2UWRA

High resolution structure of human cd59
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
79
structure length
79
Chain Sequence
b'MLQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLENC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CD59 GLYCOPROTEIN
publication title High-Resolution Structures of Bacterially Expressed Soluble Human Cd59.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 22
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2007-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00021 UPAR_LY6 u-PAR/Ly-6 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2uwrA00
2BHIA 2I9BE 2ABXA 1G6MA 1IDHA 3BT1U 4ZQYA 2J8BA 1HC9B 1MR6A 1NTXA 1RGJA 1UG4A 5EBXA 1TXAA 4EY8B 2MHYA 1H0JA 4IYEA 1CODA 1CDRA 1HAJA 3PLCA 2QJAC 1QM7A 1BTEA 1LXGA 1CTXA 2GOOB 1FF4A 1KU6B 2MJ0A 2H62D 3EBXA 2L03A 5IMYC 2QC1A 1IQ9A 1KBSA 2MFAA 2H64C 1CXNA 2HLRA 2H8UA 1ABTA 2BTXA 1MAHF 2OFSA 1ZADA 1CHVS 1JBDA 3NEQA 4DO8A 1I02A 1YWHA 1IK8A 1NYSA 1IDIA 1IJCA 2VLWA 1KBTA 2CRTA 2H5FA 1IDGA 1CRFA 4OM4A 1LX5B 3EVSC 3NH7A 1NEAA 1FRAA 3KFDE 1VB0A 2K3GA 2PJYB 2N99A 1KL8A 1TXBA 3NDSA 1CXOA 1ES7B 1XT3A 1RL5A 1S4YA 1KC4A 2FD6U 1QKEA 3VTSA 1KTZB 3FEVA 1NXBA 2H62C 1CDSA 2H7ZA 1LXHA 1W6BA 1FSSB 2JQPA 2MUOA 4P7UA 5DO6A 3U74U 4FAOE 1F94A 1HAAA 1TGXA 1LSIA 1CREA 1HC9A 2MJ4A 2H64B 1NYUA 4HQPF 4XJJA 4RUDA 1KBAA 1LJZA 1B41B 3BT2U 4AEAA 1CB9A 1IKCA 2CCXA 2CRSA 3LAQU 1NTNA 1IDLA 1TFSA 5DZ5A 2ERAA 2HLQA 3ERAA 3KFDI 1QKDA 4BDTB 4FAOC 1NORA 1DRSA 1ERAA 1PLOA 2QJBC 1HOYA 2NBTA 1CDTA 2CTXA 4LFTA 3HH7A 6EBXA 1ERGA 1REWC 1KFHA 1FASA 1M9ZA 2LA1A 2QJ9C 2PJYC 1KXIA 1FSCA 1V6PA 4OM5A 2JVEA 1KS6A 2GOOC 1CDQA 4QTIU 2L5SA 2MUPA 1JE9A 2X8BB 4UY2C 2UWRA 3QB4B 1COEA 3U73U 2UX2A 1F8UB 1CVOA 1JGKA 2MJYA 1ONJA 5IMTD 2LCRA 4BIKB 1BXPA 5DU1A 2H7ZB 2CDXA 1CCQA 1L4WA 1FFJA
chains in the Genus database with same CATH superfamily
