2UWRA

High resolution structure of human cd59
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
79
structure length
79
Chain Sequence
MLQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLENC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CD59 GLYCOPROTEIN
publication title High-Resolution Structures of Bacterially Expressed Soluble Human Cd59.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 22
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2007-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00021 UPAR_LY6 u-PAR/Ly-6 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2uwrA00
1L4WA 1HC9B 1CDSA 1KXIA 1DRSA 1ES7B 1FASA 1XT3A 1H0JA 1I02A 1HAJA 2L5SA 1KS6A 3NEQA 1W6BA 1IJCA 2CTXA 1CCQA 2L03A 2MJYA 2JQPA 2QC1A 1LX5B 1ERAA 1QKDA 1KTZB 2I9BE 2J8BA 2OFSA 1QM7A 2BTXA 1NTXA 1TXBA 1G6MA 2H7ZB 2H5FA 1NYUA 1CREA 2H62D 2UWRA 3KFDE 1ONJA 2FD6U 3PLCA 2VLWA 3BT2U 1NEAA 4EY8B 1V6PA 4QTIU 4OM4A 2UX2A 5DU1A 1NXBA 1LXHA 3LAQU 1BTEA 2CRTA 1HC9A 2MUPA 2K3GA 3QB4B 1CXOA 1FFJA 3FEVA 2N99A 3KFDI 1IQ9A 3NH7A 4HQPF 3BT1U 6EBXA 1ZADA 4XJJA 1KFHA 2CCXA 5EBXA 2LCRA 2MJ4A 2QJBC 1CDQA 1LSIA 1M9ZA 3ERAA 4UY2C 1REWC 3U73U 2H7ZA 2CRSA 2H64B 1NORA 5DO6A 1IK8A 1PLOA 1FSSB 1COEA 1CTXA 1IKCA 2HLRA 1CXNA 1YWHA 1RL5A 1JGKA 3EBXA 2PJYB 1IDLA 1B41B 1VB0A 2HLQA 4LFTA 4DO8A 1NYSA 2MFAA 4FAOC 1UG4A 5IMYC 1FF4A 1S4YA 5DZ5A 1KC4A 4ZQYA 2H8UA 4IYEA 1HOYA 2ERAA 4P7UA 2H64C 2GOOB 4FAOE 1HAAA 2MUOA 3VTSA 2ABXA 1CDTA 2CDXA 4AEAA 2LA1A 1F8UB 1CODA 1IDHA 1IDGA 2MJ0A 3NDSA 1TGXA 1MAHF 1CDRA 1KBSA 3U74U 2JVEA 2NBTA 1CHVS 1KBTA 1IDIA 1NTNA 1TFSA 2PJYC 5IMTD 1LJZA 1BXPA 1KU6B 1TXAA 1ABTA 1JE9A 4BIKB 1FSCA 2QJAC 1KBAA 1JBDA 4OM5A 1F94A 2GOOC 2QJ9C 2BHIA 2H62C 1ERGA 1KL8A 1QKEA 1CVOA 1CRFA 2X8BB 3EVSC 2MHYA 1FRAA 1CB9A 1MR6A 1LXGA 3HH7A 4RUDA 4BDTB 1RGJA
chains in the Genus database with same CATH superfamily
