3LAQU

Structure-based engineering of species selectivity in the upa-upar interaction
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
274
structure length
258
Chain Sequence
LQCMQCESNQSCLVEECALGQDLCRTTVLREWQDDRELEVVTRGCAHSEKTNRTMSYRMGSMIISLTETVCATNLCNRPRPYLECASCTSLDQSCERGREQSLQCRYPTEHCIEVVTLQSTERSLKDEDYTRGCGSLPGCPGTAGFHSNQTFHFLKCCNYTHCNGGPVLDLQSFPPNGFQCYSCEGNNTLGCSSEEASLINCRGPMNQCLVATGLRSYTVRGCATASWCQGSHVADSFPTHLNVSVSCCHGSGCNSPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase receptor
molecule keywords Urokinase-type plasminogen activator
publication title Structure-based engineering of species selectivity in the interaction between urokinase and its receptor: implication for preclinical cancer therapy.
pubmed doi rcsb
source organism Mus musculus
total genus 56
structure length 258
sequence length 274
chains with identical sequence V
ec nomenclature
pdb deposition date 2010-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00021 UPAR_LY6 u-PAR/Ly-6 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 3laqU01
2.10.60.10 Mainly Beta Ribbon CD59 CD59 3laqU03
2.10.60.10 Mainly Beta Ribbon CD59 CD59 3laqU02
1CREA 2H62D 1JBDA 3EVSC 2MJYA 1NTNA 3U73U 1NYSA 1TXAA 1CDTA 1QM7A 4P7UA 1CDSA 3NH7A 2H5FA 1KU6B 4QTIU 1CDQA 1I02A 1DRSA 2JVEA 3KFDE 2H8UA 4OM5A 1BXPA 2LA1A 1CXNA 2L03A 2K3GA 1QKDA 3ERAA 1HAAA 4FAOE 2CDXA 1KL8A 1CHVS 2UX2A 2VLWA 1HC9B 1KTZB 4BDTB 1MAHF 1VB0A 3HH7A 4BIKB 4DO8A 1CODA 2CTXA 1HC9A 1W6BA 1KXIA 3U74U 1ZADA 1CTXA 3VTSA 1S4YA 1MR6A 1IDIA 1IK8A 1REWC 1JGKA 2UWRA 1F94A 1LJZA 2LCRA 1IDGA 1LXHA 1TGXA 2H64B 2BHIA 2OFSA 1KBTA 2GOOB 2MFAA 1IDLA 1COEA 1NEAA 4OM4A 5IMTD 1RGJA 4UY2C 1LXGA 2QJ9C 2MJ0A 5DZ5A 1CXOA 2FD6U 1YWHA 2HLRA 1KBSA 2QC1A 3NEQA 4IYEA 2MJ4A 2CRSA 1CRFA 1TXBA 1HOYA 1H0JA 2GOOC 2N99A 2HLQA 1BTEA 1G6MA 3QB4B 4XJJA 2L5SA 1UG4A 1ERGA 2X8BB 1ERAA 1FFJA 1KC4A 1KS6A 2ABXA 2CCXA 3KFDI 1IJCA 2H7ZB 2QJAC 2I9BE 1PLOA 1LX5B 1M9ZA 1QKEA 1IKCA 1ONJA 2H7ZA 1XT3A 5DU1A 1FASA 2MHYA 4ZQYA 2NBTA 1F8UB 3BT1U 1FSCA 1L4WA 1NXBA 1LSIA 1V6PA 1IDHA 2ERAA 4AEAA 1RL5A 2MUPA 2PJYB 1CB9A 2H64C 5IMYC 2JQPA 5DO6A 6EBXA 1HAJA 2J8BA 4EY8B 3PLCA 4HQPF 1CCQA 4LFTA 1KBAA 1TFSA 3BT2U 3NDSA 1ABTA 1NTXA 2MUOA 2BTXA 1CDRA 2CRTA 1ES7B 1B41B 1NORA 1FRAA 1NYUA 1KFHA 2PJYC 3EBXA 4FAOC 1IQ9A 2H62C 3FEVA 5EBXA 1CVOA 1FF4A 1JE9A 3LAQU 2QJBC 4RUDA 1FSSB
