1IK8A

Nmr structure of alpha-bungarotoxin
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
74
structure length
74
Chain Sequence
IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LONG NEUROTOXIN 1
publication title NMR structure of alpha-bungarotoxin free and bound to a mimotope of the nicotinic acetylcholine receptor.
pubmed doi rcsb
molecule tags Toxin
total genus 5
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2001-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1ik8A00
4P7UA 2PJYB 1QM7A 1NYUA 3ERAA 1G6MA 1KTZB 3NDSA 4OM4A 3U73U 2UX2A 1CTXA 4BIKB 4OM5A 1CRFA 3VTSA 2CCXA 2BTXA 3EVSC 2MHYA 1NORA 1KU6B 2ERAA 2CRSA 5DO6A 1ES7B 1REWC 1CXOA 2H5FA 3PLCA 1KC4A 3QB4B 1H0JA 1FSSB 2J8BA 1NYSA 2FD6U 3BT1U 2BHIA 5DU1A 1KFHA 1ERAA 2H7ZA 1IK8A 1M9ZA 1HC9A 1NEAA 1JBDA 1CDTA 1PLOA 1HAAA 2MUOA 1LJZA 1TFSA 2MUPA 4DO8A 2K3GA 2HLQA 1CREA 1CDSA 1VB0A 1IDLA 2H62D 2VLWA 1FF4A 2MJ4A 1F8UB 3FEVA 1KXIA 1BXPA 1JE9A 2HLRA 4LFTA 1IKCA 1CODA 1RGJA 1W6BA 1YWHA 1IQ9A 1KBTA 1CB9A 1NTNA 2N99A 1KL8A 1HAJA 5IMTD 1ERGA 1ZADA 6EBXA 1FFJA 1TGXA 1NXBA 1MAHF 2ABXA 2JVEA 4FAOE 1TXAA 3BT2U 2NBTA 5IMYC 4BDTB 1ONJA 1HOYA 1S4YA 3NH7A 1HC9B 1COEA 1CXNA 4AEAA 1UG4A 1IDGA 5DZ5A 1CHVS 1CVOA 1B41B 2GOOC 1LX5B 1BTEA 2L5SA 4XJJA 2I9BE 2L03A 4EY8B 2CRTA 1LXGA 1JGKA 3KFDE 4RUDA 1L4WA 2MJ0A 1CCQA 3HH7A 1TXBA 2H64C 2GOOB 1FRAA 4FAOC 1FASA 2MFAA 1KBSA 1QKDA 2X8BB 1I02A 1NTXA 5EBXA 2OFSA 2UWRA 1F94A 1IDIA 1RL5A 1QKEA 1LXHA 2H64B 2QJAC 4ZQYA 1DRSA 2H7ZB 2LA1A 2MJYA 1KS6A 2CTXA 1ABTA 3KFDI 4QTIU 4HQPF 2JQPA 2QC1A 3U74U 1LSIA 2PJYC 2QJBC 1V6PA 1IDHA 1FSCA 2CDXA 1CDRA 3NEQA 4UY2C 1MR6A 1CDQA 4IYEA 3LAQU 1XT3A 2H8UA 2QJ9C 2LCRA 2H62C 3EBXA 1IJCA 1KBAA
chains in the Genus database with same CATH superfamily