1L4WA 1HC9B 1CDSA 1KXIA 1DRSA 1ES7B 1FASA 1XT3A 1H0JA 1I02A 1HAJA 2L5SA 1KS6A 3NEQA 1W6BA 1IJCA 2CTXA 1CCQA 2L03A 2MJYA 2JQPA 2QC1A 1LX5B 1ERAA 1QKDA 1KTZB 2I9BE 2J8BA 2OFSA 1QM7A 2BTXA 1NTXA 1TXBA 1G6MA 2H7ZB 2H5FA 1NYUA 1CREA 2H62D 2UWRA 3KFDE 1ONJA 2FD6U 3PLCA 2VLWA 3BT2U 1NEAA 4EY8B 1V6PA 4QTIU 4OM4A 2UX2A 5DU1A 1NXBA 1LXHA 3LAQU 1BTEA 2CRTA 1HC9A 2MUPA 2K3GA 3QB4B 1CXOA 1FFJA 3FEVA 2N99A 3KFDI 1IQ9A 3NH7A 4HQPF 3BT1U 6EBXA 1ZADA 4XJJA 1KFHA 2CCXA 5EBXA 2LCRA 2MJ4A 2QJBC 1CDQA 1LSIA 1M9ZA 3ERAA 4UY2C 1REWC 3U73U 2H7ZA 2CRSA 2H64B 1NORA 5DO6A 1IK8A 1PLOA 1FSSB 1COEA 1CTXA 1IKCA 2HLRA 1CXNA 1YWHA 1RL5A 1JGKA 3EBXA 2PJYB 1IDLA 1B41B 1VB0A 2HLQA 4LFTA 4DO8A 1NYSA 2MFAA 4FAOC 1UG4A 5IMYC 1FF4A 1S4YA 5DZ5A 1KC4A 4ZQYA 2H8UA 4IYEA 1HOYA 2ERAA 4P7UA 2H64C 2GOOB 4FAOE 1HAAA 2MUOA 3VTSA 2ABXA 1CDTA 2CDXA 4AEAA 2LA1A 1F8UB 1CODA 1IDHA 1IDGA 2MJ0A 3NDSA 1TGXA 1MAHF 1CDRA 1KBSA 3U74U 2JVEA 2NBTA 1CHVS 1KBTA 1IDIA 1NTNA 1TFSA 2PJYC 5IMTD 1LJZA 1BXPA 1KU6B 1TXAA 1ABTA 1JE9A 4BIKB 1FSCA 2QJAC 1KBAA 1JBDA 4OM5A 1F94A 2GOOC 2QJ9C 4KSNA 2BHIA 2H62C 1ERGA 1KL8A 1QKEA 1CVOA 1CRFA 2X8BB 3EVSC 2MHYA 1FRAA 1CB9A 1MR6A 1LXGA 3HH7A 4RUDA 4BDTB 1RGJA
chains in the Genus database with same CATH topology
1L4WA 1HC9B 1CDSA 1KXIA 1DRSA 1ES7B 1FASA 1XT3A 1H0JA 1I02A 1HAJA 2L5SA 1KS6A 3NEQA 1W6BA 1IJCA 2CTXA 1CCQA 2L03A 2MJYA 2JQPA 2QC1A 1LX5B 1ERAA 1QKDA 1KTZB 2I9BE 2J8BA 2OFSA 1QM7A 2BTXA 1NTXA 1TXBA 1G6MA 2H7ZB 2H5FA 1NYUA 1CREA 2H62D 2UWRA 3KFDE 1ONJA 2FD6U 3PLCA 2VLWA 3BT2U 1NEAA 4EY8B 1V6PA 4QTIU 4OM4A 2UX2A 5DU1A 1NXBA 1LXHA 3LAQU 1BTEA 2CRTA 1HC9A 2MUPA 2K3GA 3QB4B 1CXOA 1FFJA 3FEVA 2N99A 3KFDI 1IQ9A 3NH7A 4HQPF 3BT1U 6EBXA 1ZADA 4XJJA 1KFHA 2CCXA 5EBXA 2LCRA 2MJ4A 2QJBC 1CDQA 1LSIA 1M9ZA 3ERAA 4UY2C 1REWC 3U73U 2H7ZA 2CRSA 2H64B 1NORA 5DO6A 1IK8A 1PLOA 1FSSB 1COEA 1CTXA 1IKCA 2HLRA 1CXNA 1YWHA 1RL5A 1JGKA 3EBXA 2PJYB 1IDLA 1B41B 1VB0A 2HLQA 4LFTA 4DO8A 1NYSA 2MFAA 4FAOC 1UG4A 5IMYC 1FF4A 1S4YA 5DZ5A 1KC4A 4ZQYA 2H8UA 4IYEA 1HOYA 2ERAA 4P7UA 2H64C 2GOOB 4FAOE 1HAAA 2MUOA 3VTSA 2ABXA 