chains in the Genus database with same CATH superfamily
1CREA 2H62D 1JBDA 3EVSC 2MJYA 1NTNA 3U73U 1NYSA 1TXAA 1CDTA 1QM7A 4P7UA 1CDSA 3NH7A 2H5FA 1KU6B 4QTIU 1CDQA 1I02A 1DRSA 2JVEA 3KFDE 2H8UA 4OM5A 1BXPA 2LA1A 1CXNA 2L03A 2K3GA 1QKDA 3ERAA 1HAAA 4FAOE 2CDXA 1KL8A 1CHVS 2UX2A 2VLWA 1HC9B 1KTZB 4BDTB 1MAHF 1VB0A 3HH7A 4BIKB 4DO8A 1CODA 2CTXA 1HC9A 1W6BA 1KXIA 3U74U 1ZADA 1CTXA 3VTSA 1S4YA 1MR6A 1IDIA 1IK8A 1REWC 1JGKA 2UWRA 1F94A 1LJZA 2LCRA 1IDGA 1LXHA 1TGXA 2H64B 2BHIA 2OFSA 1KBTA 2GOOB 2MFAA 1IDLA 1COEA 1NEAA 4OM4A 5IMTD 1RGJA 4UY2C 1LXGA 2QJ9C 2MJ0A 5DZ5A 1CXOA 2FD6U 1YWHA 2HLRA 1KBSA 2QC1A 3NEQA 4IYEA 2MJ4A 2CRSA 1CRFA 1TXBA 1HOYA 1H0JA 2GOOC 2N99A 2HLQA 1BTEA 1G6MA 3QB4B 4XJJA 2L5SA 1UG4A 1ERGA 2X8BB 1ERAA 1FFJA 1KC4A 1KS6A 2ABXA 2CCXA 3KFDI 1IJCA 2H7ZB 2QJAC 2I9BE 1PLOA 1LX5B 1M9ZA 1QKEA 1IKCA 1ONJA 2H7ZA 1XT3A 5DU1A 1FASA 2MHYA 4ZQYA 2NBTA 1F8UB 3BT1U 1FSCA 1L4WA 4KSNA 1NXBA 1LSIA 1V6PA 1IDHA 2ERAA 4AEAA 1RL5A 2MUPA 2PJYB 1CB9A 2H64C 5IMYC 2JQPA 5DO6A 6EBXA 1HAJA 2J8BA 4EY8B 3PLCA 4HQPF 1CCQA 4LFTA 1KBAA 1TFSA 3BT2U 3NDSA 1ABTA 1NTXA 2MUOA 2BTXA 1CDRA 2CRTA 1ES7B 1B41B 1NORA 1FRAA 1NYUA 1KFHA 2PJYC 3EBXA 4FAOC 1IQ9A 2H62C 3FEVA 5EBXA 1CVOA 1FF4A 1JE9A 3LAQU 2QJBC 4RUDA 1FSSB
chains in the Genus database with same CATH topology
1CREA 2H62D 1JBDA 3EVSC 2MJYA 1NTNA 3U73U 1NYSA 1TXAA 1CDTA 1QM7A 4P7UA 1CDSA 3NH7A 2H5FA 1KU6B 4QTIU 1CDQA 1I02A 1DRSA 2JVEA 3KFDE 2H8UA 4OM5A 1BXPA 2LA1A 1CXNA 2L03A 2K3GA 1QKDA 3ERAA 1HAAA 4FAOE 2CDXA 1KL8A 1CHVS 2UX2A 2VLWA 1HC9B 1KTZB 4BDTB 1MAHF 1VB0A 3HH7A 4BIKB 4DO8A 1CODA 2CTXA 1HC9A 1W6BA 1KXIA 3U74U 1ZADA 1CTXA 3VTSA 1S4YA 1MR6A 1IDIA 1IK8A 1REWC 1JGKA 2UWRA 1F94A 1LJZA 2LCRA 1IDGA 1LXHA 1TGXA 2H64B 2BHIA 2OFSA 1KBTA 2GOOB 2MFAA 1IDLA 1COEA 1NEAA 4OM4A 5IMTD 1RGJA 4UY2C 