2BHIA 2I9BE 2ABXA 1G6MA 1IDHA 3BT1U 4ZQYA 2J8BA 1HC9B 1MR6A 1NTXA 1RGJA 1UG4A 5EBXA 1TXAA 4EY8B 2MHYA 1H0JA 4IYEA 1CODA 1CDRA 1HAJA 3PLCA 2QJAC 1QM7A 1BTEA 1LXGA 1CTXA 2GOOB 1FF4A 1KU6B 2MJ0A 2H62D 3EBXA 2L03A 5IMYC 2QC1A 1IQ9A 1KBSA 2MFAA 2H64C 1CXNA 2HLRA 2H8UA 1ABTA 2BTXA 1MAHF 2OFSA 1ZADA 1CHVS 1JBDA 3NEQA 4DO8A 1I02A 1YWHA 1IK8A 1NYSA 1IDIA 1IJCA 2VLWA 1KBTA 2CRTA 2H5FA 1IDGA 1CRFA 4OM4A 1LX5B 3EVSC 3NH7A 1NEAA 4KSNA 1FRAA 3KFDE 1VB0A 2K3GA 2PJYB 2N99A 1KL8A 1TXBA 3NDSA 1CXOA 1ES7B 1XT3A 1RL5A 1S4YA 1KC4A 2FD6U 1QKEA 3VTSA 1KTZB 3FEVA 1NXBA 2H62C 1CDSA 2H7ZA 1LXHA 1W6BA 1FSSB 2JQPA 2MUOA 4P7UA 5DO6A 3U74U 4FAOE 1F94A 1HAAA 1TGXA 1LSIA 1CREA 1HC9A 2MJ4A 2H64B 1NYUA 4HQPF 4XJJA 4RUDA 1KBAA 1LJZA 1B41B 3BT2U 4AEAA 1CB9A 1IKCA 2CCXA 2CRSA 3LAQU 1NTNA 1IDLA 1TFSA 5DZ5A 2ERAA 2HLQA 3ERAA 3KFDI 1QKDA 4BDTB 4FAOC 1NORA 1DRSA 1ERAA 1PLOA 2QJBC 1HOYA 2NBTA 1CDTA 2CTXA 4LFTA 3HH7A 6EBXA 1ERGA 1REWC 1KFHA 1FASA 1M9ZA 2LA1A 2QJ9C 2PJYC 1KXIA 1FSCA 1V6PA 4OM5A 2JVEA 1KS6A 2GOOC 1CDQA 4QTIU 2L5SA 2MUPA 1JE9A 2X8BB 4UY2C 2UWRA 3QB4B 1COEA 3U73U 2UX2A 1F8UB 1CVOA 1JGKA 2MJYA 1ONJA 5IMTD 2LCRA 4BIKB 1BXPA 5DU1A 2H7ZB 2CDXA 1CCQA 1L4WA 1FFJA
chains in the Genus database with same CATH topology
2BHIA 2I9BE 2ABXA 1G6MA 1IDHA 3BT1U 4ZQYA 2J8BA 1HC9B 1MR6A 1NTXA 1RGJA 1UG4A 5EBXA 1TXAA 4EY8B 2MHYA 1H0JA 4IYEA 1CODA 1CDRA 1HAJA 3PLCA 2QJAC 1QM7A 1BTEA 1LXGA 1CTXA 2GOOB 1FF4A 1KU6B 2MJ0A 2H62D 3EBXA 2L03A 5IMYC 2QC1A 1IQ9A 1KBSA 2MFAA 2H64C 1CXNA 2HLRA 2H8UA 1ABTA 2BTXA 1MAHF 2OFSA 1ZADA 1CHVS 1JBDA 3NEQA 4DO8A 1I02A 1YWHA 1IK8A 1NYSA 1IDIA 1IJCA 2VLWA 1KBTA 2CRTA 2H5FA 1IDGA 1CRFA 4OM4A 1LX5B 3EVSC 3NH7A 1NEAA 4KSNA 1FRAA 3KFDE 1VB0A 2K3GA 2PJYB 2N99A 1KL8A 1TXBA 3NDSA 1CXOA 1ES7B 1XT3A 1RL5A 1S4YA 1KC4A 2FD6U 1QKEA 3VTSA 1KTZB 3FEVA 1NXBA 2H62C 1CDSA 2H7ZA 1LXHA 1W6BA 1FSSB 2JQPA 2MUOA 4P7UA 5DO6A 3U74U 4FAOE 1F94A 1HAAA 1TGXA 1LSIA 1CREA 1HC9A 2MJ4A 2H64B 1NYUA 4HQPF 4XJJA 4RUDA 1KBAA 1LJZA 1B41B 3BT2U 4AEAA 1CB9A 1IKCA 2CCXA 2CRSA 3LAQU 1NTNA 1IDLA 1TFSA 5DZ5A 2ERAA 2HLQA 3ERAA 