3FEVA

Crystal structure of the chimeric muscarinic toxin mt7 with loop 1 from mt1.
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
65
structure length
65
Chain Sequence
LTCVTSKSIFGITTENCPDGQNLCFKRWQYISPRMYDFTRGCAATCPKAEYRDVINCCGTDKCNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords Fusion of Muscarinic toxin 1, Muscarinic m1-toxin1
publication title Engineering of three-finger fold toxins creates ligands with original pharmacological profiles for muscarinic and adrenergic receptors.
pubmed doi rcsb
total genus 11
structure length 65
sequence length 65
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2008-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 3fevA00
2H62C 5DZ5A 1B41B 2BHIA 1KL8A 1YWHA 2H7ZB 1W6BA 3NDSA 2PJYB 1RL5A 2H64C 1CODA 1IDLA 3BT2U 2H5FA 4P7UA 1MR6A 1JGKA 4BDTB 2K3GA 2H62D 2MJ4A 3NH7A 1KC4A 1CXNA 1CDRA 5EBXA 1HC9B 1LXGA 1NTNA 1LJZA 3ERAA 1I02A 3EVSC 2GOOC 4UY2C 3KFDE 1LSIA 2NBTA 3U73U 4XJJA 4AEAA 1CRFA 1G6MA 1KTZB 1CXOA 4LFTA 1IK8A 1KFHA 1KS6A 1ZADA 1HC9A 1COEA 1CB9A 5IMYC 5DU1A 1NXBA 2L03A 1XT3A 1ONJA 2ABXA 4HQPF 6EBXA 1TFSA 2MUPA 1JE9A 1CCQA 1FRAA 1HAAA 1IDIA 4QTIU 2X8BB 1VB0A 1H0JA 2QJAC 3PLCA 2MJYA 2JVEA 3KFDI 4ZQYA 5IMTD 2LCRA 1TXAA 2BTXA 1FSSB 2MUOA 4OM5A 2MHYA 1MAHF 2HLRA 2VLWA 1ERAA 4EY8B 1KBAA 2FD6U 1TXBA 1F8UB 1CREA 1ERGA 1KXIA 2PJYC 2CTXA 1NEAA 1NYUA 2H64B 3HH7A 1NORA 1JBDA 2JQPA 2L5SA 3QB4B 1L4WA 4FAOC 4BIKB 2CCXA 4DO8A 1CDSA 4FAOE 4OM4A 1HAJA 1KBSA 1M9ZA 1RGJA 3LAQU 1KBTA 2QJBC 1CVOA 1QKEA 2ERAA 2GOOB 2CRSA 1CTXA 1FSCA 1HOYA 4IYEA 2N99A 1CHVS 1FASA 1CDTA 3EBXA 1BXPA 2I9BE 3NEQA 2UWRA 1ABTA 1V6PA 4RUDA 2QC1A 2LA1A 1CDQA 3BT1U 3U74U 1REWC 1FFJA 1LX5B 1IQ9A 1NTXA 2HLQA 1QKDA 2UX2A 1ES7B 2QJ9C 1S4YA 1QM7A 1NYSA 1PLOA 2CDXA 2MFAA 1KU6B 1BTEA 1UG4A 2CRTA 3FEVA 1IJCA 1DRSA 3VTSA 2H7ZA 1FF4A 1IDHA 1IDGA 5DO6A 1IKCA 2J8BA 1F94A 2MJ0A 2H8UA 1LXHA 1TGXA 2OFSA
chains in the Genus database with same CATH superfamily