1CDTA 2CDXA 4AEAA 2LA1A 1F8UB 1CODA 1IDHA 1IDGA 2MJ0A 3NDSA 1TGXA 1MAHF 1CDRA 1KBSA 3U74U 2JVEA 2NBTA 1CHVS 1KBTA 1IDIA 1NTNA 1TFSA 2PJYC 5IMTD 1LJZA 1BXPA 1KU6B 1TXAA 1ABTA 1JE9A 4BIKB 1FSCA 2QJAC 1KBAA 1JBDA 4OM5A 1F94A 2GOOC 2QJ9C 4KSNA 2BHIA 2H62C 1ERGA 1KL8A 1QKEA 1CVOA 1CRFA 2X8BB 3EVSC 2MHYA 1FRAA 1CB9A 1MR6A 1LXGA 3HH7A 4RUDA 4BDTB 1RGJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L4W A;  1HC9 B;  1CDS A;  1KXI A;  1DRS A;  1ES7 B;  1FAS A;  1XT3 A;  1H0J A;  1I02 A;  1HAJ A;  2L5S A;  1KS6 A;  3NEQ A;  1W6B A;  1IJC A;  2CTX A;  1CCQ A;  2L03 A;  2MJY A;  2JQP A;  2QC1 A;  1LX5 B;  1ERA A;  1QKD A;  1KTZ B;  2I9B E;  2J8B A;  2OFS A;  1QM7 A;  2BTX A;  1NTX A;  1TXB A;  1G6M A;  2H7Z B;  2H5F A;  1NYU A;  1CRE A;  2H62 D;  2UWR A;  3KFD E;  1ONJ A;  2FD6 U;  3PLC A;  2VLW A;  3BT2 U;  1NEA A;  4EY8 B;  1V6P A;  4QTI U;  4OM4 A;  2UX2 A;  5DU1 A;  1NXB A;  1LXH A;  3LAQ U;  1BTE A;  2CRT A;  1HC9 A;  2MUP A;  2K3G A;  3QB4 B;  1CXO A;  1FFJ A;  3FEV A;  2N99 A;  3KFD I;  1IQ9 A;  3NH7 A;  4HQP F;  3BT1 U;  6EBX A;  1ZAD A;  4XJJ A;  1KFH A;  2CCX A;  5EBX A;  2LCR A;  2MJ4 A;  2QJB C;  1CDQ A;  1LSI A;  1M9Z A;  3ERA A;  4UY2 C;  1REW C;  3U73 U;  2H7Z A;  2CRS A;  2H64 B;  1NOR A;  5DO6 A;  1IK8 A;  1PLO A;  1FSS B;  1COE A;  1CTX A;  1IKC A;  2HLR A;  1CXN A;  1YWH A;  1RL5 A;  1JGK A;  3EBX A;  2PJY B;  1IDL A;  1B41 B;  1VB0 A;  2HLQ A;  4LFT A;  4DO8 A;  1NYS A;  2MFA A;  4FAO C;  1UG4 A;  5IMY C;  1FF4 A;  1S4Y A;  5DZ5 A;  1KC4 A;  4ZQY A;  2H8U A;  4IYE A;  1HOY A;  2ERA A;  4P7U A;  2H64 C;  2GOO B;  4FAO E;  1HAA A;  2MUO A;  3VTS A;  2ABX A;  1CDT A;  2CDX A;  4AEA A;  2LA1 A;  1F8U B;  1COD A;  1IDH A;  1IDG A;  2MJ0 A;  3NDS A;  1TGX A;  1MAH F;  1CDR A;  1KBS A;  3U74 U;  2JVE A;  2NBT A;  1CHV S;  1KBT A;  1IDI A;  1NTN A;  1TFS A;  2PJY C;  5IMT D;  1LJZ A;  1BXP A;  1KU6 B;  1TXA A;  1ABT A;  1JE9 A;  4BIK B;  1FSC A;  2QJA C;  1KBA A;  1JBD A;  4OM5 A;  1F94 A;  2GOO C;  2QJ9 C;  2BHI A;  2H62 C;  1ERG A;  1KL8 A;  1QKE A;  1CVO A;  1CRF A;  2X8B B;  3EVS C;  2MHY A;  1FRA A;  1CB9 A;  1MR6 A;  1LXG A;  3HH7 A;  4RUD A;  4BDT B;  1RGJ A; 
