2H64B

Crystal structure of a ternary ligand-receptor complex of bmp-2
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
92
structure length
92
Chain Sequence
TLPFLKCYCSGHCPDDAINNTCITNGHCFAIIEEDDQGETTLASGCMKYEGSDFQCKDSPKAQLRRTIECCRTNLCNQYLQPTLPPVVIGPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bone morphogenetic protein 2
publication title A silent H-bond can be mutationally activated for high-affinity interaction of BMP-2 and activin type IIB receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone/growth factor
total genus 16
structure length 92
sequence length 92
ec nomenclature ec 2.7.11.30: Receptor protein serine/threonine kinase.
pdb deposition date 2006-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01064 Activin_recp Activin types I and II receptor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2h64B00
2LCRA 1JE9A 1DRSA 1JGKA 5IMTD 1QKDA 1IDGA 2ERAA 4QTIU 1V6PA 4BIKB 1IDHA 4BDTB 3VTSA 1YWHA 1XT3A 2UX2A 5DO6A 4AEAA 1CDTA 1UG4A 2CRTA 1NORA 1LJZA 2H64C 1TXAA 1COEA 1CREA 1F8UB 1H0JA 2CCXA 3ERAA 2BTXA 1KFHA 3PLCA 2L03A 1L4WA 2MFAA 2H8UA 1CDRA 1FASA 1S4YA 2X8BB 1IDIA 3KFDE 1IK8A 3BT1U 2QJAC 1LXHA 1HAAA 3NDSA 2BHIA 2CRSA 1NYSA 1CDSA 2I9BE 5DZ5A 1CDQA 1RGJA 1TGXA 3HH7A 1CXNA 4RUDA 1BXPA 1BTEA 2K3GA 1I02A 4EY8B 2ABXA 2HLRA 1KBSA 1ABTA 2QC1A 1MR6A 2NBTA 3NH7A 3EBXA 5IMYC 2UWRA 1IJCA 3EVSC 4FAOC 1FSSB 4HQPF 4OM5A 2MUPA 1TXBA 1CCQA 2LA1A 1KBTA 4P7UA 4UY2C 1ONJA 2HLQA 2H7ZB 1KXIA 4IYEA 1FRAA 1QM7A 2H5FA 1M9ZA 3FEVA 1MAHF 1RL5A 1KTZB 2OFSA 1ERAA 1CTXA 1NTXA 2H62C 1NTNA 1FF4A 1NYUA 1NEAA 1CXOA 1LX5B 1LXGA 1QKEA 2H7ZA 2QJ9C 1ZADA 2PJYC 1LSIA 2N99A 2CDXA 1HC9B 2L5SA 2PJYB 1TFSA 3LAQU 4XJJA 4DO8A 1IDLA 1VB0A 2MUOA 3U74U 1NXBA 1HOYA 3NEQA 2MJYA 1CVOA 1W6BA 5EBXA 1B41B 1KBAA 6EBXA 1CODA 1CRFA 1F94A 3U73U 1ERGA 2VLWA 1PLOA 1REWC 2MHYA 2H62D 2J8BA 5DU1A 3BT2U 1KU6B 2MJ0A 3QB4B 4LFTA 2GOOC 1HC9A 1ES7B 2GOOB 4FAOE 1FFJA 1HAJA 2JVEA 2JQPA 2H64B 1CHVS 1IQ9A 1KC4A 2MJ4A 1IKCA 3KFDI 1JBDA 2FD6U 4OM4A 1CB9A 4ZQYA 2CTXA 1FSCA 2QJBC 1G6MA 1KL8A 1KS6A