3KFDI 1QKDA 4BDTB 4FAOC 1NORA 1DRSA 1ERAA 1PLOA 2QJBC 1HOYA 2NBTA 1CDTA 2CTXA 4LFTA 3HH7A 6EBXA 1ERGA 1REWC 1KFHA 1FASA 1M9ZA 2LA1A 2QJ9C 2PJYC 1KXIA 1FSCA 1V6PA 4OM5A 2JVEA 1KS6A 2GOOC 1CDQA 4QTIU 2L5SA 2MUPA 1JE9A 2X8BB 4UY2C 2UWRA 3QB4B 1COEA 3U73U 2UX2A 1F8UB 1CVOA 1JGKA 2MJYA 1ONJA 5IMTD 2LCRA 4BIKB 1BXPA 5DU1A 2H7ZB 2CDXA 1CCQA 1L4WA 1FFJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BHI A;  2I9B E;  2ABX A;  1G6M A;  1IDH A;  3BT1 U;  4ZQY A;  2J8B A;  1HC9 B;  1MR6 A;  1NTX A;  1RGJ A;  1UG4 A;  5EBX A;  1TXA A;  4EY8 B;  2MHY A;  1H0J A;  4IYE A;  1COD A;  1CDR A;  1HAJ A;  3PLC A;  2QJA C;  1QM7 A;  1BTE A;  1LXG A;  1CTX A;  2GOO B;  1FF4 A;  1KU6 B;  2MJ0 A;  2H62 D;  3EBX A;  2L03 A;  5IMY C;  2QC1 A;  1IQ9 A;  1KBS A;  2MFA A;  2H64 C;  1CXN A;  2HLR A;  2H8U A;  1ABT A;  2BTX A;  1MAH F;  2OFS A;  1ZAD A;  1CHV S;  1JBD A;  3NEQ A;  4DO8 A;  1I02 A;  1YWH A;  1IK8 A;  1NYS A;  1IDI A;  1IJC A;  2VLW A;  1KBT A;  2CRT A;  2H5F A;  1IDG A;  1CRF A;  4OM4 A;  1LX5 B;  3EVS C;  3NH7 A;  1NEA A;  1FRA A;  3KFD E;  1VB0 A;  2K3G A;  2PJY B;  2N99 A;  1KL8 A;  1TXB A;  3NDS A;  1CXO A;  1ES7 B;  1XT3 A;  1RL5 A;  1S4Y A;  1KC4 A;  2FD6 U;  1QKE A;  3VTS A;  1KTZ B;  3FEV A;  1NXB A;  2H62 C;  1CDS A;  2H7Z A;  1LXH A;  1W6B A;  1FSS B;  2JQP A;  2MUO A;  4P7U A;  5DO6 A;  3U74 U;  4FAO E;  1F94 A;  1HAA A;  1TGX A;  1LSI A;  1CRE A;  1HC9 A;  2MJ4 A;  2H64 B;  1NYU A;  4HQP F;  4XJJ A;  4RUD A;  1KBA A;  1LJZ A;  1B41 B;  3BT2 U;  4AEA A;  1CB9 A;  1IKC A;  2CCX A;  2CRS A;  3LAQ U;  1NTN A;  1IDL A;  1TFS A;  5DZ5 A;  2ERA A;  2HLQ A;  3ERA A;  3KFD I;  1QKD A;  4BDT B;  4FAO C;  1NOR A;  1DRS A;  1ERA A;  1PLO A;  2QJB C;  1HOY A;  2NBT A;  1CDT A;  2CTX A;  4LFT A;  3HH7 A;  6EBX A;  1ERG A;  1REW C;  1KFH A;  1FAS A;  1M9Z A;  2LA1 A;  2QJ9 C;  2PJY C;  1KXI A;  1FSC A;  1V6P A;  4OM5 A;  2JVE A;  1KS6 A;  2GOO C;  1CDQ A;  4QTI U;  2L5S A;  2MUP A;  1JE9 A;  2X8B B;  4UY2 C;  2UWR A;  3QB4 B;  1COE A;  3U73 U;  2UX2 A;  1F8U B;  1CVO A;  1JGK A;  2MJY A;  1ONJ A;  5IMT D;  2LCR A;  4BIK B;  1BXP A;  5DU1 A;  2H7Z B;  2CDX A;  1CCQ A;  1L4W A;  1FFJ A; 
