1KS6A

Transforming growth factor beta type ii receptor ligand binding domain
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
107
structure length
107
Chain Sequence
QLPRLCKFCDVKATTCSNQDQCTSNCNITSICEKNNEVCAAVWRRNDENVTLETICHDPQKRLYGHMLDDSSSEQCVMKEKKDDGGLMFMCSCTGEECNDVLIFSAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hormone/growth factor
molecule keywords TRANSFORMING GROWTH FACTOR BETA TYPE II RECEPTOR
publication title Solution structure of the chick TGFb type II receptor ligand binding domain
pubmed doi rcsb
source organism Gallus gallus
total genus 10
structure length 107
sequence length 107
ec nomenclature ec 2.7.11.30: Receptor protein serine/threonine kinase.
pdb deposition date 2002-01-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1ks6A00
1PLOA 6EBXA 5DU1A 3NH7A 2H64B 4FAOC 3VTSA 1TGXA 1ES7B 1ONJA 1LJZA 4DO8A 1NEAA 1BTEA 1F8UB 1FSSB 1CDQA 3EVSC 1NYSA 2FD6U 3ERAA 1S4YA 3PLCA 2CDXA 1CB9A 2I9BE 1L4WA 2GOOB 1FRAA 5IMYC 3HH7A 2H62C 2H7ZA 1IDGA 3BT1U 1KC4A 1IDHA 1KBAA 2QJ9C 1M9ZA 1KBSA 2MUOA 1CRFA 1BXPA 1XT3A 2BTXA 1JBDA 4XJJA 4AEAA 1CVOA 1MAHF 2QC1A 1ERGA 4HQPF 2PJYC 1TXBA 2X8BB 1FSCA 2CCXA 4IYEA 1NORA 1H0JA 2UWRA 4BDTB 1W6BA 4BIKB 1CDRA 2MJYA 2MHYA 2LA1A 1LX5B 2CTXA 2NBTA 1CCQA 1UG4A 1IDLA 2L03A 1CDTA 1CDSA 2K3GA 2MJ0A 1QKDA 1IQ9A 1MR6A 1REWC 4RUDA 1NTXA 1IKCA 2HLRA 1YWHA 1IK8A 1KXIA 1CREA 1FASA 1KFHA 1NXBA 3KFDI 5DZ5A 1JE9A 1KU6B 1V6PA 2QJAC 2H8UA 1KBTA 4OM5A 1HC9A 2N99A 2MUPA 1CXOA 4P7UA 2H64C 1VB0A 4FAOE 1LXGA 1FFJA 2H7ZB 1JGKA 2CRSA 3BT2U 3NDSA 1LXHA 5DO6A 2GOOC 2JVEA 1QKEA 1CHVS 1CODA 1HAJA 1RGJA 2OFSA 3LAQU 4UY2C 1HAAA 1TXAA 2QJBC 1KTZB 1G6MA 2CRTA 1F94A 2LCRA 1DRSA 3KFDE 1I02A 3NEQA 3QB4B 4QTIU 1NTNA 4OM4A 4LFTA 5IMTD 1ERAA 1HC9B 1KL8A 1HOYA 1CXNA 1RL5A 3EBXA 2PJYB 2MJ4A 1B41B 1ABTA 2H62D 2H5FA 1QM7A 3U73U 1IDIA 4ZQYA 1ZADA 1TFSA 2J8BA 2ERAA 3FEVA 1COEA 1KS6A 4EY8B 1IJCA 2HLQA 2MFAA 2VLWA 5EBXA 1LSIA 1FF4A 2JQPA 2L5SA 2UX2A 3U74U 2BHIA 1CTXA 2ABXA 1NYUA