chains in the Genus database with same CATH superfamily
2LCRA 1JE9A 1DRSA 1JGKA 5IMTD 1QKDA 1IDGA 2ERAA 4QTIU 1V6PA 4BIKB 1IDHA 4BDTB 3VTSA 1YWHA 1XT3A 2UX2A 5DO6A 4AEAA 1CDTA 1UG4A 2CRTA 1NORA 1LJZA 2H64C 1TXAA 1COEA 1CREA 1F8UB 1H0JA 2CCXA 3ERAA 2BTXA 1KFHA 3PLCA 2L03A 1L4WA 2MFAA 2H8UA 1CDRA 1FASA 1S4YA 2X8BB 1IDIA 3KFDE 1IK8A 3BT1U 2QJAC 1LXHA 1HAAA 3NDSA 2BHIA 2CRSA 1NYSA 1CDSA 2I9BE 5DZ5A 1CDQA 1RGJA 1TGXA 3HH7A 1CXNA 4RUDA 1BXPA 1BTEA 2K3GA 1I02A 4EY8B 2ABXA 2HLRA 1KBSA 4KSNA 1ABTA 2QC1A 1MR6A 2NBTA 3NH7A 3EBXA 5IMYC 2UWRA 1IJCA 3EVSC 4FAOC 1FSSB 4HQPF 4OM5A 2MUPA 1TXBA 1CCQA 2LA1A 1KBTA 4P7UA 4UY2C 1ONJA 2HLQA 2H7ZB 1KXIA 4IYEA 1FRAA 1QM7A 2H5FA 1M9ZA 3FEVA 1MAHF 1RL5A 1KTZB 2OFSA 1ERAA 1CTXA 1NTXA 2H62C 1NTNA 1FF4A 1NYUA 1NEAA 1CXOA 1LX5B 1LXGA 1QKEA 2H7ZA 2QJ9C 1ZADA 2PJYC 1LSIA 2N99A 2CDXA 1HC9B 2L5SA 2PJYB 1TFSA 3LAQU 4XJJA 4DO8A 1IDLA 1VB0A 2MUOA 3U74U 1NXBA 1HOYA 3NEQA 2MJYA 1CVOA 1W6BA 5EBXA 1B41B 1KBAA 6EBXA 1CODA 1CRFA 1F94A 3U73U 1ERGA 2VLWA 1PLOA 1REWC 2MHYA 2H62D 2J8BA 5DU1A 3BT2U 1KU6B 2MJ0A 3QB4B 4LFTA 2GOOC 1HC9A 1ES7B 2GOOB 4FAOE 1FFJA 1HAJA 2JVEA 2JQPA 2H64B 1CHVS 1IQ9A 1KC4A 2MJ4A 1IKCA 3KFDI 1JBDA 2FD6U 4OM4A 1CB9A 4ZQYA 2CTXA 1FSCA 2QJBC 1G6MA 1KL8A 1KS6A
chains in the Genus database with same CATH topology
2LCRA 1JE9A 1DRSA 1JGKA 5IMTD 1QKDA 1IDGA 2ERAA 4QTIU 1V6PA 4BIKB 1IDHA 4BDTB 3VTSA 1YWHA 1XT3A 2UX2A 5DO6A 4AEAA 1CDTA 1UG4A 2CRTA 1NORA 1LJZA 2H64C 1TXAA 1COEA 1CREA 1F8UB 1H0JA 2CCXA 3ERAA 2BTXA 1KFHA 3PLCA 2L03A 1L4WA 2MFAA 2H8UA 1CDRA 1FASA 1S4YA 2X8BB 1IDIA 3KFDE 1IK8A 3BT1U 2QJAC 1LXHA 1HAAA 3NDSA 2BHIA 2CRSA 1NYSA 1CDSA 2I9BE 5DZ5A 1CDQA 1RGJA 1TGXA 3HH7A 1CXNA 4RUDA 1BXPA 1BTEA 2K3GA 1I02A 4EY8B 2ABXA 2HLRA 1KBSA 4KSNA 1ABTA 2QC1A 1MR6A 2NBTA 3NH7A 3EBXA 5IMYC 2UWRA 1IJCA 3EVSC 4FAOC 1FSSB 4HQPF 4OM5A 2MUPA 1TXBA 1CCQA 2LA1A 1KBTA 4P7UA 4UY2C 1ONJA 2HLQA 2H7ZB 1KXIA 4IYEA 1FRAA 1QM7A 2H5FA 1M9ZA 3FEVA 1MAHF 1RL5A 1KTZB 2OFSA 1ERAA 1CTXA 