2H64B

Crystal structure of a ternary ligand-receptor complex of bmp-2
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
92
structure length
92
Chain Sequence
TLPFLKCYCSGHCPDDAINNTCITNGHCFAIIEEDDQGETTLASGCMKYEGSDFQCKDSPKAQLRRTIECCRTNLCNQYLQPTLPPVVIGPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hormone/growth factor
molecule keywords Bone morphogenetic protein 2
publication title A silent H-bond can be mutationally activated for high-affinity interaction of BMP-2 and activin type IIB receptor.
pubmed doi rcsb
source organism Homo sapiens
total genus 16
structure length 92
sequence length 92
ec nomenclature ec 2.7.11.30: Receptor protein serine/threonine kinase.
pdb deposition date 2006-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01064 Activin_recp Activin types I and II receptor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2h64B00
3NDSA 1LX5B 1LXGA 2MFAA 2QJAC 1BTEA 2BTXA 1CTXA 2JVEA 2GOOC 2L5SA 1HC9A 1L4WA 2MJYA 1KFHA 1NYUA 2K3GA 1TXBA 1QM7A 2J8BA 1UG4A 1FSSB 1CDQA 1KU6B 2QJ9C 3FEVA 2CRTA 1XT3A 4XJJA 2JQPA 1FFJA 1HC9B 3PLCA 1CVOA 1F8UB 1TGXA 3HH7A 1CRFA 1VB0A 1CDTA 1CHVS 1MR6A 2H62C 1DRSA 1NTNA 1IK8A 4P7UA 4DO8A 1JBDA 1CDSA 1H0JA 1CODA 3QB4B 2H64B 1I02A 2MUPA 1TFSA 2L03A 1CXNA 1YWHA 2QC1A 2QJBC 3U74U 1W6BA 1CDRA 1FF4A 1NORA 2LA1A 5IMYC 2MJ4A 1KC4A 1IQ9A 1PLOA 3BT2U 1LSIA 1ERAA 2NBTA 3ERAA 4EY8B 3KFDI 4HQPF 5DO6A 1IKCA 1QKEA 1BXPA 1CXOA 1HOYA 1MAHF 1REWC 4AEAA 2HLRA 1NYSA 1KL8A 1JE9A 1IDGA 1KXIA 1TXAA 1RL5A 1B41B 2VLWA 1CCQA 1ES7B 2CTXA 1RGJA 2UX2A 1ZADA 2BHIA 1FSCA 1G6MA 1NTXA 1ABTA 2H7ZA 1KBSA 2H8UA 4OM5A 2GOOB 4OM4A 2LCRA 1F94A 2PJYC 3NEQA 1FASA 1QKDA 2H7ZB 1IJCA 2OFSA 2MJ0A 2FD6U 3EBXA 4QTIU 1ERGA 5IMTD 3EVSC 2HLQA 1ONJA 4UY2C 3VTSA 4IYEA 5DZ5A 1IDHA 2H62D 1CB9A 2CRSA 2MHYA 2UWRA 1LJZA 1M9ZA 2MUOA 2H64C 2I9BE 2CCXA 1KBTA 1IDIA 1S4YA 4FAOE 6EBXA 2N99A 3BT1U 3LAQU 2PJYB 3KFDE 1NXBA 4LFTA 5EBXA 1CREA 4FAOC 1KTZB 1FRAA 1IDLA 1HAAA 2X8BB 1JGKA 1V6PA 4ZQYA 3NH7A 4BIKB 2H5FA 3U73U 5DU1A 4RUDA 1COEA 1HAJA 1KBAA 1LXHA 4BDTB 2ERAA 1NEAA 2CDXA 1KS6A 2ABXA