chains in the Genus database with same CATH superfamily
1PLOA 6EBXA 5DU1A 3NH7A 2H64B 4FAOC 3VTSA 1TGXA 1ES7B 1ONJA 1LJZA 4DO8A 1NEAA 1BTEA 1F8UB 1FSSB 1CDQA 3EVSC 1NYSA 2FD6U 3ERAA 1S4YA 3PLCA 2CDXA 1CB9A 2I9BE 1L4WA 2GOOB 1FRAA 5IMYC 3HH7A 2H62C 2H7ZA 1IDGA 3BT1U 1KC4A 1IDHA 1KBAA 2QJ9C 1M9ZA 1KBSA 2MUOA 1CRFA 1BXPA 1XT3A 2BTXA 1JBDA 4XJJA 4AEAA 1CVOA 1MAHF 2QC1A 1ERGA 4HQPF 2PJYC 1TXBA 2X8BB 1FSCA 2CCXA 4IYEA 1NORA 1H0JA 2UWRA 4BDTB 1W6BA 4BIKB 1CDRA 2MJYA 2MHYA 2LA1A 1LX5B 2CTXA 2NBTA 1CCQA 1UG4A 1IDLA 2L03A 1CDTA 1CDSA 2K3GA 2MJ0A 1QKDA 1IQ9A 1MR6A 1REWC 4RUDA 1NTXA 1IKCA 2HLRA 1YWHA 1IK8A 1KXIA 1CREA 1FASA 1KFHA 1NXBA 3KFDI 5DZ5A 1JE9A 1KU6B 4KSNA 1V6PA 2QJAC 2H8UA 1KBTA 4OM5A 1HC9A 2N99A 2MUPA 1CXOA 4P7UA 2H64C 1VB0A 4FAOE 1LXGA 1FFJA 2H7ZB 1JGKA 2CRSA 3BT2U 3NDSA 1LXHA 5DO6A 2GOOC 2JVEA 1QKEA 1CHVS 1CODA 1HAJA 1RGJA 2OFSA 3LAQU 4UY2C 1HAAA 1TXAA 2QJBC 1KTZB 1G6MA 2CRTA 1F94A 2LCRA 1DRSA 3KFDE 1I02A 3NEQA 3QB4B 4QTIU 1NTNA 4OM4A 4LFTA 5IMTD 1ERAA 1HC9B 1KL8A 1HOYA 1CXNA 1RL5A 3EBXA 2PJYB 2MJ4A 1B41B 1ABTA 2H62D 2H5FA 1QM7A 3U73U 1IDIA 4ZQYA 1ZADA 1TFSA 2J8BA 2ERAA 3FEVA 1COEA 1KS6A 4EY8B 1IJCA 2HLQA 2MFAA 2VLWA 5EBXA 1LSIA 1FF4A 2JQPA 2L5SA 2UX2A 3U74U 2BHIA 1CTXA 2ABXA 1NYUA
chains in the Genus database with same CATH topology
1PLOA 6EBXA 5DU1A 3NH7A 2H64B 4FAOC 3VTSA 1TGXA 1ES7B 1ONJA 1LJZA 4DO8A 1NEAA 1BTEA 1F8UB 1FSSB 1CDQA 3EVSC 1NYSA 2FD6U 3ERAA 1S4YA 3PLCA 2CDXA 1CB9A 2I9BE 1L4WA 2GOOB 1FRAA 5IMYC 3HH7A 2H62C 2H7ZA 1IDGA 3BT1U 1KC4A 1IDHA 1KBAA 2QJ9C 1M9ZA 1KBSA 2MUOA 1CRFA 1BXPA 1XT3A 2BTXA 1JBDA 4XJJA 4AEAA 1CVOA 1MAHF 2QC1A 1ERGA 4HQPF 2PJYC 1TXBA 2X8BB 1FSCA 2CCXA 4IYEA 1NORA 1H0JA 2UWRA 4BDTB 1W6BA 4BIKB 1CDRA 2MJYA 2MHYA 2LA1A 1LX5B 2CTXA 2NBTA 1CCQA 1UG4A 1IDLA 2L03A 1CDTA 1CDSA 2K3GA 2MJ0A 1QKDA 1IQ9A 1MR6A 1REWC 4RUDA 1NTXA 1IKCA 2HLRA 1YWHA 1IK8A 1KXIA 1CREA 1FASA 1KFHA 1NXBA 3KFDI 5DZ5A 1JE9A 1KU6B 4KSNA 1V6PA 2QJAC 2H8UA 1KBTA 4OM5A 1HC9A 2N99A 2MUPA 1CXOA 4P7UA 2H64C 1VB0A 4FAOE 1LXGA 1FFJA 