#chains in the Genus database with same CATH topology
 1L4W A;  1HC9 B;  1CDS A;  1KXI A;  1DRS A;  1ES7 B;  1FAS A;  1XT3 A;  1H0J A;  1I02 A;  1HAJ A;  2L5S A;  1KS6 A;  3NEQ A;  1W6B A;  1IJC A;  2CTX A;  1CCQ A;  2L03 A;  2MJY A;  2JQP A;  2QC1 A;  1LX5 B;  1ERA A;  1QKD A;  1KTZ B;  2I9B E;  2J8B A;  2OFS A;  1QM7 A;  2BTX A;  1NTX A;  1TXB A;  1G6M A;  2H7Z B;  2H5F A;  1NYU A;  1CRE A;  2H62 D;  2UWR A;  3KFD E;  1ONJ A;  2FD6 U;  3PLC A;  2VLW A;  3BT2 U;  1NEA A;  4EY8 B;  1V6P A;  4QTI U;  4OM4 A;  2UX2 A;  5DU1 A;  1NXB A;  1LXH A;  3LAQ U;  1BTE A;  2CRT A;  1HC9 A;  2MUP A;  2K3G A;  3QB4 B;  1CXO A;  1FFJ A;  3FEV A;  2N99 A;  3KFD I;  1IQ9 A;  3NH7 A;  4HQP F;  3BT1 U;  6EBX A;  1ZAD A;  4XJJ A;  1KFH A;  2CCX A;  5EBX A;  2LCR A;  2MJ4 A;  2QJB C;  1CDQ A;  1LSI A;  1M9Z A;  3ERA A;  4UY2 C;  1REW C;  3U73 U;  2H7Z A;  2CRS A;  2H64 B;  1NOR A;  5DO6 A;  1IK8 A;  1PLO A;  1FSS B;  1COE A;  1CTX A;  1IKC A;  2HLR A;  1CXN A;  1YWH A;  1RL5 A;  1JGK A;  3EBX A;  2PJY B;  1IDL A;  1B41 B;  1VB0 A;  2HLQ A;  4LFT A;  4DO8 A;  1NYS A;  2MFA A;  4FAO C;  1UG4 A;  5IMY C;  1FF4 A;  1S4Y A;  5DZ5 A;  1KC4 A;  4ZQY A;  2H8U A;  4IYE A;  1HOY A;  2ERA A;  4P7U A;  2H64 C;  2GOO B;  4FAO E;  1HAA A;  2MUO A;  3VTS A;  2ABX A;  1CDT A;  2CDX A;  4AEA A;  2LA1 A;  1F8U B;  1COD A;  1IDH A;  1IDG A;  2MJ0 A;  3NDS A;  1TGX A;  1MAH F;  1CDR A;  1KBS A;  3U74 U;  2JVE A;  2NBT A;  1CHV S;  1KBT A;  1IDI A;  1NTN A;  1TFS A;  2PJY C;  5IMT D;  1LJZ A;  1BXP A;  1KU6 B;  1TXA A;  1ABT A;  1JE9 A;  4BIK B;  1FSC A;  2QJA C;  1KBA A;  1JBD A;  4OM5 A;  1F94 A;  2GOO C;  2QJ9 C;  4KSN A;  2BHI A;  2H62 C;  1ERG A;  1KL8 A;  1QKE A;  1CVO A;  1CRF A;  2X8B B;  3EVS C;  2MHY A;  1FRA A;  1CB9 A;  1MR6 A;  1LXG A;  3HH7 A;  4RUD A;  4BDT B;  1RGJ A; 