#chains in the Genus database with same CATH topology
 2BHI A;  2I9B E;  2ABX A;  1G6M A;  1IDH A;  3BT1 U;  4ZQY A;  2J8B A;  1HC9 B;  1MR6 A;  1NTX A;  1RGJ A;  1UG4 A;  5EBX A;  1TXA A;  4EY8 B;  2MHY A;  1H0J A;  4IYE A;  1COD A;  1CDR A;  1HAJ A;  3PLC A;  2QJA C;  1QM7 A;  1BTE A;  1LXG A;  1CTX A;  2GOO B;  1FF4 A;  1KU6 B;  2MJ0 A;  2H62 D;  3EBX A;  2L03 A;  5IMY C;  2QC1 A;  1IQ9 A;  1KBS A;  2MFA A;  2H64 C;  1CXN A;  2HLR A;  2H8U A;  1ABT A;  2BTX A;  1MAH F;  2OFS A;  1ZAD A;  1CHV S;  1JBD A;  3NEQ A;  4DO8 A;  1I02 A;  1YWH A;  1IK8 A;  1NYS A;  1IDI A;  1IJC A;  2VLW A;  1KBT A;  2CRT A;  2H5F A;  1IDG A;  1CRF A;  4OM4 A;  1LX5 B;  3EVS C;  3NH7 A;  1NEA A;  4KSN A;  1FRA A;  3KFD E;  1VB0 A;  2K3G A;  2PJY B;  2N99 A;  1KL8 A;  1TXB A;  3NDS A;  1CXO A;  1ES7 B;  1XT3 A;  1RL5 A;  1S4Y A;  1KC4 A;  2FD6 U;  1QKE A;  3VTS A;  1KTZ B;  3FEV A;  1NXB A;  2H62 C;  1CDS A;  2H7Z A;  1LXH A;  1W6B A;  1FSS B;  2JQP A;  2MUO A;  4P7U A;  5DO6 A;  3U74 U;  4FAO E;  1F94 A;  1HAA A;  1TGX A;  1LSI A;  1CRE A;  1HC9 A;  2MJ4 A;  2H64 B;  1NYU A;  4HQP F;  4XJJ A;  4RUD A;  1KBA A;  1LJZ A;  1B41 B;  3BT2 U;  4AEA A;  1CB9 A;  1IKC A;  2CCX A;  2CRS A;  3LAQ U;  1NTN A;  1IDL A;  1TFS A;  5DZ5 A;  2ERA A;  2HLQ A;  3ERA A;  3KFD I;  1QKD A;  4BDT B;  4FAO C;  1NOR A;  1DRS A;  1ERA A;  1PLO A;  2QJB C;  1HOY A;  2NBT A;  1CDT A;  2CTX A;  4LFT A;  3HH7 A;  6EBX A;  1ERG A;  1REW C;  1KFH A;  1FAS A;  1M9Z A;  2LA1 A;  2QJ9 C;  2PJY C;  1KXI A;  1FSC A;  1V6P A;  4OM5 A;  2JVE A;  1KS6 A;  2GOO C;  1CDQ A;  4QTI U;  2L5S A;  2MUP A;  1JE9 A;  2X8B B;  4UY2 C;  2UWR A;  3QB4 B;  1COE A;  3U73 U;  2UX2 A;  1F8U B;  1CVO A;  1JGK A;  2MJY A;  1ONJ A;  5IMT D;  2LCR A;  4BIK B;  1BXP A;  5DU1 A;  2H7Z B;  2CDX A;  1CCQ A;  1L4W A;  1FFJ A; 
