1KS6A

Transforming growth factor beta type ii receptor ligand binding domain
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
107
structure length
107
Chain Sequence
QLPRLCKFCDVKATTCSNQDQCTSNCNITSICEKNNEVCAAVWRRNDENVTLETICHDPQKRLYGHMLDDSSSEQCVMKEKKDDGGLMFMCSCTGEECNDVLIFSAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSFORMING GROWTH FACTOR BETA TYPE II RECEPTOR
publication title Solution structure of the chick TGFb type II receptor ligand binding domain
pubmed doi rcsb
source organism Gallus gallus
molecule tags Hormone/growth factor
total genus 10
structure length 107
sequence length 107
ec nomenclature ec 2.7.11.30: Receptor protein serine/threonine kinase.
pdb deposition date 2002-01-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1ks6A00
1RGJA 1KC4A 1F8UB 2H7ZA 1S4YA 1CODA 1MAHF 4HQPF 1LXHA 1IDHA 2ERAA 1LXGA 3QB4B 1NTNA 1IKCA 1ZADA 2HLQA 2LCRA 2N99A 4AEAA 4QTIU 2JQPA 1COEA 2H62D 1HOYA 1TFSA 4XJJA 1FSSB 2NBTA 2H64C 2CTXA 1IJCA 1G6MA 1KL8A 1LSIA 1NTXA 5DU1A 2ABXA 1KS6A 1REWC 2CCXA 2X8BB 1TGXA 2QJAC 3HH7A 2FD6U 1CREA 2H62C 3BT1U 3EBXA 2MJYA 3ERAA 1IDIA 1MR6A 1PLOA 4OM4A 2H8UA 2GOOC 2PJYB 3KFDE 3U74U 1LX5B 1B41B 1CCQA 1IQ9A 1KFHA 1NYUA 1TXAA 4FAOE 1FRAA 2MHYA 2BHIA 1KXIA 2MUOA 2OFSA 3U73U 1HAJA 2QC1A 1H0JA 2MUPA 1NEAA 1CHVS 5DZ5A 1CDQA 1KTZB 2L03A 1CDTA 2J8BA 1QKEA 1IDGA 1CDSA 2HLRA 1I02A 1L4WA 1CXOA 1IDLA 1HC9B 3NEQA 6EBXA 4IYEA 2UWRA 1FFJA 5IMTD 1ERAA 1M9ZA 3LAQU 3EVSC 5IMYC 1RL5A 4P7UA 2MFAA 1KBTA 1HC9A 1CTXA 1ES7B 1IK8A 1FASA 4BDTB 2MJ4A 1V6PA 1ERGA 1F94A 2PJYC 1CXNA 2JVEA 3VTSA 3PLCA 1NYSA 3NDSA 1NXBA 2QJ9C 1LJZA 2L5SA 2CRSA 2QJBC 4DO8A 1UG4A 1DRSA 4RUDA 1BXPA 1JBDA 1CVOA 1KBAA 3FEVA 1TXBA 4ZQYA 4UY2C 1ONJA 1CB9A 1YWHA 1ABTA 4FAOC 1QKDA 2BTXA 2UX2A 1BTEA 1KBSA 2MJ0A 5DO6A 1VB0A 2K3GA 3BT2U 4BIKB 2H64B 1JGKA 4EY8B 1QM7A 3KFDI 4LFTA 1JE9A 2H5FA 1FF4A 1FSCA 1KU6B 2CDXA 1HAAA 5EBXA 2VLWA 1CDRA 1NORA 2GOOB 2LA1A 1CRFA 2H7ZB 3NH7A 4OM5A 2I9BE 1W6BA 1XT3A 2CRTA