1NTXA 2H62C 1NTNA 1FF4A 1NYUA 1NEAA 1CXOA 1LX5B 1LXGA 1QKEA 2H7ZA 2QJ9C 1ZADA 2PJYC 1LSIA 2N99A 2CDXA 1HC9B 2L5SA 2PJYB 1TFSA 3LAQU 4XJJA 4DO8A 1IDLA 1VB0A 2MUOA 3U74U 1NXBA 1HOYA 3NEQA 2MJYA 1CVOA 1W6BA 5EBXA 1B41B 1KBAA 6EBXA 1CODA 1CRFA 1F94A 3U73U 1ERGA 2VLWA 1PLOA 1REWC 2MHYA 2H62D 2J8BA 5DU1A 3BT2U 1KU6B 2MJ0A 3QB4B 4LFTA 2GOOC 1HC9A 1ES7B 2GOOB 4FAOE 1FFJA 1HAJA 2JVEA 2JQPA 2H64B 1CHVS 1IQ9A 1KC4A 2MJ4A 1IKCA 3KFDI 1JBDA 2FD6U 4OM4A 1CB9A 4ZQYA 2CTXA 1FSCA 2QJBC 1G6MA 1KL8A 1KS6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LCR A;  1JE9 A;  1DRS A;  1JGK A;  5IMT D;  1QKD A;  1IDG A;  2ERA A;  4QTI U;  1V6P A;  4BIK B;  1IDH A;  4BDT B;  3VTS A;  1YWH A;  1XT3 A;  2UX2 A;  5DO6 A;  4AEA A;  1CDT A;  1UG4 A;  2CRT A;  1NOR A;  1LJZ A;  2H64 C;  1TXA A;  1COE A;  1CRE A;  1F8U B;  1H0J A;  2CCX A;  3ERA A;  2BTX A;  1KFH A;  3PLC A;  2L03 A;  1L4W A;  2MFA A;  2H8U A;  1CDR A;  1FAS A;  1S4Y A;  2X8B B;  1IDI A;  3KFD E;  1IK8 A;  3BT1 U;  2QJA C;  1LXH A;  1HAA A;  3NDS A;  2BHI A;  2CRS A;  1NYS A;  1CDS A;  2I9B E;  5DZ5 A;  1CDQ A;  1RGJ A;  1TGX A;  3HH7 A;  1CXN A;  4RUD A;  1BXP A;  1BTE A;  2K3G A;  1I02 A;  4EY8 B;  2ABX A;  2HLR A;  1KBS A;  1ABT A;  2QC1 A;  1MR6 A;  2NBT A;  3NH7 A;  3EBX A;  5IMY C;  2UWR A;  1IJC A;  3EVS C;  4FAO C;  1FSS B;  4HQP F;  4OM5 A;  2MUP A;  1TXB A;  1CCQ A;  2LA1 A;  1KBT A;  4P7U A;  4UY2 C;  1ONJ A;  2HLQ A;  2H7Z B;  1KXI A;  4IYE A;  1FRA A;  1QM7 A;  2H5F A;  1M9Z A;  3FEV A;  1MAH F;  1RL5 A;  1KTZ B;  2OFS A;  1ERA A;  1CTX A;  1NTX A;  2H62 C;  1NTN A;  1FF4 A;  1NYU A;  1NEA A;  1CXO A;  1LX5 B;  1LXG A;  1QKE A;  2H7Z A;  2QJ9 C;  1ZAD A;  2PJY C;  1LSI A;  2N99 A;  2CDX A;  1HC9 B;  2L5S A;  2PJY B;  1TFS A;  3LAQ U;  4XJJ A;  4DO8 A;  1IDL A;  1VB0 A;  2MUO A;  3U74 U;  1NXB A;  1HOY A;  3NEQ A;  2MJY A;  1CVO A;  1W6B A;  5EBX A;  1B41 B;  1KBA A;  6EBX A;  1COD A;  1CRF A;  1F94 A;  3U73 U;  1ERG A;  2VLW A;  1PLO A;  1REW C;  2MHY A;  2H62 D;  2J8B