2UWRA

High resolution structure of human cd59
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
79
structure length
79
Chain Sequence
MLQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLENC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords CD59 GLYCOPROTEIN
publication title High-Resolution Structures of Bacterially Expressed Soluble Human Cd59.
pubmed doi rcsb
source organism Homo sapiens
total genus 22
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2007-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00021 UPAR_LY6 u-PAR/Ly-6 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2uwrA00
1COEA 4BIKB 1NXBA 2H62C 1LX5B 2H64C 5DU1A 4EY8B 1KBSA 1W6BA 1I02A 1IDGA 2H7ZA 1LXGA 2MJ4A 2QJAC 2CTXA 1VB0A 1MR6A 1FSCA 1TFSA 2OFSA 3U74U 1CVOA 1TXBA 1CODA 1CB9A 2L03A 1MAHF 2X8BB 1KU6B 1ABTA 5IMTD 4OM5A 1KS6A 1FF4A 5DO6A 2K3GA 1KL8A 2UX2A 3KFDE 3EBXA 2MFAA 5DZ5A 1HAJA 1NTXA 1HC9B 1CCQA 3QB4B 2L5SA 2JVEA 2GOOC 1ERGA 1L4WA 4XJJA 1HAAA 1IQ9A 1CXOA 2QC1A 4UY2C 2PJYB 1HOYA 1REWC 2UWRA 2VLWA 1QKDA 2H62D 2CCXA 1CXNA 2BHIA 3NDSA 4FAOE 1FASA 1CHVS 2H64B 3BT1U 1NYUA 4QTIU 4RUDA 1S4YA 1BTEA 2JQPA 4BDTB 1JGKA 4LFTA 4ZQYA 1TXAA 2MUOA 5EBXA 1IKCA 1CDTA 3FEVA 2MHYA 3PLCA 1LXHA 1FFJA 1TGXA 1CRFA 2I9BE 1CDQA 2HLRA 1IDHA 1RGJA 1IDLA 1KC4A 1NORA 2CDXA 4AEAA 1IK8A 2H8UA 1YWHA 1CDSA 1DRSA 5IMYC 2QJ9C 3EVSC 4FAOC 2MUPA 1IDIA 2H5FA 3NEQA 3U73U 1NYSA 1CDRA 1IJCA 1LJZA 1F8UB 1HC9A 1FRAA 1ES7B 2NBTA 1KTZB 2GOOB 1QKEA 3LAQU 1FSSB 3VTSA 1KXIA 2J8BA 1QM7A 4P7UA 1V6PA 2ABXA 4HQPF 1LSIA 2BTXA 1KFHA 1RL5A 2MJ0A 1M9ZA 2CRSA 1KBAA 2QJBC 3ERAA 1JBDA 2CRTA 1KBTA 2ERAA 2LA1A 3HH7A 1BXPA 4OM4A 1B41B 3KFDI 1ONJA 2H7ZB 4DO8A 1ERAA 1JE9A 1CTXA 2HLQA 2MJYA 1CREA 1UG4A 3BT2U 1XT3A 1PLOA 2N99A 1G6MA 6EBXA 2LCRA 1NEAA 2FD6U 1ZADA 1NTNA 1H0JA 2PJYC 4IYEA 1F94A 3NH7A
chains in the Genus database with same CATH superfamily