2H62C 5DZ5A 1B41B 2BHIA 1KL8A 1YWHA 2H7ZB 1W6BA 3NDSA 2PJYB 1RL5A 2H64C 1CODA 1IDLA 3BT2U 2H5FA 4P7UA 1MR6A 1JGKA 4BDTB 2K3GA 2H62D 2MJ4A 3NH7A 1KC4A 1CXNA 1CDRA 5EBXA 1HC9B 1LXGA 1NTNA 1LJZA 3ERAA 1I02A 3EVSC 2GOOC 4UY2C 3KFDE 1LSIA 2NBTA 3U73U 4XJJA 4AEAA 1CRFA 1G6MA 1KTZB 1CXOA 4LFTA 1IK8A 1KFHA 1KS6A 1ZADA 1HC9A 1COEA 1CB9A 5IMYC 5DU1A 1NXBA 2L03A 1XT3A 1ONJA 2ABXA 4HQPF 6EBXA 1TFSA 2MUPA 1JE9A 1CCQA 1FRAA 1HAAA 1IDIA 4QTIU 2X8BB 1VB0A 1H0JA 2QJAC 3PLCA 2MJYA 2JVEA 3KFDI 4ZQYA 5IMTD 2LCRA 1TXAA 2BTXA 1FSSB 2MUOA 4OM5A 2MHYA 1MAHF 2HLRA 2VLWA 1ERAA 4EY8B 1KBAA 2FD6U 1TXBA 1F8UB 1CREA 1ERGA 1KXIA 2PJYC 2CTXA 1NEAA 1NYUA 2H64B 3HH7A 1NORA 1JBDA 2JQPA 2L5SA 3QB4B 1L4WA 4FAOC 4BIKB 2CCXA 4DO8A 1CDSA 4FAOE 4OM4A 1HAJA 1KBSA 1M9ZA 1RGJA 3LAQU 1KBTA 2QJBC 1CVOA 1QKEA 2ERAA 2GOOB 2CRSA 1CTXA 1FSCA 1HOYA 4IYEA 2N99A 1CHVS 1FASA 1CDTA 3EBXA 1BXPA 2I9BE 3NEQA 2UWRA 1ABTA 1V6PA 4KSNA 4RUDA 2QC1A 2LA1A 1CDQA 3BT1U 3U74U 1REWC 1FFJA 1LX5B 1IQ9A 1NTXA 2HLQA 1QKDA 2UX2A 1ES7B 2QJ9C 1S4YA 1QM7A 1NYSA 1PLOA 2CDXA 2MFAA 1KU6B 1BTEA 1UG4A 2CRTA 3FEVA 1IJCA 1DRSA 3VTSA 2H7ZA 1FF4A 1IDHA 1IDGA 5DO6A 1IKCA 2J8BA 1F94A 2MJ0A 2H8UA 1LXHA 1TGXA 2OFSA
chains in the Genus database with same CATH topology
2H62C 5DZ5A 1B41B 2BHIA 1KL8A 1YWHA 2H7ZB 1W6BA 3NDSA 2PJYB 1RL5A 2H64C 1CODA 1IDLA 3BT2U 2H5FA 4P7UA 1MR6A 1JGKA 4BDTB 2K3GA 2H62D 2MJ4A 3NH7A 1KC4A 1CXNA 1CDRA 5EBXA 1HC9B 1LXGA 1NTNA 1LJZA 3ERAA 1I02A 3EVSC 2GOOC 4UY2C 3KFDE 1LSIA 2NBTA 3U73U 4XJJA 4AEAA 1CRFA 1G6MA 1KTZB 1CXOA 4LFTA 1IK8A 1KFHA 1KS6A 1ZADA 1HC9A 1COEA 1CB9A 5IMYC 5DU1A 1NXBA 2L03A 1XT3A 1ONJA 2ABXA 4HQPF 6EBXA 1TFSA 2MUPA 1JE9A 1CCQA 1FRAA 1HAAA 1IDIA 4QTIU 2X8BB 1VB0A 1H0JA 2QJAC 3PLCA 2MJYA 2JVEA 3KFDI 4ZQYA 5IMTD 2LCRA 1TXAA 2BTXA 1FSSB 2MUOA 4OM5A 2MHYA 1MAHF 2HLRA 2VLWA 1ERAA 4EY8B 1KBAA 2FD6U 1TXBA 1F8UB 1CREA 1ERGA 1KXIA 2PJYC 2CTXA 1NEAA 1NYUA 2H64B 3HH7A 1NORA 1JBDA 2JQPA 2L5SA 3QB4B 1L4WA 4FAOC 4BIKB 2CCXA 4DO8A 1CDSA 4FAOE 4OM4A 1HAJA 1KBSA 1M9ZA 1RGJA 3LAQU 