A;  5DU1 A;  3BT2 U;  1KU6 B;  2MJ0 A;  3QB4 B;  4LFT A;  2GOO C;  1HC9 A;  1ES7 B;  2GOO B;  4FAO E;  1FFJ A;  1HAJ A;  2JVE A;  2JQP A;  2H64 B;  1CHV S;  1IQ9 A;  1KC4 A;  2MJ4 A;  1IKC A;  3KFD I;  1JBD A;  2FD6 U;  4OM4 A;  1CB9 A;  4ZQY A;  2CTX A;  1FSC A;  2QJB C;  1G6M A;  1KL8 A;  1KS6 A; 
#chains in the Genus database with same CATH topology
 2LCR A;  1JE9 A;  1DRS A;  1JGK A;  5IMT D;  1QKD A;  1IDG A;  2ERA A;  4QTI U;  1V6P A;  4BIK B;  1IDH A;  4BDT B;  3VTS A;  1YWH A;  1XT3 A;  2UX2 A;  5DO6 A;  4AEA A;  1CDT A;  1UG4 A;  2CRT A;  1NOR A;  1LJZ A;  2H64 C;  1TXA A;  1COE A;  1CRE A;  1F8U B;  1H0J A;  2CCX A;  3ERA A;  2BTX A;  1KFH A;  3PLC A;  2L03 A;  1L4W A;  2MFA A;  2H8U A;  1CDR A;  1FAS A;  1S4Y A;  2X8B B;  1IDI A;  3KFD E;  1IK8 A;  3BT1 U;  2QJA C;  1LXH A;  1HAA A;  3NDS A;  2BHI A;  2CRS A;  1NYS A;  1CDS A;  2I9B E;  5DZ5 A;  1CDQ A;  1RGJ A;  1TGX A;  3HH7 A;  1CXN A;  4RUD A;  1BXP A;  1BTE A;  2K3G A;  1I02 A;  4EY8 B;  2ABX A;  2HLR A;  1KBS A;  4KSN A;  1ABT A;  2QC1 A;  1MR6 A;  2NBT A;  3NH7 A;  3EBX A;  5IMY C;  2UWR A;  1IJC A;  3EVS C;  4FAO C;  1FSS B;  4HQP F;  4OM5 A;  2MUP A;  1TXB A;  1CCQ A;  2LA1 A;  1KBT A;  4P7U A;  4UY2 C;  1ONJ A;  2HLQ A;  2H7Z B;  1KXI A;  4IYE A;  1FRA A;  1QM7 A;  2H5F A;  1M9Z A;  3FEV A;  1MAH F;  1RL5 A;  1KTZ B;  2OFS A;  1ERA A;  1CTX A;  1NTX A;  2H62 C;  1NTN A;  1FF4 A;  1NYU A;  1NEA A;  1CXO A;  1LX5 B;  1LXG A;  1QKE A;  2H7Z A;  2QJ9 C;  1ZAD A;  2PJY C;  1LSI A;  2N99 A;  2CDX A;  1HC9 B;  2L5S A;  2PJY B;  1TFS A;  3LAQ U;  4XJJ A;  4DO8 A;  1IDL A;  1VB0 A;  2MUO A;  3U74 U;  1NXB A;  1HOY A;  3NEQ A;  2MJY A;  1CVO A;  1W6B A;  5EBX A;  1B41 B;  1KBA A;  6EBX A;  1COD A;  1CRF A;  1F94 A;  3U73 U;  1ERG A;  2VLW A;  1PLO A;  1REW C;  2MHY A;  2H62 D;  2J8B A;  5DU1 A;  3BT2 U;  1KU6 B;  2MJ0 A;  3QB4 B;  4LFT A;  2GOO C;  1HC9 A;  1ES7 B;  2GOO B;  4FAO E;  1FFJ A;  1HAJ A;  2JVE A;  2JQP A;  2H64 B;  1CHV S;  1IQ9 A;  1KC4 A;  2MJ4 A;  1IKC A;  3KFD I;  1JBD A;  2FD6 U;  4OM4 A;  1CB9 A;  4ZQY A;  2CTX A;  1FSC A;  2QJB C;  1G6M A;  1KL8 A;  1KS6 A; 