chains in the Genus database with same CATH superfamily
1RGJA 1KC4A 1F8UB 2H7ZA 1S4YA 1CODA 1MAHF 4HQPF 1LXHA 1IDHA 2ERAA 1LXGA 3QB4B 1NTNA 1IKCA 1ZADA 2HLQA 2LCRA 2N99A 4AEAA 4QTIU 2JQPA 1COEA 2H62D 1HOYA 1TFSA 4XJJA 1FSSB 2NBTA 2H64C 2CTXA 1IJCA 1G6MA 1KL8A 1LSIA 1NTXA 5DU1A 2ABXA 1KS6A 1REWC 2CCXA 2X8BB 1TGXA 2QJAC 3HH7A 2FD6U 1CREA 2H62C 3BT1U 3EBXA 2MJYA 3ERAA 1IDIA 1MR6A 1PLOA 4OM4A 2H8UA 2GOOC 2PJYB 3KFDE 3U74U 1LX5B 1B41B 1CCQA 1IQ9A 1KFHA 1NYUA 1TXAA 4FAOE 1FRAA 2MHYA 2BHIA 1KXIA 2MUOA 2OFSA 3U73U 1HAJA 2QC1A 1H0JA 2MUPA 1NEAA 1CHVS 5DZ5A 1CDQA 1KTZB 2L03A 1CDTA 2J8BA 1QKEA 1IDGA 1CDSA 2HLRA 1I02A 1L4WA 1CXOA 1IDLA 1HC9B 3NEQA 6EBXA 4IYEA 2UWRA 1FFJA 5IMTD 1ERAA 1M9ZA 3LAQU 3EVSC 5IMYC 1RL5A 4P7UA 2MFAA 1KBTA 1HC9A 1CTXA 1ES7B 1IK8A 1FASA 4BDTB 2MJ4A 1V6PA 1ERGA 1F94A 2PJYC 1CXNA 2JVEA 3VTSA 3PLCA 1NYSA 3NDSA 1NXBA 2QJ9C 1LJZA 2L5SA 2CRSA 2QJBC 4DO8A 1UG4A 1DRSA 4RUDA 1BXPA 1JBDA 1CVOA 1KBAA 3FEVA 1TXBA 4ZQYA 4UY2C 1ONJA 1CB9A 1YWHA 1ABTA 4FAOC 1QKDA 2BTXA 2UX2A 1BTEA 1KBSA 2MJ0A 5DO6A 1VB0A 2K3GA 4KSNA 3BT2U 4BIKB 2H64B 1JGKA 4EY8B 1QM7A 3KFDI 4LFTA 1JE9A 2H5FA 1FF4A 1FSCA 1KU6B 2CDXA 1HAAA 5EBXA 2VLWA 1CDRA 1NORA 2GOOB 2LA1A 1CRFA 2H7ZB 3NH7A 4OM5A 2I9BE 1W6BA 1XT3A 2CRTA
chains in the Genus database with same CATH topology
1RGJA 1KC4A 1F8UB 2H7ZA 1S4YA 1CODA 1MAHF 4HQPF 1LXHA 1IDHA 2ERAA 1LXGA 3QB4B 1NTNA 1IKCA 1ZADA 2HLQA 2LCRA 2N99A 4AEAA 4QTIU 2JQPA 1COEA 2H62D 1HOYA 1TFSA 4XJJA 1FSSB 2NBTA 2H64C 2CTXA 1IJCA 1G6MA 1KL8A 1LSIA 1NTXA 5DU1A 2ABXA 1KS6A 1REWC 2CCXA 2X8BB 1TGXA 2QJAC 3HH7A 2FD6U 1CREA 2H62C 3BT1U 3EBXA 2MJYA 3ERAA 1IDIA 1MR6A 1PLOA 4OM4A 2H8UA 2GOOC 2PJYB 3KFDE 3U74U 1LX5B 1B41B 1CCQA 1IQ9A 1KFHA 1NYUA 1TXAA 4FAOE 1FRAA 2MHYA 2BHIA 1KXIA 2MUOA 2OFSA 3U73U 1HAJA 2QC1A 1H0JA 2MUPA 1NEAA 1CHVS 5DZ5A 1CDQA 1KTZB 2L03A 1CDTA 2J8BA 1QKEA 1IDGA 1CDSA 2HLRA 1I02A 1L4WA 1CXOA 1IDLA 1HC9B 3NEQA 6EBXA 4IYEA 2UWRA 1FFJA 5IMTD 1ERAA 1M9ZA 3LAQU 3EVSC 5IMYC 1RL5A 4P7UA 2MFAA 1KBTA 1HC9A 1CTXA 1ES7B 1IK8A 1FASA 