4P7UA 2PJYB 1QM7A 1NYUA 3ERAA 1G6MA 1KTZB 3NDSA 4OM4A 3U73U 2UX2A 1CTXA 4BIKB 4OM5A 1CRFA 3VTSA 2CCXA 2BTXA 3EVSC 2MHYA 1NORA 1KU6B 2ERAA 2CRSA 5DO6A 1ES7B 1REWC 1CXOA 2H5FA 3PLCA 1KC4A 3QB4B 1H0JA 1FSSB 2J8BA 1NYSA 2FD6U 3BT1U 2BHIA 5DU1A 1KFHA 1ERAA 2H7ZA 1IK8A 1M9ZA 1HC9A 1NEAA 1JBDA 1CDTA 1PLOA 1HAAA 2MUOA 1LJZA 1TFSA 2MUPA 4DO8A 2K3GA 4KSNA 2HLQA 1CREA 1CDSA 1VB0A 1IDLA 2H62D 2VLWA 1FF4A 2MJ4A 1F8UB 3FEVA 1KXIA 1BXPA 1JE9A 2HLRA 4LFTA 1IKCA 1CODA 1RGJA 1W6BA 1YWHA 1IQ9A 1KBTA 1CB9A 1NTNA 2N99A 1KL8A 1HAJA 5IMTD 1ERGA 1ZADA 6EBXA 1FFJA 1TGXA 1NXBA 1MAHF 2ABXA 2JVEA 4FAOE 1TXAA 3BT2U 2NBTA 5IMYC 4BDTB 1ONJA 1HOYA 1S4YA 3NH7A 1HC9B 1COEA 1CXNA 4AEAA 1UG4A 1IDGA 5DZ5A 1CHVS 1CVOA 1B41B 2GOOC 1LX5B 1BTEA 2L5SA 4XJJA 2I9BE 2L03A 4EY8B 2CRTA 1LXGA 1JGKA 3KFDE 4RUDA 1L4WA 2MJ0A 1CCQA 3HH7A 1TXBA 2H64C 2GOOB 1FRAA 4FAOC 1FASA 2MFAA 1KBSA 1QKDA 2X8BB 1I02A 1NTXA 5EBXA 2OFSA 2UWRA 1F94A 1IDIA 1RL5A 1QKEA 1LXHA 2H64B 2QJAC 4ZQYA 1DRSA 2H7ZB 2LA1A 2MJYA 1KS6A 2CTXA 1ABTA 3KFDI 4QTIU 4HQPF 2JQPA 2QC1A 3U74U 1LSIA 2PJYC 2QJBC 1V6PA 1IDHA 1FSCA 2CDXA 1CDRA 3NEQA 4UY2C 1MR6A 1CDQA 4IYEA 3LAQU 1XT3A 2H8UA 2QJ9C 2LCRA 2H62C 3EBXA 1IJCA 1KBAA
chains in the Genus database with same CATH topology
4P7UA 2PJYB 1QM7A 1NYUA 3ERAA 1G6MA 1KTZB 3NDSA 4OM4A 3U73U 2UX2A 1CTXA 4BIKB 4OM5A 1CRFA 3VTSA 2CCXA 2BTXA 3EVSC 2MHYA 1NORA 1KU6B 2ERAA 2CRSA 5DO6A 1ES7B 1REWC 1CXOA 2H5FA 3PLCA 1KC4A 3QB4B 1H0JA 1FSSB 2J8BA 1NYSA 2FD6U 3BT1U 2BHIA 5DU1A 1KFHA 1ERAA 2H7ZA 1IK8A 1M9ZA 1HC9A 1NEAA 1JBDA 1CDTA 1PLOA 1HAAA 2MUOA 1LJZA 1TFSA 2MUPA 4DO8A 2K3GA 4KSNA 2HLQA 1CREA 1CDSA 1VB0A 1IDLA 2H62D 2VLWA 1FF4A 2MJ4A 1F8UB 3FEVA 1KXIA 1BXPA 1JE9A 2HLRA 4LFTA 1IKCA 1CODA 1RGJA 1W6BA 1YWHA 1IQ9A 1KBTA 1CB9A 1NTNA 2N99A 1KL8A 1HAJA 5IMTD 1ERGA 1ZADA 6EBXA 1FFJA 1TGXA 1NXBA 1MAHF 2ABXA 2JVEA 4FAOE 1TXAA 3BT2U 2NBTA 5IMYC 4BDTB 1ONJA 1HOYA 1S4YA 3NH7A 1HC9B 1COEA 1CXNA 4AEAA 1UG4A 1IDGA 5DZ5A 1CHVS 1CVOA 1B41B 2GOOC 1LX5B 1BTEA 2L5SA 4XJJA 2I9BE 2L03A 4EY8B 2CRTA 1LXGA 1JGKA 3KFDE 4RUDA 1L4WA 2MJ0A 1CCQA 3HH7A 1TXBA 2H64C 