2H7ZB 1JGKA 2CRSA 3BT2U 3NDSA 1LXHA 5DO6A 2GOOC 2JVEA 1QKEA 1CHVS 1CODA 1HAJA 1RGJA 2OFSA 3LAQU 4UY2C 1HAAA 1TXAA 2QJBC 1KTZB 1G6MA 2CRTA 1F94A 2LCRA 1DRSA 3KFDE 1I02A 3NEQA 3QB4B 4QTIU 1NTNA 4OM4A 4LFTA 5IMTD 1ERAA 1HC9B 1KL8A 1HOYA 1CXNA 1RL5A 3EBXA 2PJYB 2MJ4A 1B41B 1ABTA 2H62D 2H5FA 1QM7A 3U73U 1IDIA 4ZQYA 1ZADA 1TFSA 2J8BA 2ERAA 3FEVA 1COEA 1KS6A 4EY8B 1IJCA 2HLQA 2MFAA 2VLWA 5EBXA 1LSIA 1FF4A 2JQPA 2L5SA 2UX2A 3U74U 2BHIA 1CTXA 2ABXA 1NYUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PLO A;  6EBX A;  5DU1 A;  3NH7 A;  2H64 B;  4FAO C;  3VTS A;  1TGX A;  1ES7 B;  1ONJ A;  1LJZ A;  4DO8 A;  1NEA A;  1BTE A;  1F8U B;  1FSS B;  1CDQ A;  3EVS C;  1NYS A;  2FD6 U;  3ERA A;  1S4Y A;  3PLC A;  2CDX A;  1CB9 A;  2I9B E;  1L4W A;  2GOO B;  1FRA A;  5IMY C;  3HH7 A;  2H62 C;  2H7Z A;  1IDG A;  3BT1 U;  1KC4 A;  1IDH A;  1KBA A;  2QJ9 C;  1M9Z A;  1KBS A;  2MUO A;  1CRF A;  1BXP A;  1XT3 A;  2BTX A;  1JBD A;  4XJJ A;  4AEA A;  1CVO A;  1MAH F;  2QC1 A;  1ERG A;  4HQP F;  2PJY C;  1TXB A;  2X8B B;  1FSC A;  2CCX A;  4IYE A;  1NOR A;  1H0J A;  2UWR A;  4BDT B;  1W6B A;  4BIK B;  1CDR A;  2MJY A;  2MHY A;  2LA1 A;  1LX5 B;  2CTX A;  2NBT A;  1CCQ A;  1UG4 A;  1IDL A;  2L03 A;  1CDT A;  1CDS A;  2K3G A;  2MJ0 A;  1QKD A;  1IQ9 A;  1MR6 A;  1REW C;  4RUD A;  1NTX A;  1IKC A;  2HLR A;  1YWH A;  1IK8 A;  1KXI A;  1CRE A;  1FAS A;  1KFH A;  1NXB A;  3KFD I;  5DZ5 A;  1JE9 A;  1KU6 B;  1V6P A;  2QJA C;  2H8U A;  1KBT A;  4OM5 A;  1HC9 A;  2N99 A;  2MUP A;  1CXO A;  4P7U A;  2H64 C;  1VB0 A;  4FAO E;  1LXG A;  1FFJ A;  2H7Z B;  1JGK A;  2CRS A;  3BT2 U;  3NDS A;  1LXH A;  5DO6 A;  2GOO C;  2JVE A;  1QKE A;  1CHV S;  1COD A;  1HAJ A;  1RGJ A;  2OFS A;  3LAQ U;  4UY2 C;  1HAA A;  1TXA A;  2QJB C;  1KTZ B;  1G6M A;  2CRT A;  1F94 A;  2LCR A;  1DRS A;  3KFD E;  1I02 A;  3NEQ A;  3QB4 B;  4QTI U;  1NTN A;  4OM4 A;  4LFT A;  5IMT D;  1ERA A;  1HC9 B;  1KL8 A;  1HOY A;  1CXN A;  1RL5 A;  3EBX A;  2PJY B;  2MJ4 A;  1B41 B;  1ABT A;  2H62 D;  2H5F A;  1QM7 A;  3U73 U;  1IDI A;  4ZQY A;  1ZAD A;  1TFS A;  2J8B A;  2ERA A;  3FEV A;  1COE A;  1KS6 A;  4EY8 B;  1IJC A;  2HLQ A;  2MFA A;  2VLW A;  5EBX A;  1LSI A;  1FF4 A;  2JQP A;  2L5S A;  2UX2 A;  3U74 U;  2BHI A;  1CTX A;  2ABX A;  1NYU A; 