chains in the Genus database with same CATH superfamily
3NDSA 1LX5B 1LXGA 2MFAA 2QJAC 1BTEA 2BTXA 1CTXA 2JVEA 2GOOC 2L5SA 1HC9A 1L4WA 2MJYA 1KFHA 1NYUA 2K3GA 1TXBA 1QM7A 2J8BA 1UG4A 1FSSB 1CDQA 1KU6B 2QJ9C 3FEVA 2CRTA 1XT3A 4XJJA 2JQPA 1FFJA 1HC9B 3PLCA 1CVOA 1F8UB 1TGXA 3HH7A 1CRFA 1VB0A 1CDTA 1CHVS 1MR6A 2H62C 1DRSA 1NTNA 1IK8A 4P7UA 4DO8A 1JBDA 1CDSA 1H0JA 1CODA 3QB4B 2H64B 1I02A 2MUPA 1TFSA 2L03A 1CXNA 1YWHA 2QC1A 2QJBC 3U74U 1W6BA 1CDRA 1FF4A 1NORA 2LA1A 5IMYC 2MJ4A 1KC4A 1IQ9A 1PLOA 3BT2U 1LSIA 1ERAA 2NBTA 3ERAA 4EY8B 3KFDI 4HQPF 5DO6A 1IKCA 1QKEA 1BXPA 1CXOA 1HOYA 1MAHF 1REWC 4AEAA 2HLRA 1NYSA 1KL8A 1JE9A 1IDGA 1KXIA 1TXAA 1RL5A 1B41B 2VLWA 1CCQA 1ES7B 2CTXA 1RGJA 2UX2A 1ZADA 2BHIA 1FSCA 1G6MA 1NTXA 1ABTA 2H7ZA 1KBSA 2H8UA 4OM5A 2GOOB 4OM4A 2LCRA 1F94A 2PJYC 3NEQA 1FASA 1QKDA 2H7ZB 1IJCA 2OFSA 2MJ0A 2FD6U 3EBXA 4QTIU 1ERGA 5IMTD 3EVSC 2HLQA 1ONJA 4UY2C 3VTSA 4IYEA 5DZ5A 1IDHA 2H62D 1CB9A 2CRSA 2MHYA 2UWRA 1LJZA 1M9ZA 2MUOA 2H64C 2I9BE 2CCXA 1KBTA 1IDIA 1S4YA 4FAOE 6EBXA 2N99A 3BT1U 3LAQU 2PJYB 3KFDE 1NXBA 4LFTA 5EBXA 1CREA 4FAOC 1KTZB 1FRAA 1IDLA 1HAAA 2X8BB 1JGKA 1V6PA 4ZQYA 3NH7A 4BIKB 2H5FA 3U73U 4KSNA 5DU1A 4RUDA 1COEA 1HAJA 1KBAA 1LXHA 4BDTB 2ERAA 1NEAA 2CDXA 1KS6A 2ABXA
chains in the Genus database with same CATH topology
3NDSA 1LX5B 1LXGA 2MFAA 2QJAC 1BTEA 2BTXA 1CTXA 2JVEA 2GOOC 2L5SA 1HC9A 1L4WA 2MJYA 1KFHA 1NYUA 2K3GA 1TXBA 1QM7A 2J8BA 1UG4A 1FSSB 1CDQA 1KU6B 2QJ9C 3FEVA 2CRTA 1XT3A 4XJJA 2JQPA 1FFJA 1HC9B 3PLCA 1CVOA 1F8UB 1TGXA 3HH7A 1CRFA 1VB0A 1CDTA 1CHVS 1MR6A 2H62C 1DRSA 1NTNA 1IK8A 4P7UA 4DO8A 1JBDA 1CDSA 1H0JA 1CODA 3QB4B 2H64B 1I02A 2MUPA 1TFSA 2L03A 1CXNA 1YWHA 2QC1A 2QJBC 3U74U 1W6BA 1CDRA 1FF4A 1NORA 2LA1A 5IMYC 2MJ4A 1KC4A 1IQ9A 1PLOA 3BT2U 1LSIA 1ERAA 2NBTA 3ERAA 4EY8B 3KFDI 4HQPF 5DO6A 1IKCA 1QKEA 1BXPA 1CXOA 1HOYA 1MAHF 1REWC 4AEAA 2HLRA 1NYSA 1KL8A 1JE9A 1IDGA 1KXIA 1TXAA 1RL5A 1B41B 2VLWA 1CCQA 1ES7B 2CTXA 1RGJA 2UX2A 1ZADA 2BHIA 