4BDTB 2MJ4A 1V6PA 1ERGA 1F94A 2PJYC 1CXNA 2JVEA 3VTSA 3PLCA 1NYSA 3NDSA 1NXBA 2QJ9C 1LJZA 2L5SA 2CRSA 2QJBC 4DO8A 1UG4A 1DRSA 4RUDA 1BXPA 1JBDA 1CVOA 1KBAA 3FEVA 1TXBA 4ZQYA 4UY2C 1ONJA 1CB9A 1YWHA 1ABTA 4FAOC 1QKDA 2BTXA 2UX2A 1BTEA 1KBSA 2MJ0A 5DO6A 1VB0A 2K3GA 4KSNA 3BT2U 4BIKB 2H64B 1JGKA 4EY8B 1QM7A 3KFDI 4LFTA 1JE9A 2H5FA 1FF4A 1FSCA 1KU6B 2CDXA 1HAAA 5EBXA 2VLWA 1CDRA 1NORA 2GOOB 2LA1A 1CRFA 2H7ZB 3NH7A 4OM5A 2I9BE 1W6BA 1XT3A 2CRTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RGJ A;  1KC4 A;  1F8U B;  2H7Z A;  1S4Y A;  1COD A;  1MAH F;  4HQP F;  1LXH A;  1IDH A;  2ERA A;  1LXG A;  3QB4 B;  1NTN A;  1IKC A;  1ZAD A;  2HLQ A;  2LCR A;  2N99 A;  4AEA A;  4QTI U;  2JQP A;  1COE A;  2H62 D;  1HOY A;  1TFS A;  4XJJ A;  1FSS B;  2NBT A;  2H64 C;  2CTX A;  1IJC A;  1G6M A;  1KL8 A;  1LSI A;  1NTX A;  5DU1 A;  2ABX A;  1KS6 A;  1REW C;  2CCX A;  2X8B B;  1TGX A;  2QJA C;  3HH7 A;  2FD6 U;  1CRE A;  2H62 C;  3BT1 U;  3EBX A;  2MJY A;  3ERA A;  1IDI A;  1MR6 A;  1PLO A;  4OM4 A;  2H8U A;  2GOO C;  2PJY B;  3KFD E;  3U74 U;  1LX5 B;  1B41 B;  1CCQ A;  1IQ9 A;  1KFH A;  1NYU A;  1TXA A;  4FAO E;  1FRA A;  2MHY A;  2BHI A;  1KXI A;  2MUO A;  2OFS A;  3U73 U;  1HAJ A;  2QC1 A;  1H0J A;  2MUP A;  1NEA A;  1CHV S;  5DZ5 A;  1CDQ A;  1KTZ B;  2L03 A;  1CDT A;  2J8B A;  1QKE A;  1IDG A;  1CDS A;  2HLR A;  1I02 A;  1L4W A;  1CXO A;  1IDL A;  1HC9 B;  3NEQ A;  6EBX A;  4IYE A;  2UWR A;  1FFJ A;  5IMT D;  1ERA A;  1M9Z A;  3LAQ U;  3EVS C;  5IMY C;  1RL5 A;  4P7U A;  2MFA A;  1KBT A;  1HC9 A;  1CTX A;  1ES7 B;  1IK8 A;  1FAS A;  4BDT B;  2MJ4 A;  1V6P A;  1ERG A;  1F94 A;  2PJY C;  1CXN A;  2JVE A;  3VTS A;  3PLC A;  1NYS A;  3NDS A;  1NXB A;  2QJ9 C;  1LJZ A;  2L5S A;  2CRS A;  2QJB C;  4DO8 A;  1UG4 A;  1DRS A;  4RUD A;  1BXP A;  1JBD A;  1CVO A;  1KBA A;  3FEV A;  1TXB A;  4ZQY A;  4UY2 C;  1ONJ A;  1CB9 A;  1YWH A;  1ABT A;  4FAO C;  1QKD A;  2BTX A;  2UX2 A;  1BTE A;  1KBS A;  2MJ0 A;  5DO6 A;  1VB0 A;  2K3G A;  3BT2 U;  4BIK B;  2H64 B;  1JGK A;  4EY8 B;  1QM7 A;  3KFD I;  4LFT A;  1JE9 A;  2H5F A;  1FF4 A;  1FSC A;  1KU6 B;  2CDX A;  1HAA A;  5EBX A;  2VLW A;  1CDR A;  1NOR A;  2GOO B;  2LA1 A;  1CRF A;  2H7Z B;  3NH7 A;  4OM5 A;  2I9B E;  1W6B A;  1XT3 A;  2CRT A; 