#chains in the Genus database with same CATH topology
 1PLO A;  6EBX A;  5DU1 A;  3NH7 A;  2H64 B;  4FAO C;  3VTS A;  1TGX A;  1ES7 B;  1ONJ A;  1LJZ A;  4DO8 A;  1NEA A;  1BTE A;  1F8U B;  1FSS B;  1CDQ A;  3EVS C;  1NYS A;  2FD6 U;  3ERA A;  1S4Y A;  3PLC A;  2CDX A;  1CB9 A;  2I9B E;  1L4W A;  2GOO B;  1FRA A;  5IMY C;  3HH7 A;  2H62 C;  2H7Z A;  1IDG A;  3BT1 U;  1KC4 A;  1IDH A;  1KBA A;  2QJ9 C;  1M9Z A;  1KBS A;  2MUO A;  1CRF A;  1BXP A;  1XT3 A;  2BTX A;  1JBD A;  4XJJ A;  4AEA A;  1CVO A;  1MAH F;  2QC1 A;  1ERG A;  4HQP F;  2PJY C;  1TXB A;  2X8B B;  1FSC A;  2CCX A;  4IYE A;  1NOR A;  1H0J A;  2UWR A;  4BDT B;  1W6B A;  4BIK B;  1CDR A;  2MJY A;  2MHY A;  2LA1 A;  1LX5 B;  2CTX A;  2NBT A;  1CCQ A;  1UG4 A;  1IDL A;  2L03 A;  1CDT A;  1CDS A;  2K3G A;  2MJ0 A;  1QKD A;  1IQ9 A;  1MR6 A;  1REW C;  4RUD A;  1NTX A;  1IKC A;  2HLR A;  1YWH A;  1IK8 A;  1KXI A;  1CRE A;  1FAS A;  1KFH A;  1NXB A;  3KFD I;  5DZ5 A;  1JE9 A;  1KU6 B;  4KSN A;  1V6P A;  2QJA C;  2H8U A;  1KBT A;  4OM5 A;  1HC9 A;  2N99 A;  2MUP A;  1CXO A;  4P7U A;  2H64 C;  1VB0 A;  4FAO E;  1LXG A;  1FFJ A;  2H7Z B;  1JGK A;  2CRS A;  3BT2 U;  3NDS A;  1LXH A;  5DO6 A;  2GOO C;  2JVE A;  1QKE A;  1CHV S;  1COD A;  1HAJ A;  1RGJ A;  2OFS A;  3LAQ U;  4UY2 C;  1HAA A;  1TXA A;  2QJB C;  1KTZ B;  1G6M A;  2CRT A;  1F94 A;  2LCR A;  1DRS A;  3KFD E;  1I02 A;  3NEQ A;  3QB4 B;  4QTI U;  1NTN A;  4OM4 A;  4LFT A;  5IMT D;  1ERA A;  1HC9 B;  1KL8 A;  1HOY A;  1CXN A;  1RL5 A;  3EBX A;  2PJY B;  2MJ4 A;  1B41 B;  1ABT A;  2H62 D;  2H5F A;  1QM7 A;  3U73 U;  1IDI A;  4ZQY A;  1ZAD A;  1TFS A;  2J8B A;  2ERA A;  3FEV A;  1COE A;  1KS6 A;  4EY8 B;  1IJC A;  2HLQ A;  2MFA A;  2VLW A;  5EBX A;  1LSI A;  1FF4 A;  2JQP A;  2L5S A;  2UX2 A;  3U74 U;  2BHI A;  1CTX A;  2ABX A;  1NYU A; 