1FSCA 1G6MA 1NTXA 1ABTA 2H7ZA 1KBSA 2H8UA 4OM5A 2GOOB 4OM4A 2LCRA 1F94A 2PJYC 3NEQA 1FASA 1QKDA 2H7ZB 1IJCA 2OFSA 2MJ0A 2FD6U 3EBXA 4QTIU 1ERGA 5IMTD 3EVSC 2HLQA 1ONJA 4UY2C 3VTSA 4IYEA 5DZ5A 1IDHA 2H62D 1CB9A 2CRSA 2MHYA 2UWRA 1LJZA 1M9ZA 2MUOA 2H64C 2I9BE 2CCXA 1KBTA 1IDIA 1S4YA 4FAOE 6EBXA 2N99A 3BT1U 3LAQU 2PJYB 3KFDE 1NXBA 4LFTA 5EBXA 1CREA 4FAOC 1KTZB 1FRAA 1IDLA 1HAAA 2X8BB 1JGKA 1V6PA 4ZQYA 3NH7A 4BIKB 2H5FA 3U73U 4KSNA 5DU1A 4RUDA 1COEA 1HAJA 1KBAA 1LXHA 4BDTB 2ERAA 1NEAA 2CDXA 1KS6A 2ABXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NDS A;  1LX5 B;  1LXG A;  2MFA A;  2QJA C;  1BTE A;  2BTX A;  1CTX A;  2JVE A;  2GOO C;  2L5S A;  1HC9 A;  1L4W A;  2MJY A;  1KFH A;  1NYU A;  2K3G A;  1TXB A;  1QM7 A;  2J8B A;  1UG4 A;  1FSS B;  1CDQ A;  1KU6 B;  2QJ9 C;  3FEV A;  2CRT A;  1XT3 A;  4XJJ A;  2JQP A;  1FFJ A;  1HC9 B;  3PLC A;  1CVO A;  1F8U B;  1TGX A;  3HH7 A;  1CRF A;  1VB0 A;  1CDT A;  1CHV S;  1MR6 A;  2H62 C;  1DRS A;  1NTN A;  1IK8 A;  4P7U A;  4DO8 A;  1JBD A;  1CDS A;  1H0J A;  1COD A;  3QB4 B;  2H64 B;  1I02 A;  2MUP A;  1TFS A;  2L03 A;  1CXN A;  1YWH A;  2QC1 A;  2QJB C;  3U74 U;  1W6B A;  1CDR A;  1FF4 A;  1NOR A;  2LA1 A;  5IMY C;  2MJ4 A;  1KC4 A;  1IQ9 A;  1PLO A;  3BT2 U;  1LSI A;  1ERA A;  2NBT A;  3ERA A;  4EY8 B;  3KFD I;  4HQP F;  5DO6 A;  1IKC A;  1QKE A;  1BXP A;  1CXO A;  1HOY A;  1MAH F;  1REW C;  4AEA A;  2HLR A;  1NYS A;  1KL8 A;  1JE9 A;  1IDG A;  1KXI A;  1TXA A;  1RL5 A;  1B41 B;  2VLW A;  1CCQ A;  1ES7 B;  2CTX A;  1RGJ A;  2UX2 A;  1ZAD A;  2BHI A;  1FSC A;  1G6M A;  1NTX A;  1ABT A;  2H7Z A;  1KBS A;  2H8U A;  4OM5 A;  2GOO B;  4OM4 A;  2LCR A;  1F94 A;  2PJY C;  3NEQ A;  1FAS A;  1QKD A;  2H7Z B;  1IJC A;  2OFS A;  2MJ0 A;  2FD6 U;  3EBX A;  4QTI U;  1ERG A;  5IMT D;  3EVS C;  2HLQ A;  1ONJ A;  4UY2 C;  3VTS A;  4IYE A;  5DZ5 A;  1IDH A;  2H62 D;  1CB9 A;  2CRS A;  2MHY A;  2UWR A;  1LJZ A;  1M9Z A;  2MUO A;  2H64 C;  2I9B E;  2CCX A;  1KBT A;  1IDI A;  1S4Y A;  4FAO E;  6EBX