#chains in the Genus database with same CATH homology
 2LCR A;  1JE9 A;  1DRS A;  1JGK A;  5IMT D;  1QKD A;  1IDG A;  2ERA A;  4QTI U;  1V6P A;  4BIK B;  1IDH A;  4BDT B;  3VTS A;  1YWH A;  1XT3 A;  2UX2 A;  5DO6 A;  4AEA A;  1CDT A;  1UG4 A;  2CRT A;  1NOR A;  1LJZ A;  2H64 C;  1TXA A;  1COE A;  1CRE A;  1F8U B;  1H0J A;  2CCX A;  3ERA A;  2BTX A;  1KFH A;  3PLC A;  2L03 A;  1L4W A;  2MFA A;  2H8U A;  1CDR A;  1FAS A;  1S4Y A;  2X8B B;  1IDI A;  3KFD E;  1IK8 A;  3BT1 U;  2QJA C;  1LXH A;  1HAA A;  3NDS A;  2BHI A;  2CRS A;  1NYS A;  1CDS A;  2I9B E;  5DZ5 A;  1CDQ A;  1RGJ A;  1TGX A;  3HH7 A;  1CXN A;  4RUD A;  1BXP A;  1BTE A;  2K3G A;  1I02 A;  4EY8 B;  2ABX A;  2HLR A;  1KBS A;  4KSN A;  1ABT A;  2QC1 A;  1MR6 A;  2NBT A;  3NH7 A;  3EBX A;  5IMY C;  2UWR A;  1IJC A;  3EVS C;  4FAO C;  1FSS B;  4HQP F;  4OM5 A;  2MUP A;  1TXB A;  1CCQ A;  2LA1 A;  1KBT A;  4P7U A;  4UY2 C;  1ONJ A;  2HLQ A;  2H7Z B;  1KXI A;  4IYE A;  1FRA A;  1QM7 A;  2H5F A;  1M9Z A;  3FEV A;  1MAH F;  1RL5 A;  1KTZ B;  2OFS A;  1ERA A;  1CTX A;  1NTX A;  2H62 C;  1NTN A;  1FF4 A;  1NYU A;  1NEA A;  1CXO A;  1LX5 B;  1LXG A;  1QKE A;  2H7Z A;  2QJ9 C;  1ZAD A;  2PJY C;  1LSI A;  2N99 A;  2CDX A;  1HC9 B;  2L5S A;  2PJY B;  1TFS A;  3LAQ U;  4XJJ A;  4DO8 A;  1IDL A;  1VB0 A;  2MUO A;  3U74 U;  1NXB A;  1HOY A;  3NEQ A;  2MJY A;  1CVO A;  1W6B A;  5EBX A;  1B41 B;  1KBA A;  6EBX A;  1COD A;  1CRF A;  1F94 A;  3U73 U;  1ERG A;  2VLW A;  1PLO A;  1REW C;  2MHY A;  2H62 D;  2J8B A;  5DU1 A;  3BT2 U;  1KU6 B;  2MJ0 A;  3QB4 B;  4LFT A;  2GOO C;  1HC9 A;  1ES7 B;  2GOO B;  4FAO E;  1FFJ A;  1HAJ A;  2JVE A;  2JQP A;  2H64 B;  1CHV S;  1IQ9 A;  1KC4 A;  2MJ4 A;  1IKC A;  3KFD I;  1JBD A;  2FD6 U;  4OM4 A;  1CB9 A;  4ZQY A;  2CTX A;  1FSC A;  2QJB C;  1G6M A;  1KL8 A;  1KS6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...