#chains in the Genus database with same CATH homology
 1PLO A;  6EBX A;  5DU1 A;  3NH7 A;  2H64 B;  4FAO C;  3VTS A;  1TGX A;  1ES7 B;  1ONJ A;  1LJZ A;  4DO8 A;  1NEA A;  1BTE A;  1F8U B;  1FSS B;  1CDQ A;  3EVS C;  1NYS A;  2FD6 U;  3ERA A;  1S4Y A;  3PLC A;  2CDX A;  1CB9 A;  2I9B E;  1L4W A;  2GOO B;  1FRA A;  5IMY C;  3HH7 A;  2H62 C;  2H7Z A;  1IDG A;  3BT1 U;  1KC4 A;  1IDH A;  1KBA A;  2QJ9 C;  1M9Z A;  1KBS A;  2MUO A;  1CRF A;  1BXP A;  1XT3 A;  2BTX A;  1JBD A;  4XJJ A;  4AEA A;  1CVO A;  1MAH F;  2QC1 A;  1ERG A;  4HQP F;  2PJY C;  1TXB A;  2X8B B;  1FSC A;  2CCX A;  4IYE A;  1NOR A;  1H0J A;  2UWR A;  4BDT B;  1W6B A;  4BIK B;  1CDR A;  2MJY A;  2MHY A;  2LA1 A;  1LX5 B;  2CTX A;  2NBT A;  1CCQ A;  1UG4 A;  1IDL A;  2L03 A;  1CDT A;  1CDS A;  2K3G A;  2MJ0 A;  1QKD A;  1IQ9 A;  1MR6 A;  1REW C;  4RUD A;  1NTX A;  1IKC A;  2HLR A;  1YWH A;  1IK8 A;  1KXI A;  1CRE A;  1FAS A;  1KFH A;  1NXB A;  3KFD I;  5DZ5 A;  1JE9 A;  1KU6 B;  4KSN A;  1V6P A;  2QJA C;  2H8U A;  1KBT A;  4OM5 A;  1HC9 A;  2N99 A;  2MUP A;  1CXO A;  4P7U A;  2H64 C;  1VB0 A;  4FAO E;  1LXG A;  1FFJ A;  2H7Z B;  1JGK A;  2CRS A;  3BT2 U;  3NDS A;  1LXH A;  5DO6 A;  2GOO C;  2JVE A;  1QKE A;  1CHV S;  1COD A;  1HAJ A;  1RGJ A;  2OFS A;  3LAQ U;  4UY2 C;  1HAA A;  1TXA A;  2QJB C;  1KTZ B;  1G6M A;  2CRT A;  1F94 A;  2LCR A;  1DRS A;  3KFD E;  1I02 A;  3NEQ A;  3QB4 B;  4QTI U;  1NTN A;  4OM4 A;  4LFT A;  5IMT D;  1ERA A;  1HC9 B;  1KL8 A;  1HOY A;  1CXN A;  1RL5 A;  3EBX A;  2PJY B;  2MJ4 A;  1B41 B;  1ABT A;  2H62 D;  2H5F A;  1QM7 A;  3U73 U;  1IDI A;  4ZQY A;  1ZAD A;  1TFS A;  2J8B A;  2ERA A;  3FEV A;  1COE A;  1KS6 A;  4EY8 B;  1IJC A;  2HLQ A;  2MFA A;  2VLW A;  5EBX A;  1LSI A;  1FF4 A;  2JQP A;  2L5S A;  2UX2 A;  3U74 U;  2BHI A;  1CTX A;  2ABX A;  1NYU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...