2GOOB 1FRAA 4FAOC 1FASA 2MFAA 1KBSA 1QKDA 2X8BB 1I02A 1NTXA 5EBXA 2OFSA 2UWRA 1F94A 1IDIA 1RL5A 1QKEA 1LXHA 2H64B 2QJAC 4ZQYA 1DRSA 2H7ZB 2LA1A 2MJYA 1KS6A 2CTXA 1ABTA 3KFDI 4QTIU 4HQPF 2JQPA 2QC1A 3U74U 1LSIA 2PJYC 2QJBC 1V6PA 1IDHA 1FSCA 2CDXA 1CDRA 3NEQA 4UY2C 1MR6A 1CDQA 4IYEA 3LAQU 1XT3A 2H8UA 2QJ9C 2LCRA 2H62C 3EBXA 1IJCA 1KBAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P7U A;  2PJY B;  1QM7 A;  1NYU A;  3ERA A;  1G6M A;  1KTZ B;  3NDS A;  4OM4 A;  3U73 U;  2UX2 A;  1CTX A;  4BIK B;  4OM5 A;  1CRF A;  3VTS A;  2CCX A;  2BTX A;  3EVS C;  2MHY A;  1NOR A;  1KU6 B;  2ERA A;  2CRS A;  5DO6 A;  1ES7 B;  1REW C;  1CXO A;  2H5F A;  3PLC A;  1KC4 A;  3QB4 B;  1H0J A;  1FSS B;  2J8B A;  1NYS A;  2FD6 U;  3BT1 U;  2BHI A;  5DU1 A;  1KFH A;  1ERA A;  2H7Z A;  1IK8 A;  1M9Z A;  1HC9 A;  1NEA A;  1JBD A;  1CDT A;  1PLO A;  1HAA A;  2MUO A;  1LJZ A;  1TFS A;  2MUP A;  4DO8 A;  2K3G A;  2HLQ A;  1CRE A;  1CDS A;  1VB0 A;  1IDL A;  2H62 D;  2VLW A;  1FF4 A;  2MJ4 A;  1F8U B;  3FEV A;  1KXI A;  1BXP A;  1JE9 A;  2HLR A;  4LFT A;  1IKC A;  1COD A;  1RGJ A;  1W6B A;  1YWH A;  1IQ9 A;  1KBT A;  1CB9 A;  1NTN A;  2N99 A;  1KL8 A;  1HAJ A;  5IMT D;  1ERG A;  1ZAD A;  6EBX A;  1FFJ A;  1TGX A;  1NXB A;  1MAH F;  2ABX A;  2JVE A;  4FAO E;  1TXA A;  3BT2 U;  2NBT A;  5IMY C;  4BDT B;  1ONJ A;  1HOY A;  1S4Y A;  3NH7 A;  1HC9 B;  1COE A;  1CXN A;  4AEA A;  1UG4 A;  1IDG A;  5DZ5 A;  1CHV S;  1CVO A;  1B41 B;  2GOO C;  1LX5 B;  1BTE A;  2L5S A;  4XJJ A;  2I9B E;  2L03 A;  4EY8 B;  2CRT A;  1LXG A;  1JGK A;  3KFD E;  4RUD A;  1L4W A;  2MJ0 A;  1CCQ A;  3HH7 A;  1TXB A;  2H64 C;  2GOO B;  1FRA A;  4FAO C;  1FAS A;  2MFA A;  1KBS A;  1QKD A;  2X8B B;  1I02 A;  1NTX A;  5EBX A;  2OFS A;  2UWR A;  1F94 A;  1IDI A;  1RL5 A;  1QKE A;  1LXH A;  2H64 B;  2QJA C;  4ZQY A;  1DRS A;  2H7Z B;  2LA1 A;  2MJY A;  1KS6 A;  2CTX A;  1ABT A;  3KFD I;  4QTI U;  4HQP F;  2JQP A;  2QC1 A;  3U74 U;  1LSI A;  2PJY C;  2QJB C;  1V6P A;  1IDH A;  1FSC A;  2CDX A;  1CDR A;  3NEQ A;  4UY2 C;  1MR6 A;  1CDQ A;  4IYE A;  3LAQ U;  1XT3 A;  2H8U A;  2QJ9 C;  2LCR A;  2H62 C;  3EBX A;  1IJC A;  1KBA A; 