1KBTA 2QJBC 1CVOA 1QKEA 2ERAA 2GOOB 2CRSA 1CTXA 1FSCA 1HOYA 4IYEA 2N99A 1CHVS 1FASA 1CDTA 3EBXA 1BXPA 2I9BE 3NEQA 2UWRA 1ABTA 1V6PA 4KSNA 4RUDA 2QC1A 2LA1A 1CDQA 3BT1U 3U74U 1REWC 1FFJA 1LX5B 1IQ9A 1NTXA 2HLQA 1QKDA 2UX2A 1ES7B 2QJ9C 1S4YA 1QM7A 1NYSA 1PLOA 2CDXA 2MFAA 1KU6B 1BTEA 1UG4A 2CRTA 3FEVA 1IJCA 1DRSA 3VTSA 2H7ZA 1FF4A 1IDHA 1IDGA 5DO6A 1IKCA 2J8BA 1F94A 2MJ0A 2H8UA 1LXHA 1TGXA 2OFSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H62 C;  5DZ5 A;  1B41 B;  2BHI A;  1KL8 A;  1YWH A;  2H7Z B;  1W6B A;  3NDS A;  2PJY B;  1RL5 A;  2H64 C;  1COD A;  1IDL A;  3BT2 U;  2H5F A;  4P7U A;  1MR6 A;  1JGK A;  4BDT B;  2K3G A;  2H62 D;  2MJ4 A;  3NH7 A;  1KC4 A;  1CXN A;  1CDR A;  5EBX A;  1HC9 B;  1LXG A;  1NTN A;  1LJZ A;  3ERA A;  1I02 A;  3EVS C;  2GOO C;  4UY2 C;  3KFD E;  1LSI A;  2NBT A;  3U73 U;  4XJJ A;  4AEA A;  1CRF A;  1G6M A;  1KTZ B;  1CXO A;  4LFT A;  1IK8 A;  1KFH A;  1KS6 A;  1ZAD A;  1HC9 A;  1COE A;  1CB9 A;  5IMY C;  5DU1 A;  1NXB A;  2L03 A;  1XT3 A;  1ONJ A;  2ABX A;  4HQP F;  6EBX A;  1TFS A;  2MUP A;  1JE9 A;  1CCQ A;  1FRA A;  1HAA A;  1IDI A;  4QTI U;  2X8B B;  1VB0 A;  1H0J A;  2QJA C;  3PLC A;  2MJY A;  2JVE A;  3KFD I;  4ZQY A;  5IMT D;  2LCR A;  1TXA A;  2BTX A;  1FSS B;  2MUO A;  4OM5 A;  2MHY A;  1MAH F;  2HLR A;  2VLW A;  1ERA A;  4EY8 B;  1KBA A;  2FD6 U;  1TXB A;  1F8U B;  1CRE A;  1ERG A;  1KXI A;  2PJY C;  2CTX A;  1NEA A;  1NYU A;  2H64 B;  3HH7 A;  1NOR A;  1JBD A;  2JQP A;  2L5S A;  3QB4 B;  1L4W A;  4FAO C;  4BIK B;  2CCX A;  4DO8 A;  1CDS A;  4FAO E;  4OM4 A;  1HAJ A;  1KBS A;  1M9Z A;  1RGJ A;  3LAQ U;  1KBT A;  2QJB C;  1CVO A;  1QKE A;  2ERA A;  2GOO B;  2CRS A;  1CTX A;  1FSC A;  1HOY A;  4IYE A;  2N99 A;  1CHV S;  1FAS A;  1CDT A;  3EBX A;  1BXP A;  2I9B E;  3NEQ A;  2UWR A;  1ABT A;  1V6P A;  4RUD A;  2QC1 A;  2LA1 A;  1CDQ A;  3BT1 U;  3U74 U;  1REW C;  1FFJ A;  1LX5 B;  1IQ9 A;  1NTX A;  2HLQ A;  1QKD A;  2UX2 A;  1ES7 B;  2QJ9 C;  1S4Y A;  1QM7 A;  1NYS A;  1PLO A;  2CDX A;  2MFA A;  1KU6 B;  1BTE A;  1UG4 A;  2CRT A;  3FEV A;  1IJC A;  1DRS A;  3VTS A;  2H7Z A;  1FF4 A;  1IDH A;  1IDG A;  5DO6 A;  1IKC A;  2J8B A;  1F94 A;  2MJ0 A;  2H8U A;  1LXH A;  1TGX A;  2OFS A; 