1COEA 4BIKB 1NXBA 2H62C 1LX5B 2H64C 5DU1A 4EY8B 1KBSA 1W6BA 1I02A 1IDGA 2H7ZA 1LXGA 2MJ4A 2QJAC 2CTXA 1VB0A 1MR6A 1FSCA 1TFSA 2OFSA 3U74U 1CVOA 1TXBA 1CODA 1CB9A 2L03A 1MAHF 2X8BB 1KU6B 1ABTA 5IMTD 4OM5A 4KSNA 1KS6A 1FF4A 5DO6A 2K3GA 1KL8A 2UX2A 3KFDE 3EBXA 2MFAA 5DZ5A 1HAJA 1NTXA 1HC9B 1CCQA 3QB4B 2L5SA 2JVEA 2GOOC 1ERGA 1L4WA 4XJJA 1HAAA 1IQ9A 1CXOA 2QC1A 4UY2C 2PJYB 1HOYA 1REWC 2UWRA 2VLWA 1QKDA 2H62D 2CCXA 1CXNA 2BHIA 3NDSA 4FAOE 1FASA 1CHVS 2H64B 3BT1U 1NYUA 4QTIU 4RUDA 1S4YA 1BTEA 2JQPA 4BDTB 1JGKA 4LFTA 4ZQYA 1TXAA 2MUOA 5EBXA 1IKCA 1CDTA 3FEVA 2MHYA 3PLCA 1LXHA 1FFJA 1TGXA 1CRFA 2I9BE 1CDQA 2HLRA 1IDHA 1RGJA 1IDLA 1KC4A 1NORA 2CDXA 4AEAA 1IK8A 2H8UA 1YWHA 1CDSA 1DRSA 5IMYC 2QJ9C 3EVSC 4FAOC 2MUPA 1IDIA 2H5FA 3NEQA 3U73U 1NYSA 1CDRA 1IJCA 1LJZA 1F8UB 1HC9A 1FRAA 1ES7B 2NBTA 1KTZB 2GOOB 1QKEA 3LAQU 1FSSB 3VTSA 1KXIA 2J8BA 1QM7A 4P7UA 1V6PA 2ABXA 4HQPF 1LSIA 2BTXA 1KFHA 1RL5A 2MJ0A 1M9ZA 2CRSA 1KBAA 2QJBC 3ERAA 1JBDA 2CRTA 1KBTA 2ERAA 2LA1A 3HH7A 1BXPA 4OM4A 1B41B 3KFDI 1ONJA 2H7ZB 4DO8A 1ERAA 1JE9A 1CTXA 2HLQA 2MJYA 1CREA 1UG4A 3BT2U 1XT3A 1PLOA 2N99A 1G6MA 6EBXA 2LCRA 1NEAA 2FD6U 1ZADA 1NTNA 1H0JA 2PJYC 4IYEA 1F94A 3NH7A
chains in the Genus database with same CATH topology
1COEA 4BIKB 1NXBA 2H62C 1LX5B 2H64C 5DU1A 4EY8B 1KBSA 1W6BA 1I02A 1IDGA 2H7ZA 1LXGA 2MJ4A 2QJAC 2CTXA 1VB0A 1MR6A 1FSCA 1TFSA 2OFSA 3U74U 1CVOA 1TXBA 1CODA 1CB9A 2L03A 1MAHF 2X8BB 1KU6B 1ABTA 5IMTD 4OM5A 4KSNA 1KS6A 1FF4A 5DO6A 2K3GA 1KL8A 2UX2A 3KFDE 3EBXA 2MFAA 5DZ5A 1HAJA 1NTXA 1HC9B 1CCQA 3QB4B 2L5SA 2JVEA 2GOOC 1ERGA 1L4WA 4XJJA 1HAAA 1IQ9A 1CXOA 2QC1A 4UY2C 2PJYB 1HOYA 1REWC 2UWRA 2VLWA 1QKDA 2H62D 2CCXA 1CXNA 2BHIA 3NDSA 4FAOE 1FASA 1CHVS 2H64B 3BT1U 1NYUA 4QTIU 4RUDA 1S4YA 1BTEA 2JQPA 4BDTB 1JGKA 4LFTA 4ZQYA 1TXAA 2MUOA 5EBXA 1IKCA 1CDTA 3FEVA 2MHYA 3PLCA 1LXHA 1FFJA 1TGXA 1CRFA 2I9BE 1CDQA 2HLRA 1IDHA 1RGJA 1IDLA 1KC4A 1NORA 2CDXA 4AEAA 1IK8A 2H8UA 1YWHA 1CDSA 1DRSA 5IMYC 2QJ9C 3EVSC 4FAOC 2MUPA 1IDIA 2H5FA 3NEQA 3U73U 1NYSA 1CDRA 1IJCA 1LJZA 1F8UB 1HC9A 1FRAA 1ES7B 2NBTA 