1LXGA 2QJ9C 2MJ0A 5DZ5A 1CXOA 2FD6U 1YWHA 2HLRA 1KBSA 2QC1A 3NEQA 4IYEA 2MJ4A 2CRSA 1CRFA 1TXBA 1HOYA 1H0JA 2GOOC 2N99A 2HLQA 1BTEA 1G6MA 3QB4B 4XJJA 2L5SA 1UG4A 1ERGA 2X8BB 1ERAA 1FFJA 1KC4A 1KS6A 2ABXA 2CCXA 3KFDI 1IJCA 2H7ZB 2QJAC 2I9BE 1PLOA 1LX5B 1M9ZA 1QKEA 1IKCA 1ONJA 2H7ZA 1XT3A 5DU1A 1FASA 2MHYA 4ZQYA 2NBTA 1F8UB 3BT1U 1FSCA 1L4WA 4KSNA 1NXBA 1LSIA 1V6PA 1IDHA 2ERAA 4AEAA 1RL5A 2MUPA 2PJYB 1CB9A 2H64C 5IMYC 2JQPA 5DO6A 6EBXA 1HAJA 2J8BA 4EY8B 3PLCA 4HQPF 1CCQA 4LFTA 1KBAA 1TFSA 3BT2U 3NDSA 1ABTA 1NTXA 2MUOA 2BTXA 1CDRA 2CRTA 1ES7B 1B41B 1NORA 1FRAA 1NYUA 1KFHA 2PJYC 3EBXA 4FAOC 1IQ9A 2H62C 3FEVA 5EBXA 1CVOA 1FF4A 1JE9A 3LAQU 2QJBC 4RUDA 1FSSB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CRE A;  2H62 D;  1JBD A;  3EVS C;  2MJY A;  1NTN A;  3U73 U;  1NYS A;  1TXA A;  1CDT A;  1QM7 A;  4P7U A;  1CDS A;  3NH7 A;  2H5F A;  1KU6 B;  4QTI U;  1CDQ A;  1I02 A;  1DRS A;  2JVE A;  3KFD E;  2H8U A;  4OM5 A;  1BXP A;  2LA1 A;  1CXN A;  2L03 A;  2K3G A;  1QKD A;  3ERA A;  1HAA A;  4FAO E;  2CDX A;  1KL8 A;  1CHV S;  2UX2 A;  2VLW A;  1HC9 B;  1KTZ B;  4BDT B;  1MAH F;  1VB0 A;  3HH7 A;  4BIK B;  4DO8 A;  1COD A;  2CTX A;  1HC9 A;  1W6B A;  1KXI A;  3U74 U;  1ZAD A;  1CTX A;  3VTS A;  1S4Y A;  1MR6 A;  1IDI A;  1IK8 A;  1REW C;  1JGK A;  2UWR A;  1F94 A;  1LJZ A;  2LCR A;  1IDG A;  1LXH A;  1TGX A;  2H64 B;  2BHI A;  2OFS A;  1KBT A;  2GOO B;  2MFA A;  1IDL A;  1COE A;  1NEA A;  4OM4 A;  5IMT D;  1RGJ A;  4UY2 C;  1LXG A;  2QJ9 C;  2MJ0 A;  5DZ5 A;  1CXO A;  2FD6 U;  1YWH A;  2HLR A;  1KBS A;  2QC1 A;  3NEQ A;  4IYE A;  2MJ4 A;  2CRS A;  1CRF A;  1TXB A;  1HOY A;  1H0J A;  2GOO C;  2N99 A;  2HLQ A;  1BTE A;  1G6M A;  3QB4 B;  4XJJ A;  2L5S A;  1UG4 A;  1ERG A;  2X8B B;  1ERA A;  1FFJ A;  1KC4 A;  1KS6 A;  2ABX A;  2CCX A;  3KFD I;  1IJC A;  2H7Z B;  2QJA C;  2I9B E;  1PLO A;  1LX5 B;  1M9Z A;  1QKE A;  1IKC A;  1ONJ A;  2H7Z A;  1XT3 A;  5DU1 A;  1FAS A;  2MHY A;  4ZQY A;  2NBT A;  1F8U B;  3BT1 U;  1FSC A;  1L4W A;  1NXB A;  1LSI A;  1V6P A;  1IDH A;  2ERA A;  4AEA A;  