#chains in the Genus database with same CATH topology
 2H62 C;  5DZ5 A;  1B41 B;  2BHI A;  1KL8 A;  1YWH A;  2H7Z B;  1W6B A;  3NDS A;  2PJY B;  1RL5 A;  2H64 C;  1COD A;  1IDL A;  3BT2 U;  2H5F A;  4P7U A;  1MR6 A;  1JGK A;  4BDT B;  2K3G A;  2H62 D;  2MJ4 A;  3NH7 A;  1KC4 A;  1CXN A;  1CDR A;  5EBX A;  1HC9 B;  1LXG A;  1NTN A;  1LJZ A;  3ERA A;  1I02 A;  3EVS C;  2GOO C;  4UY2 C;  3KFD E;  1LSI A;  2NBT A;  3U73 U;  4XJJ A;  4AEA A;  1CRF A;  1G6M A;  1KTZ B;  1CXO A;  4LFT A;  1IK8 A;  1KFH A;  1KS6 A;  1ZAD A;  1HC9 A;  1COE A;  1CB9 A;  5IMY C;  5DU1 A;  1NXB A;  2L03 A;  1XT3 A;  1ONJ A;  2ABX A;  4HQP F;  6EBX A;  1TFS A;  2MUP A;  1JE9 A;  1CCQ A;  1FRA A;  1HAA A;  1IDI A;  4QTI U;  2X8B B;  1VB0 A;  1H0J A;  2QJA C;  3PLC A;  2MJY A;  2JVE A;  3KFD I;  4ZQY A;  5IMT D;  2LCR A;  1TXA A;  2BTX A;  1FSS B;  2MUO A;  4OM5 A;  2MHY A;  1MAH F;  2HLR A;  2VLW A;  1ERA A;  4EY8 B;  1KBA A;  2FD6 U;  1TXB A;  1F8U B;  1CRE A;  1ERG A;  1KXI A;  2PJY C;  2CTX A;  1NEA A;  1NYU A;  2H64 B;  3HH7 A;  1NOR A;  1JBD A;  2JQP A;  2L5S A;  3QB4 B;  1L4W A;  4FAO C;  4BIK B;  2CCX A;  4DO8 A;  1CDS A;  4FAO E;  4OM4 A;  1HAJ A;  1KBS A;  1M9Z A;  1RGJ A;  3LAQ U;  1KBT A;  2QJB C;  1CVO A;  1QKE A;  2ERA A;  2GOO B;  2CRS A;  1CTX A;  1FSC A;  1HOY A;  4IYE A;  2N99 A;  1CHV S;  1FAS A;  1CDT A;  3EBX A;  1BXP A;  2I9B E;  3NEQ A;  2UWR A;  1ABT A;  1V6P A;  4KSN A;  4RUD A;  2QC1 A;  2LA1 A;  1CDQ A;  3BT1 U;  3U74 U;  1REW C;  1FFJ A;  1LX5 B;  1IQ9 A;  1NTX A;  2HLQ A;  1QKD A;  2UX2 A;  1ES7 B;  2QJ9 C;  1S4Y A;  1QM7 A;  1NYS A;  1PLO A;  2CDX A;  2MFA A;  1KU6 B;  1BTE A;  1UG4 A;  2CRT A;  3FEV A;  1IJC A;  1DRS A;  3VTS A;  2H7Z A;  1FF4 A;  1IDH A;  1IDG A;  5DO6 A;  1IKC A;  2J8B A;  1F94 A;  2MJ0 A;  2H8U A;  1LXH A;  1TGX A;  2OFS A; 