#chains in the Genus database with same CATH homology
 2BHI A;  2I9B E;  2ABX A;  1G6M A;  1IDH A;  3BT1 U;  4ZQY A;  2J8B A;  1HC9 B;  1MR6 A;  1NTX A;  1RGJ A;  1UG4 A;  5EBX A;  1TXA A;  4EY8 B;  2MHY A;  1H0J A;  4IYE A;  1COD A;  1CDR A;  1HAJ A;  3PLC A;  2QJA C;  1QM7 A;  1BTE A;  1LXG A;  1CTX A;  2GOO B;  1FF4 A;  1KU6 B;  2MJ0 A;  2H62 D;  3EBX A;  2L03 A;  5IMY C;  2QC1 A;  1IQ9 A;  1KBS A;  2MFA A;  2H64 C;  1CXN A;  2HLR A;  2H8U A;  1ABT A;  2BTX A;  1MAH F;  2OFS A;  1ZAD A;  1CHV S;  1JBD A;  3NEQ A;  4DO8 A;  1I02 A;  1YWH A;  1IK8 A;  1NYS A;  1IDI A;  1IJC A;  2VLW A;  1KBT A;  2CRT A;  2H5F A;  1IDG A;  1CRF A;  4OM4 A;  1LX5 B;  3EVS C;  3NH7 A;  1NEA A;  4KSN A;  1FRA A;  3KFD E;  1VB0 A;  2K3G A;  2PJY B;  2N99 A;  1KL8 A;  1TXB A;  3NDS A;  1CXO A;  1ES7 B;  1XT3 A;  1RL5 A;  1S4Y A;  1KC4 A;  2FD6 U;  1QKE A;  3VTS A;  1KTZ B;  3FEV A;  1NXB A;  2H62 C;  1CDS A;  2H7Z A;  1LXH A;  1W6B A;  1FSS B;  2JQP A;  2MUO A;  4P7U A;  5DO6 A;  3U74 U;  4FAO E;  1F94 A;  1HAA A;  1TGX A;  1LSI A;  1CRE A;  1HC9 A;  2MJ4 A;  2H64 B;  1NYU A;  4HQP F;  4XJJ A;  4RUD A;  1KBA A;  1LJZ A;  1B41 B;  3BT2 U;  4AEA A;  1CB9 A;  1IKC A;  2CCX A;  2CRS A;  3LAQ U;  1NTN A;  1IDL A;  1TFS A;  5DZ5 A;  2ERA A;  2HLQ A;  3ERA A;  3KFD I;  1QKD A;  4BDT B;  4FAO C;  1NOR A;  1DRS A;  1ERA A;  1PLO A;  2QJB C;  1HOY A;  2NBT A;  1CDT A;  2CTX A;  4LFT A;  3HH7 A;  6EBX A;  1ERG A;  1REW C;  1KFH A;  1FAS A;  1M9Z A;  2LA1 A;  2QJ9 C;  2PJY C;  1KXI A;  1FSC A;  1V6P A;  4OM5 A;  2JVE A;  1KS6 A;  2GOO C;  1CDQ A;  4QTI U;  2L5S A;  2MUP A;  1JE9 A;  2X8B B;  4UY2 C;  2UWR A;  3QB4 B;  1COE A;  3U73 U;  2UX2 A;  1F8U B;  1CVO A;  1JGK A;  2MJY A;  1ONJ A;  5IMT D;  2LCR A;  4BIK B;  1BXP A;  5DU1 A;  2H7Z B;  2CDX A;  1CCQ A;  1L4W A;  1FFJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...