1KTZB 2GOOB 1QKEA 3LAQU 1FSSB 3VTSA 1KXIA 2J8BA 1QM7A 4P7UA 1V6PA 2ABXA 4HQPF 1LSIA 2BTXA 1KFHA 1RL5A 2MJ0A 1M9ZA 2CRSA 1KBAA 2QJBC 3ERAA 1JBDA 2CRTA 1KBTA 2ERAA 2LA1A 3HH7A 1BXPA 4OM4A 1B41B 3KFDI 1ONJA 2H7ZB 4DO8A 1ERAA 1JE9A 1CTXA 2HLQA 2MJYA 1CREA 1UG4A 3BT2U 1XT3A 1PLOA 2N99A 1G6MA 6EBXA 2LCRA 1NEAA 2FD6U 1ZADA 1NTNA 1H0JA 2PJYC 4IYEA 1F94A 3NH7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1COE A;  4BIK B;  1NXB A;  2H62 C;  1LX5 B;  2H64 C;  5DU1 A;  4EY8 B;  1KBS A;  1W6B A;  1I02 A;  1IDG A;  2H7Z A;  1LXG A;  2MJ4 A;  2QJA C;  2CTX A;  1VB0 A;  1MR6 A;  1FSC A;  1TFS A;  2OFS A;  3U74 U;  1CVO A;  1TXB A;  1COD A;  1CB9 A;  2L03 A;  1MAH F;  2X8B B;  1KU6 B;  1ABT A;  5IMT D;  4OM5 A;  1KS6 A;  1FF4 A;  5DO6 A;  2K3G A;  1KL8 A;  2UX2 A;  3KFD E;  3EBX A;  2MFA A;  5DZ5 A;  1HAJ A;  1NTX A;  1HC9 B;  1CCQ A;  3QB4 B;  2L5S A;  2JVE A;  2GOO C;  1ERG A;  1L4W A;  4XJJ A;  1HAA A;  1IQ9 A;  1CXO A;  2QC1 A;  4UY2 C;  2PJY B;  1HOY A;  1REW C;  2UWR A;  2VLW A;  1QKD A;  2H62 D;  2CCX A;  1CXN A;  2BHI A;  3NDS A;  4FAO E;  1FAS A;  1CHV S;  2H64 B;  3BT1 U;  1NYU A;  4QTI U;  4RUD A;  1S4Y A;  1BTE A;  2JQP A;  4BDT B;  1JGK A;  4LFT A;  4ZQY A;  1TXA A;  2MUO A;  5EBX A;  1IKC A;  1CDT A;  3FEV A;  2MHY A;  3PLC A;  1LXH A;  1FFJ A;  1TGX A;  1CRF A;  2I9B E;  1CDQ A;  2HLR A;  1IDH A;  1RGJ A;  1IDL A;  1KC4 A;  1NOR A;  2CDX A;  4AEA A;  1IK8 A;  2H8U A;  1YWH A;  1CDS A;  1DRS A;  5IMY C;  2QJ9 C;  3EVS C;  4FAO C;  2MUP A;  1IDI A;  2H5F A;  3NEQ A;  3U73 U;  1NYS A;  1CDR A;  1IJC A;  1LJZ A;  1F8U B;  1HC9 A;  1FRA A;  1ES7 B;  2NBT A;  1KTZ B;  2GOO B;  1QKE A;  3LAQ U;  1FSS B;  3VTS A;  1KXI A;  2J8B A;  1QM7 A;  4P7U A;  1V6P A;  2ABX A;  4HQP F;  1LSI A;  2BTX A;  1KFH A;  1RL5 A;  2MJ0 A;  1M9Z A;  2CRS A;  1KBA A;  2QJB C;  3ERA A;  1JBD A;  2CRT A;  1KBT A;  2ERA A;  2LA1 A;  3HH7 A;  1BXP A;  4OM4 A;  1B41 B;  3KFD I;  1ONJ A;  2H7Z B;  4DO8 A;  1ERA A;  1JE9 A;  1CTX A;  2HLQ A;  2MJY A;  1CRE A;  1UG4 A;  3BT2 U;  1XT3 A;  1PLO A;  2N99 A;  1G6M A;  6EBX A;  2LCR A;  1NEA A;  2FD6 U;  1ZAD A;  1NTN A;  1H0J A;  2PJY C;  4IYE A;  1F94 A;  3NH7 A; 