#chains in the Genus database with same CATH topology
 4P7U A;  2PJY B;  1QM7 A;  1NYU A;  3ERA A;  1G6M A;  1KTZ B;  3NDS A;  4OM4 A;  3U73 U;  2UX2 A;  1CTX A;  4BIK B;  4OM5 A;  1CRF A;  3VTS A;  2CCX A;  2BTX A;  3EVS C;  2MHY A;  1NOR A;  1KU6 B;  2ERA A;  2CRS A;  5DO6 A;  1ES7 B;  1REW C;  1CXO A;  2H5F A;  3PLC A;  1KC4 A;  3QB4 B;  1H0J A;  1FSS B;  2J8B A;  1NYS A;  2FD6 U;  3BT1 U;  2BHI A;  5DU1 A;  1KFH A;  1ERA A;  2H7Z A;  1IK8 A;  1M9Z A;  1HC9 A;  1NEA A;  1JBD A;  1CDT A;  1PLO A;  1HAA A;  2MUO A;  1LJZ A;  1TFS A;  2MUP A;  4DO8 A;  2K3G A;  4KSN A;  2HLQ A;  1CRE A;  1CDS A;  1VB0 A;  1IDL A;  2H62 D;  2VLW A;  1FF4 A;  2MJ4 A;  1F8U B;  3FEV A;  1KXI A;  1BXP A;  1JE9 A;  2HLR A;  4LFT A;  1IKC A;  1COD A;  1RGJ A;  1W6B A;  1YWH A;  1IQ9 A;  1KBT A;  1CB9 A;  1NTN A;  2N99 A;  1KL8 A;  1HAJ A;  5IMT D;  1ERG A;  1ZAD A;  6EBX A;  1FFJ A;  1TGX A;  1NXB A;  1MAH F;  2ABX A;  2JVE A;  4FAO E;  1TXA A;  3BT2 U;  2NBT A;  5IMY C;  4BDT B;  1ONJ A;  1HOY A;  1S4Y A;  3NH7 A;  1HC9 B;  1COE A;  1CXN A;  4AEA A;  1UG4 A;  1IDG A;  5DZ5 A;  1CHV S;  1CVO A;  1B41 B;  2GOO C;  1LX5 B;  1BTE A;  2L5S A;  4XJJ A;  2I9B E;  2L03 A;  4EY8 B;  2CRT A;  1LXG A;  1JGK A;  3KFD E;  4RUD A;  1L4W A;  2MJ0 A;  1CCQ A;  3HH7 A;  1TXB A;  2H64 C;  2GOO B;  1FRA A;  4FAO C;  1FAS A;  2MFA A;  1KBS A;  1QKD A;  2X8B B;  1I02 A;  1NTX A;  5EBX A;  2OFS A;  2UWR A;  1F94 A;  1IDI A;  1RL5 A;  1QKE A;  1LXH A;  2H64 B;  2QJA C;  4ZQY A;  1DRS A;  2H7Z B;  2LA1 A;  2MJY A;  1KS6 A;  2CTX A;  1ABT A;  3KFD I;  4QTI U;  4HQP F;  2JQP A;  2QC1 A;  3U74 U;  1LSI A;  2PJY C;  2QJB C;  1V6P A;  1IDH A;  1FSC A;  2CDX A;  1CDR A;  3NEQ A;  4UY2 C;  1MR6 A;  1CDQ A;  4IYE A;  3LAQ U;  1XT3 A;  2H8U A;  2QJ9 C;  2LCR A;  2H62 C;  3EBX A;  1IJC A;  1KBA A; 