#chains in the Genus database with same CATH topology
 1RGJ A;  1KC4 A;  1F8U B;  2H7Z A;  1S4Y A;  1COD A;  1MAH F;  4HQP F;  1LXH A;  1IDH A;  2ERA A;  1LXG A;  3QB4 B;  1NTN A;  1IKC A;  1ZAD A;  2HLQ A;  2LCR A;  2N99 A;  4AEA A;  4QTI U;  2JQP A;  1COE A;  2H62 D;  1HOY A;  1TFS A;  4XJJ A;  1FSS B;  2NBT A;  2H64 C;  2CTX A;  1IJC A;  1G6M A;  1KL8 A;  1LSI A;  1NTX A;  5DU1 A;  2ABX A;  1KS6 A;  1REW C;  2CCX A;  2X8B B;  1TGX A;  2QJA C;  3HH7 A;  2FD6 U;  1CRE A;  2H62 C;  3BT1 U;  3EBX A;  2MJY A;  3ERA A;  1IDI A;  1MR6 A;  1PLO A;  4OM4 A;  2H8U A;  2GOO C;  2PJY B;  3KFD E;  3U74 U;  1LX5 B;  1B41 B;  1CCQ A;  1IQ9 A;  1KFH A;  1NYU A;  1TXA A;  4FAO E;  1FRA A;  2MHY A;  2BHI A;  1KXI A;  2MUO A;  2OFS A;  3U73 U;  1HAJ A;  2QC1 A;  1H0J A;  2MUP A;  1NEA A;  1CHV S;  5DZ5 A;  1CDQ A;  1KTZ B;  2L03 A;  1CDT A;  2J8B A;  1QKE A;  1IDG A;  1CDS A;  2HLR A;  1I02 A;  1L4W A;  1CXO A;  1IDL A;  1HC9 B;  3NEQ A;  6EBX A;  4IYE A;  2UWR A;  1FFJ A;  5IMT D;  1ERA A;  1M9Z A;  3LAQ U;  3EVS C;  5IMY C;  1RL5 A;  4P7U A;  2MFA A;  1KBT A;  1HC9 A;  1CTX A;  1ES7 B;  1IK8 A;  1FAS A;  4BDT B;  2MJ4 A;  1V6P A;  1ERG A;  1F94 A;  2PJY C;  1CXN A;  2JVE A;  3VTS A;  3PLC A;  1NYS A;  3NDS A;  1NXB A;  2QJ9 C;  1LJZ A;  2L5S A;  2CRS A;  2QJB C;  4DO8 A;  1UG4 A;  1DRS A;  4RUD A;  1BXP A;  1JBD A;  1CVO A;  1KBA A;  3FEV A;  1TXB A;  4ZQY A;  4UY2 C;  1ONJ A;  1CB9 A;  1YWH A;  1ABT A;  4FAO C;  1QKD A;  2BTX A;  2UX2 A;  1BTE A;  1KBS A;  2MJ0 A;  5DO6 A;  1VB0 A;  2K3G A;  4KSN A;  3BT2 U;  4BIK B;  2H64 B;  1JGK A;  4EY8 B;  1QM7 A;  3KFD I;  4LFT A;  1JE9 A;  2H5F A;  1FF4 A;  1FSC A;  1KU6 B;  2CDX A;  1HAA A;  5EBX A;  2VLW A;  1CDR A;  1NOR A;  2GOO B;  2LA1 A;  1CRF A;  2H7Z B;  3NH7 A;  4OM5 A;  2I9B E;  1W6B A;  1XT3 A;  2CRT A; 