1RL5 A;  2MUP A;  2PJY B;  1CB9 A;  2H64 C;  5IMY C;  2JQP A;  5DO6 A;  6EBX A;  1HAJ A;  2J8B A;  4EY8 B;  3PLC A;  4HQP F;  1CCQ A;  4LFT A;  1KBA A;  1TFS A;  3BT2 U;  3NDS A;  1ABT A;  1NTX A;  2MUO A;  2BTX A;  1CDR A;  2CRT A;  1ES7 B;  1B41 B;  1NOR A;  1FRA A;  1NYU A;  1KFH A;  2PJY C;  3EBX A;  4FAO C;  1IQ9 A;  2H62 C;  3FEV A;  5EBX A;  1CVO A;  1FF4 A;  1JE9 A;  3LAQ U;  2QJB C;  4RUD A;  1FSS B; 
#chains in the Genus database with same CATH topology
 1CRE A;  2H62 D;  1JBD A;  3EVS C;  2MJY A;  1NTN A;  3U73 U;  1NYS A;  1TXA A;  1CDT A;  1QM7 A;  4P7U A;  1CDS A;  3NH7 A;  2H5F A;  1KU6 B;  4QTI U;  1CDQ A;  1I02 A;  1DRS A;  2JVE A;  3KFD E;  2H8U A;  4OM5 A;  1BXP A;  2LA1 A;  1CXN A;  2L03 A;  2K3G A;  1QKD A;  3ERA A;  1HAA A;  4FAO E;  2CDX A;  1KL8 A;  1CHV S;  2UX2 A;  2VLW A;  1HC9 B;  1KTZ B;  4BDT B;  1MAH F;  1VB0 A;  3HH7 A;  4BIK B;  4DO8 A;  1COD A;  2CTX A;  1HC9 A;  1W6B A;  1KXI A;  3U74 U;  1ZAD A;  1CTX A;  3VTS A;  1S4Y A;  1MR6 A;  1IDI A;  1IK8 A;  1REW C;  1JGK A;  2UWR A;  1F94 A;  1LJZ A;  2LCR A;  1IDG A;  1LXH A;  1TGX A;  2H64 B;  2BHI A;  2OFS A;  1KBT A;  2GOO B;  2MFA A;  1IDL A;  1COE A;  1NEA A;  4OM4 A;  5IMT D;  1RGJ A;  4UY2 C;  1LXG A;  2QJ9 C;  2MJ0 A;  5DZ5 A;  1CXO A;  2FD6 U;  1YWH A;  2HLR A;  1KBS A;  2QC1 A;  3NEQ A;  4IYE A;  2MJ4 A;  2CRS A;  1CRF A;  1TXB A;  1HOY A;  1H0J A;  2GOO C;  2N99 A;  2HLQ A;  1BTE A;  1G6M A;  3QB4 B;  4XJJ A;  2L5S A;  1UG4 A;  1ERG A;  2X8B B;  1ERA A;  1FFJ A;  1KC4 A;  1KS6 A;  2ABX A;  2CCX A;  3KFD I;  1IJC A;  2H7Z B;  2QJA C;  2I9B E;  1PLO A;  1LX5 B;  1M9Z A;  1QKE A;  1IKC A;  1ONJ A;  2H7Z A;  1XT3 A;  5DU1 A;  1FAS A;  2MHY A;  4ZQY A;  2NBT A;  1F8U B;  3BT1 U;  1FSC A;  1L4W A;  4KSN A;  1NXB A;  1LSI A;  1V6P A;  1IDH A;  2ERA A;  4AEA A;  1RL5 A;  2MUP A;  2PJY B;  1CB9 A;  2H64 C;  5IMY C;  2JQP A;  5DO6 A;  6EBX A;  1HAJ A;  2J8B A;  4EY8 B;  3PLC A;  4HQP F;  1CCQ A;  4LFT A;  1KBA A;  1TFS A;  3BT2 U;  3NDS A;  1ABT A;  1NTX A;  2MUO A;  2BTX A;  1CDR A;  2CRT A;  1ES7 B;  1B41 B;  1NOR A;  1FRA A;  1NYU A;  1KFH A;  2PJY C;  3EBX A;  4FAO C;  1IQ9 A;  2H62 C;  3FEV A;  5EBX A;  1CVO A;  1FF4 A;  1JE9 A;  3LAQ U;  2QJB C;  4RUD A;  1FSS B; 