#chains in the Genus database with same CATH topology
 1COE A;  4BIK B;  1NXB A;  2H62 C;  1LX5 B;  2H64 C;  5DU1 A;  4EY8 B;  1KBS A;  1W6B A;  1I02 A;  1IDG A;  2H7Z A;  1LXG A;  2MJ4 A;  2QJA C;  2CTX A;  1VB0 A;  1MR6 A;  1FSC A;  1TFS A;  2OFS A;  3U74 U;  1CVO A;  1TXB A;  1COD A;  1CB9 A;  2L03 A;  1MAH F;  2X8B B;  1KU6 B;  1ABT A;  5IMT D;  4OM5 A;  4KSN A;  1KS6 A;  1FF4 A;  5DO6 A;  2K3G A;  1KL8 A;  2UX2 A;  3KFD E;  3EBX A;  2MFA A;  5DZ5 A;  1HAJ A;  1NTX A;  1HC9 B;  1CCQ A;  3QB4 B;  2L5S A;  2JVE A;  2GOO C;  1ERG A;  1L4W A;  4XJJ A;  1HAA A;  1IQ9 A;  1CXO A;  2QC1 A;  4UY2 C;  2PJY B;  1HOY A;  1REW C;  2UWR A;  2VLW A;  1QKD A;  2H62 D;  2CCX A;  1CXN A;  2BHI A;  3NDS A;  4FAO E;  1FAS A;  1CHV S;  2H64 B;  3BT1 U;  1NYU A;  4QTI U;  4RUD A;  1S4Y A;  1BTE A;  2JQP A;  4BDT B;  1JGK A;  4LFT A;  4ZQY A;  1TXA A;  2MUO A;  5EBX A;  1IKC A;  1CDT A;  3FEV A;  2MHY A;  3PLC A;  1LXH A;  1FFJ A;  1TGX A;  1CRF A;  2I9B E;  1CDQ A;  2HLR A;  1IDH A;  1RGJ A;  1IDL A;  1KC4 A;  1NOR A;  2CDX A;  4AEA A;  1IK8 A;  2H8U A;  1YWH A;  1CDS A;  1DRS A;  5IMY C;  2QJ9 C;  3EVS C;  4FAO C;  2MUP A;  1IDI A;  2H5F A;  3NEQ A;  3U73 U;  1NYS A;  1CDR A;  1IJC A;  1LJZ A;  1F8U B;  1HC9 A;  1FRA A;  1ES7 B;  2NBT A;  1KTZ B;  2GOO B;  1QKE A;  3LAQ U;  1FSS B;  3VTS A;  1KXI A;  2J8B A;  1QM7 A;  4P7U A;  1V6P A;  2ABX A;  4HQP F;  1LSI A;  2BTX A;  1KFH A;  1RL5 A;  2MJ0 A;  1M9Z A;  2CRS A;  1KBA A;  2QJB C;  3ERA A;  1JBD A;  2CRT A;  1KBT A;  2ERA A;  2LA1 A;  3HH7 A;  1BXP A;  4OM4 A;  1B41 B;  3KFD I;  1ONJ A;  2H7Z B;  4DO8 A;  1ERA A;  1JE9 A;  1CTX A;  2HLQ A;  2MJY A;  1CRE A;  1UG4 A;  3BT2 U;  1XT3 A;  1PLO A;  2N99 A;  1G6M A;  6EBX A;  2LCR A;  1NEA A;  2FD6 U;  1ZAD A;  1NTN A;  1H0J A;  2PJY C;  4IYE A;  1F94 A;  3NH7 A; 