#chains in the Genus database with same CATH homology
 1RGJ A;  1KC4 A;  1F8U B;  2H7Z A;  1S4Y A;  1COD A;  1MAH F;  4HQP F;  1LXH A;  1IDH A;  2ERA A;  1LXG A;  3QB4 B;  1NTN A;  1IKC A;  1ZAD A;  2HLQ A;  2LCR A;  2N99 A;  4AEA A;  4QTI U;  2JQP A;  1COE A;  2H62 D;  1HOY A;  1TFS A;  4XJJ A;  1FSS B;  2NBT A;  2H64 C;  2CTX A;  1IJC A;  1G6M A;  1KL8 A;  1LSI A;  1NTX A;  5DU1 A;  2ABX A;  1KS6 A;  1REW C;  2CCX A;  2X8B B;  1TGX A;  2QJA C;  3HH7 A;  2FD6 U;  1CRE A;  2H62 C;  3BT1 U;  3EBX A;  2MJY A;  3ERA A;  1IDI A;  1MR6 A;  1PLO A;  4OM4 A;  2H8U A;  2GOO C;  2PJY B;  3KFD E;  3U74 U;  1LX5 B;  1B41 B;  1CCQ A;  1IQ9 A;  1KFH A;  1NYU A;  1TXA A;  4FAO E;  1FRA A;  2MHY A;  2BHI A;  1KXI A;  2MUO A;  2OFS A;  3U73 U;  1HAJ A;  2QC1 A;  1H0J A;  2MUP A;  1NEA A;  1CHV S;  5DZ5 A;  1CDQ A;  1KTZ B;  2L03 A;  1CDT A;  2J8B A;  1QKE A;  1IDG A;  1CDS A;  2HLR A;  1I02 A;  1L4W A;  1CXO A;  1IDL A;  1HC9 B;  3NEQ A;  6EBX A;  4IYE A;  2UWR A;  1FFJ A;  5IMT D;  1ERA A;  1M9Z A;  3LAQ U;  3EVS C;  5IMY C;  1RL5 A;  4P7U A;  2MFA A;  1KBT A;  1HC9 A;  1CTX A;  1ES7 B;  1IK8 A;  1FAS A;  4BDT B;  2MJ4 A;  1V6P A;  1ERG A;  1F94 A;  2PJY C;  1CXN A;  2JVE A;  3VTS A;  3PLC A;  1NYS A;  3NDS A;  1NXB A;  2QJ9 C;  1LJZ A;  2L5S A;  2CRS A;  2QJB C;  4DO8 A;  1UG4 A;  1DRS A;  4RUD A;  1BXP A;  1JBD A;  1CVO A;  1KBA A;  3FEV A;  1TXB A;  4ZQY A;  4UY2 C;  1ONJ A;  1CB9 A;  1YWH A;  1ABT A;  4FAO C;  1QKD A;  2BTX A;  2UX2 A;  1BTE A;  1KBS A;  2MJ0 A;  5DO6 A;  1VB0 A;  2K3G A;  4KSN A;  3BT2 U;  4BIK B;  2H64 B;  1JGK A;  4EY8 B;  1QM7 A;  3KFD I;  4LFT A;  1JE9 A;  2H5F A;  1FF4 A;  1FSC A;  1KU6 B;  2CDX A;  1HAA A;  5EBX A;  2VLW A;  1CDR A;  1NOR A;  2GOO B;  2LA1 A;  1CRF A;  2H7Z B;  3NH7 A;  4OM5 A;  2I9B E;  1W6B A;  1XT3 A;  2CRT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...