7 A;  1RGJ A;  1I02 A;  1TGX A;  2QJ9 C;  1LSI A;  2MJ4 A;  4P7U A;  1F94 A;  2H7Z A;  1TXA A;  4FAO E;  1W6B A;  3PLC A;  1NYU A;  1FSC A;  1IDI A;  2L03 A;  1M9Z A;  2ERA A;  2MHY A;  2ABX A;  1JGK A;  1HAA A;  2UX2 A;  1FFJ A;  1CXO A;  1B41 B;  3KFD E;  3QB4 B;  2PJY C;  2H62 C;  1CDT A;  4RUD A;  1PLO A;  1KS6 A;  2JQP A;  4KSN A;  2MJ0 A;  2CDX A;  2FD6 U;  1NOR A;  2OFS A;  2X8B B;  1YWH A;  1COE A;  2CTX A;  3BT1 U;  2CRT A;  1BTE A;  1NTX A;  1HC9 B;  2H8U A;  1CCQ A;  2MFA A;  5EBX A;  4QTI U;  3NH7 A;  1ERA A;  1FRA A;  1LXG A;  1NTN A;  6EBX A;  1CRE A;  1CTX A;  1CDQ A;  1IJC A;  1ABT A;  4EY8 B;  1FF4 A;  5IMY C;  2HLR A;  1ES7 B;  4XJJ A;  2NBT A;  2HLQ A;  1HC9 A;  1LXH A;  1REW C;  1ERG A;  2MUO A;  1IDH A;  1LX5 B;  2I9B E;  1TXB A;  1CDR A;  3VTS A;  2H5F A;  1IK8 A;  2QJA C;  1HAJ A;  4BDT B;  1JE9 A;  2BTX A;  3NDS A;  5DU1 A;  2QJB C;  1KXI A;  2H62 D;  4DO8 A;  1KBA A;  3BT2 U;  1RL5 A;  1MR6 A;  4LFT A;  1S4Y A;  1NYS A;  3HH7 A;  1KBS A;  4OM4 A;  4OM5 A;  1CVO A;  1CHV S;  3KFD I;  1FSS B;  1NXB A;  2CRS A;  3U73 U;  3NEQ A;  1F8U B;  1XT3 A;  2GOO B;  4HQP F;  1KU6 B;  1H0J A;  1QKD A;  2H64 B;  1VB0 A;  1TFS A;  2MJY A;  2N99 A;  2K3G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...