A;  2N99 A;  3BT1 U;  3LAQ U;  2PJY B;  3KFD E;  1NXB A;  4LFT A;  5EBX A;  1CRE A;  4FAO C;  1KTZ B;  1FRA A;  1IDL A;  1HAA A;  2X8B B;  1JGK A;  1V6P A;  4ZQY A;  3NH7 A;  4BIK B;  2H5F A;  3U73 U;  5DU1 A;  4RUD A;  1COE A;  1HAJ A;  1KBA A;  1LXH A;  4BDT B;  2ERA A;  1NEA A;  2CDX A;  1KS6 A;  2ABX A; 
#chains in the Genus database with same CATH topology
 3NDS A;  1LX5 B;  1LXG A;  2MFA A;  2QJA C;  1BTE A;  2BTX A;  1CTX A;  2JVE A;  2GOO C;  2L5S A;  1HC9 A;  1L4W A;  2MJY A;  1KFH A;  1NYU A;  2K3G A;  1TXB A;  1QM7 A;  2J8B A;  1UG4 A;  1FSS B;  1CDQ A;  1KU6 B;  2QJ9 C;  3FEV A;  2CRT A;  1XT3 A;  4XJJ A;  2JQP A;  1FFJ A;  1HC9 B;  3PLC A;  1CVO A;  1F8U B;  1TGX A;  3HH7 A;  1CRF A;  1VB0 A;  1CDT A;  1CHV S;  1MR6 A;  2H62 C;  1DRS A;  1NTN A;  1IK8 A;  4P7U A;  4DO8 A;  1JBD A;  1CDS A;  1H0J A;  1COD A;  3QB4 B;  2H64 B;  1I02 A;  2MUP A;  1TFS A;  2L03 A;  1CXN A;  1YWH A;  2QC1 A;  2QJB C;  3U74 U;  1W6B A;  1CDR A;  1FF4 A;  1NOR A;  2LA1 A;  5IMY C;  2MJ4 A;  1KC4 A;  1IQ9 A;  1PLO A;  3BT2 U;  1LSI A;  1ERA A;  2NBT A;  3ERA A;  4EY8 B;  3KFD I;  4HQP F;  5DO6 A;  1IKC A;  1QKE A;  1BXP A;  1CXO A;  1HOY A;  1MAH F;  1REW C;  4AEA A;  2HLR A;  1NYS A;  1KL8 A;  1JE9 A;  1IDG A;  1KXI A;  1TXA A;  1RL5 A;  1B41 B;  2VLW A;  1CCQ A;  1ES7 B;  2CTX A;  1RGJ A;  2UX2 A;  1ZAD A;  2BHI A;  1FSC A;  1G6M A;  1NTX A;  1ABT A;  2H7Z A;  1KBS A;  2H8U A;  4OM5 A;  2GOO B;  4OM4 A;  2LCR A;  1F94 A;  2PJY C;  3NEQ A;  1FAS A;  1QKD A;  2H7Z B;  1IJC A;  2OFS A;  2MJ0 A;  2FD6 U;  3EBX A;  4QTI U;  1ERG A;  5IMT D;  3EVS C;  2HLQ A;  1ONJ A;  4UY2 C;  3VTS A;  4IYE A;  5DZ5 A;  1IDH A;  2H62 D;  1CB9 A;  2CRS A;  2MHY A;  2UWR A;  1LJZ A;  1M9Z A;  2MUO A;  2H64 C;  2I9B E;  2CCX A;  1KBT A;  1IDI A;  1S4Y A;  4FAO E;  6EBX A;  2N99 A;  3BT1 U;  3LAQ U;  2PJY B;  3KFD E;  1NXB A;  4LFT A;  5EBX A;  1CRE A;  4FAO C;  1KTZ B;  1FRA A;  1IDL A;  1HAA A;  2X8B B;  1JGK A;  1V6P A;  4ZQY A;  3NH7 A;  4BIK B;  2H5F A;  3U73 U;  4KSN A;  5DU1 A;  4RUD A;  1COE A;  1HAJ A;  1KBA A;  1LXH A;  4BDT B;  2ERA A;  1NEA A;  2CDX A;  1KS6 A;  2ABX A; 