#chains in the Genus database with same CATH homology
 1COE A;  4BIK B;  1NXB A;  2H62 C;  1LX5 B;  2H64 C;  5DU1 A;  4EY8 B;  1KBS A;  1W6B A;  1I02 A;  1IDG A;  2H7Z A;  1LXG A;  2MJ4 A;  2QJA C;  2CTX A;  1VB0 A;  1MR6 A;  1FSC A;  1TFS A;  2OFS A;  3U74 U;  1CVO A;  1TXB A;  1COD A;  1CB9 A;  2L03 A;  1MAH F;  2X8B B;  1KU6 B;  1ABT A;  5IMT D;  4OM5 A;  4KSN A;  1KS6 A;  1FF4 A;  5DO6 A;  2K3G A;  1KL8 A;  2UX2 A;  3KFD E;  3EBX A;  2MFA A;  5DZ5 A;  1HAJ A;  1NTX A;  1HC9 B;  1CCQ A;  3QB4 B;  2L5S A;  2JVE A;  2GOO C;  1ERG A;  1L4W A;  4XJJ A;  1HAA A;  1IQ9 A;  1CXO A;  2QC1 A;  4UY2 C;  2PJY B;  1HOY A;  1REW C;  2UWR A;  2VLW A;  1QKD A;  2H62 D;  2CCX A;  1CXN A;  2BHI A;  3NDS A;  4FAO E;  1FAS A;  1CHV S;  2H64 B;  3BT1 U;  1NYU A;  4QTI U;  4RUD A;  1S4Y A;  1BTE A;  2JQP A;  4BDT B;  1JGK A;  4LFT A;  4ZQY A;  1TXA A;  2MUO A;  5EBX A;  1IKC A;  1CDT A;  3FEV A;  2MHY A;  3PLC A;  1LXH A;  1FFJ A;  1TGX A;  1CRF A;  2I9B E;  1CDQ A;  2HLR A;  1IDH A;  1RGJ A;  1IDL A;  1KC4 A;  1NOR A;  2CDX A;  4AEA A;  1IK8 A;  2H8U A;  1YWH A;  1CDS A;  1DRS A;  5IMY C;  2QJ9 C;  3EVS C;  4FAO C;  2MUP A;  1IDI A;  2H5F A;  3NEQ A;  3U73 U;  1NYS A;  1CDR A;  1IJC A;  1LJZ A;  1F8U B;  1HC9 A;  1FRA A;  1ES7 B;  2NBT A;  1KTZ B;  2GOO B;  1QKE A;  3LAQ U;  1FSS B;  3VTS A;  1KXI A;  2J8B A;  1QM7 A;  4P7U A;  1V6P A;  2ABX A;  4HQP F;  1LSI A;  2BTX A;  1KFH A;  1RL5 A;  2MJ0 A;  1M9Z A;  2CRS A;  1KBA A;  2QJB C;  3ERA A;  1JBD A;  2CRT A;  1KBT A;  2ERA A;  2LA1 A;  3HH7 A;  1BXP A;  4OM4 A;  1B41 B;  3KFD I;  1ONJ A;  2H7Z B;  4DO8 A;  1ERA A;  1JE9 A;  1CTX A;  2HLQ A;  2MJY A;  1CRE A;  1UG4 A;  3BT2 U;  1XT3 A;  1PLO A;  2N99 A;  1G6M A;  6EBX A;  2LCR A;  1NEA A;  2FD6 U;  1ZAD A;  1NTN A;  1H0J A;  2PJY C;  4IYE A;  1F94 A;  3NH7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...