#chains in the Genus database with same CATH homology
 1CRE A;  2H62 D;  1JBD A;  3EVS C;  2MJY A;  1NTN A;  3U73 U;  1NYS A;  1TXA A;  1CDT A;  1QM7 A;  4P7U A;  1CDS A;  3NH7 A;  2H5F A;  1KU6 B;  4QTI U;  1CDQ A;  1I02 A;  1DRS A;  2JVE A;  3KFD E;  2H8U A;  4OM5 A;  1BXP A;  2LA1 A;  1CXN A;  2L03 A;  2K3G A;  1QKD A;  3ERA A;  1HAA A;  4FAO E;  2CDX A;  1KL8 A;  1CHV S;  2UX2 A;  2VLW A;  1HC9 B;  1KTZ B;  4BDT B;  1MAH F;  1VB0 A;  3HH7 A;  4BIK B;  4DO8 A;  1COD A;  2CTX A;  1HC9 A;  1W6B A;  1KXI A;  3U74 U;  1ZAD A;  1CTX A;  3VTS A;  1S4Y A;  1MR6 A;  1IDI A;  1IK8 A;  1REW C;  1JGK A;  2UWR A;  1F94 A;  1LJZ A;  2LCR A;  1IDG A;  1LXH A;  1TGX A;  2H64 B;  2BHI A;  2OFS A;  1KBT A;  2GOO B;  2MFA A;  1IDL A;  1COE A;  1NEA A;  4OM4 A;  5IMT D;  1RGJ A;  4UY2 C;  1LXG A;  2QJ9 C;  2MJ0 A;  5DZ5 A;  1CXO A;  2FD6 U;  1YWH A;  2HLR A;  1KBS A;  2QC1 A;  3NEQ A;  4IYE A;  2MJ4 A;  2CRS A;  1CRF A;  1TXB A;  1HOY A;  1H0J A;  2GOO C;  2N99 A;  2HLQ A;  1BTE A;  1G6M A;  3QB4 B;  4XJJ A;  2L5S A;  1UG4 A;  1ERG A;  2X8B B;  1ERA A;  1FFJ A;  1KC4 A;  1KS6 A;  2ABX A;  2CCX A;  3KFD I;  1IJC A;  2H7Z B;  2QJA C;  2I9B E;  1PLO A;  1LX5 B;  1M9Z A;  1QKE A;  1IKC A;  1ONJ A;  2H7Z A;  1XT3 A;  5DU1 A;  1FAS A;  2MHY A;  4ZQY A;  2NBT A;  1F8U B;  3BT1 U;  1FSC A;  1L4W A;  4KSN A;  1NXB A;  1LSI A;  1V6P A;  1IDH A;  2ERA A;  4AEA A;  1RL5 A;  2MUP A;  2PJY B;  1CB9 A;  2H64 C;  5IMY C;  2JQP A;  5DO6 A;  6EBX A;  1HAJ A;  2J8B A;  4EY8 B;  3PLC A;  4HQP F;  1CCQ A;  4LFT A;  1KBA A;  1TFS A;  3BT2 U;  3NDS A;  1ABT A;  1NTX A;  2MUO A;  2BTX A;  1CDR A;  2CRT A;  1ES7 B;  1B41 B;  1NOR A;  1FRA A;  1NYU A;  1KFH A;  2PJY C;  3EBX A;  4FAO C;  1IQ9 A;  2H62 C;  3FEV A;  5EBX A;  1CVO A;  1FF4 A;  1JE9 A;  3LAQ U;  2QJB C;  4RUD A;  1FSS B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...