#chains in the Genus database with same CATH homology
 2H62 C;  5DZ5 A;  1B41 B;  2BHI A;  1KL8 A;  1YWH A;  2H7Z B;  1W6B A;  3NDS A;  2PJY B;  1RL5 A;  2H64 C;  1COD A;  1IDL A;  3BT2 U;  2H5F A;  4P7U A;  1MR6 A;  1JGK A;  4BDT B;  2K3G A;  2H62 D;  2MJ4 A;  3NH7 A;  1KC4 A;  1CXN A;  1CDR A;  5EBX A;  1HC9 B;  1LXG A;  1NTN A;  1LJZ A;  3ERA A;  1I02 A;  3EVS C;  2GOO C;  4UY2 C;  3KFD E;  1LSI A;  2NBT A;  3U73 U;  4XJJ A;  4AEA A;  1CRF A;  1G6M A;  1KTZ B;  1CXO A;  4LFT A;  1IK8 A;  1KFH A;  1KS6 A;  1ZAD A;  1HC9 A;  1COE A;  1CB9 A;  5IMY C;  5DU1 A;  1NXB A;  2L03 A;  1XT3 A;  1ONJ A;  2ABX A;  4HQP F;  6EBX A;  1TFS A;  2MUP A;  1JE9 A;  1CCQ A;  1FRA A;  1HAA A;  1IDI A;  4QTI U;  2X8B B;  1VB0 A;  1H0J A;  2QJA C;  3PLC A;  2MJY A;  2JVE A;  3KFD I;  4ZQY A;  5IMT D;  2LCR A;  1TXA A;  2BTX A;  1FSS B;  2MUO A;  4OM5 A;  2MHY A;  1MAH F;  2HLR A;  2VLW A;  1ERA A;  4EY8 B;  1KBA A;  2FD6 U;  1TXB A;  1F8U B;  1CRE A;  1ERG A;  1KXI A;  2PJY C;  2CTX A;  1NEA A;  1NYU A;  2H64 B;  3HH7 A;  1NOR A;  1JBD A;  2JQP A;  2L5S A;  3QB4 B;  1L4W A;  4FAO C;  4BIK B;  2CCX A;  4DO8 A;  1CDS A;  4FAO E;  4OM4 A;  1HAJ A;  1KBS A;  1M9Z A;  1RGJ A;  3LAQ U;  1KBT A;  2QJB C;  1CVO A;  1QKE A;  2ERA A;  2GOO B;  2CRS A;  1CTX A;  1FSC A;  1HOY A;  4IYE A;  2N99 A;  1CHV S;  1FAS A;  1CDT A;  3EBX A;  1BXP A;  2I9B E;  3NEQ A;  2UWR A;  1ABT A;  1V6P A;  4KSN A;  4RUD A;  2QC1 A;  2LA1 A;  1CDQ A;  3BT1 U;  3U74 U;  1REW C;  1FFJ A;  1LX5 B;  1IQ9 A;  1NTX A;  2HLQ A;  1QKD A;  2UX2 A;  1ES7 B;  2QJ9 C;  1S4Y A;  1QM7 A;  1NYS A;  1PLO A;  2CDX A;  2MFA A;  1KU6 B;  1BTE A;  1UG4 A;  2CRT A;  3FEV A;  1IJC A;  1DRS A;  3VTS A;  2H7Z A;  1FF4 A;  1IDH A;  1IDG A;  5DO6 A;  1IKC A;  2J8B A;  1F94 A;  2MJ0 A;  2H8U A;  1LXH A;  1TGX A;  2OFS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...