#chains in the Genus database with same CATH homology
 1L4W A;  1HC9 B;  1CDS A;  1KXI A;  1DRS A;  1ES7 B;  1FAS A;  1XT3 A;  1H0J A;  1I02 A;  1HAJ A;  2L5S A;  1KS6 A;  3NEQ A;  1W6B A;  1IJC A;  2CTX A;  1CCQ A;  2L03 A;  2MJY A;  2JQP A;  2QC1 A;  1LX5 B;  1ERA A;  1QKD A;  1KTZ B;  2I9B E;  2J8B A;  2OFS A;  1QM7 A;  2BTX A;  1NTX A;  1TXB A;  1G6M A;  2H7Z B;  2H5F A;  1NYU A;  1CRE A;  2H62 D;  2UWR A;  3KFD E;  1ONJ A;  2FD6 U;  3PLC A;  2VLW A;  3BT2 U;  1NEA A;  4EY8 B;  1V6P A;  4QTI U;  4OM4 A;  2UX2 A;  5DU1 A;  1NXB A;  1LXH A;  3LAQ U;  1BTE A;  2CRT A;  1HC9 A;  2MUP A;  2K3G A;  3QB4 B;  1CXO A;  1FFJ A;  3FEV A;  2N99 A;  3KFD I;  1IQ9 A;  3NH7 A;  4HQP F;  3BT1 U;  6EBX A;  1ZAD A;  4XJJ A;  1KFH A;  2CCX A;  5EBX A;  2LCR A;  2MJ4 A;  2QJB C;  1CDQ A;  1LSI A;  1M9Z A;  3ERA A;  4UY2 C;  1REW C;  3U73 U;  2H7Z A;  2CRS A;  2H64 B;  1NOR A;  5DO6 A;  1IK8 A;  1PLO A;  1FSS B;  1COE A;  1CTX A;  1IKC A;  2HLR A;  1CXN A;  1YWH A;  1RL5 A;  1JGK A;  3EBX A;  2PJY B;  1IDL A;  1B41 B;  1VB0 A;  2HLQ A;  4LFT A;  4DO8 A;  1NYS A;  2MFA A;  4FAO C;  1UG4 A;  5IMY C;  1FF4 A;  1S4Y A;  5DZ5 A;  1KC4 A;  4ZQY A;  2H8U A;  4IYE A;  1HOY A;  2ERA A;  4P7U A;  2H64 C;  2GOO B;  4FAO E;  1HAA A;  2MUO A;  3VTS A;  2ABX A;  1CDT A;  2CDX A;  4AEA A;  2LA1 A;  1F8U B;  1COD A;  1IDH A;  1IDG A;  2MJ0 A;  3NDS A;  1TGX A;  1MAH F;  1CDR A;  1KBS A;  3U74 U;  2JVE A;  2NBT A;  1CHV S;  1KBT A;  1IDI A;  1NTN A;  1TFS A;  2PJY C;  5IMT D;  1LJZ A;  1BXP A;  1KU6 B;  1TXA A;  1ABT A;  1JE9 A;  4BIK B;  1FSC A;  2QJA C;  1KBA A;  1JBD A;  4OM5 A;  1F94 A;  2GOO C;  2QJ9 C;  4KSN A;  2BHI A;  2H62 C;  1ERG A;  1KL8 A;  1QKE A;  1CVO A;  1CRF A;  2X8B B;  3EVS C;  2MHY A;  1FRA A;  1CB9 A;  1MR6 A;  1LXG A;  3HH7 A;  4RUD A;  4BDT B;  1RGJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...