#chains in the Genus database with same CATH homology
 3NDS A;  1LX5 B;  1LXG A;  2MFA A;  2QJA C;  1BTE A;  2BTX A;  1CTX A;  2JVE A;  2GOO C;  2L5S A;  1HC9 A;  1L4W A;  2MJY A;  1KFH A;  1NYU A;  2K3G A;  1TXB A;  1QM7 A;  2J8B A;  1UG4 A;  1FSS B;  1CDQ A;  1KU6 B;  2QJ9 C;  3FEV A;  2CRT A;  1XT3 A;  4XJJ A;  2JQP A;  1FFJ A;  1HC9 B;  3PLC A;  1CVO A;  1F8U B;  1TGX A;  3HH7 A;  1CRF A;  1VB0 A;  1CDT A;  1CHV S;  1MR6 A;  2H62 C;  1DRS A;  1NTN A;  1IK8 A;  4P7U A;  4DO8 A;  1JBD A;  1CDS A;  1H0J A;  1COD A;  3QB4 B;  2H64 B;  1I02 A;  2MUP A;  1TFS A;  2L03 A;  1CXN A;  1YWH A;  2QC1 A;  2QJB C;  3U74 U;  1W6B A;  1CDR A;  1FF4 A;  1NOR A;  2LA1 A;  5IMY C;  2MJ4 A;  1KC4 A;  1IQ9 A;  1PLO A;  3BT2 U;  1LSI A;  1ERA A;  2NBT A;  3ERA A;  4EY8 B;  3KFD I;  4HQP F;  5DO6 A;  1IKC A;  1QKE A;  1BXP A;  1CXO A;  1HOY A;  1MAH F;  1REW C;  4AEA A;  2HLR A;  1NYS A;  1KL8 A;  1JE9 A;  1IDG A;  1KXI A;  1TXA A;  1RL5 A;  1B41 B;  2VLW A;  1CCQ A;  1ES7 B;  2CTX A;  1RGJ A;  2UX2 A;  1ZAD A;  2BHI A;  1FSC A;  1G6M A;  1NTX A;  1ABT A;  2H7Z A;  1KBS A;  2H8U A;  4OM5 A;  2GOO B;  4OM4 A;  2LCR A;  1F94 A;  2PJY C;  3NEQ A;  1FAS A;  1QKD A;  2H7Z B;  1IJC A;  2OFS A;  2MJ0 A;  2FD6 U;  3EBX A;  4QTI U;  1ERG A;  5IMT D;  3EVS C;  2HLQ A;  1ONJ A;  4UY2 C;  3VTS A;  4IYE A;  5DZ5 A;  1IDH A;  2H62 D;  1CB9 A;  2CRS A;  2MHY A;  2UWR A;  1LJZ A;  1M9Z A;  2MUO A;  2H64 C;  2I9B E;  2CCX A;  1KBT A;  1IDI A;  1S4Y A;  4FAO E;  6EBX A;  2N99 A;  3BT1 U;  3LAQ U;  2PJY B;  3KFD E;  1NXB A;  4LFT A;  5EBX A;  1CRE A;  4FAO C;  1KTZ B;  1FRA A;  1IDL A;  1HAA A;  2X8B B;  1JGK A;  1V6P A;  4ZQY A;  3NH7 A;  4BIK B;  2H5F A;  3U73 U;  4KSN A;  5DU1 A;  4RUD A;  1COE A;  1HAJ A;  1KBA A;  1LXH A;  4BDT B;  2ERA A;  1NEA A;  2CDX A;  1KS6 A;  2ABX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...