#chains in the Genus database with same CATH homology
 4P7U A;  2PJY B;  1QM7 A;  1NYU A;  3ERA A;  1G6M A;  1KTZ B;  3NDS A;  4OM4 A;  3U73 U;  2UX2 A;  1CTX A;  4BIK B;  4OM5 A;  1CRF A;  3VTS A;  2CCX A;  2BTX A;  3EVS C;  2MHY A;  1NOR A;  1KU6 B;  2ERA A;  2CRS A;  5DO6 A;  1ES7 B;  1REW C;  1CXO A;  2H5F A;  3PLC A;  1KC4 A;  3QB4 B;  1H0J A;  1FSS B;  2J8B A;  1NYS A;  2FD6 U;  3BT1 U;  2BHI A;  5DU1 A;  1KFH A;  1ERA A;  2H7Z A;  1IK8 A;  1M9Z A;  1HC9 A;  1NEA A;  1JBD A;  1CDT A;  1PLO A;  1HAA A;  2MUO A;  1LJZ A;  1TFS A;  2MUP A;  4DO8 A;  2K3G A;  4KSN A;  2HLQ A;  1CRE A;  1CDS A;  1VB0 A;  1IDL A;  2H62 D;  2VLW A;  1FF4 A;  2MJ4 A;  1F8U B;  3FEV A;  1KXI A;  1BXP A;  1JE9 A;  2HLR A;  4LFT A;  1IKC A;  1COD A;  1RGJ A;  1W6B A;  1YWH A;  1IQ9 A;  1KBT A;  1CB9 A;  1NTN A;  2N99 A;  1KL8 A;  1HAJ A;  5IMT D;  1ERG A;  1ZAD A;  6EBX A;  1FFJ A;  1TGX A;  1NXB A;  1MAH F;  2ABX A;  2JVE A;  4FAO E;  1TXA A;  3BT2 U;  2NBT A;  5IMY C;  4BDT B;  1ONJ A;  1HOY A;  1S4Y A;  3NH7 A;  1HC9 B;  1COE A;  1CXN A;  4AEA A;  1UG4 A;  1IDG A;  5DZ5 A;  1CHV S;  1CVO A;  1B41 B;  2GOO C;  1LX5 B;  1BTE A;  2L5S A;  4XJJ A;  2I9B E;  2L03 A;  4EY8 B;  2CRT A;  1LXG A;  1JGK A;  3KFD E;  4RUD A;  1L4W A;  2MJ0 A;  1CCQ A;  3HH7 A;  1TXB A;  2H64 C;  2GOO B;  1FRA A;  4FAO C;  1FAS A;  2MFA A;  1KBS A;  1QKD A;  2X8B B;  1I02 A;  1NTX A;  5EBX A;  2OFS A;  2UWR A;  1F94 A;  1IDI A;  1RL5 A;  1QKE A;  1LXH A;  2H64 B;  2QJA C;  4ZQY A;  1DRS A;  2H7Z B;  2LA1 A;  2MJY A;  1KS6 A;  2CTX A;  1ABT A;  3KFD I;  4QTI U;  4HQP F;  2JQP A;  2QC1 A;  3U74 U;  1LSI A;  2PJY C;  2QJB C;  1V6P A;  1IDH A;  1FSC A;  2CDX A;  1CDR A;  3NEQ A;  4UY2 C;  1MR6 A;  1CDQ A;  4IYE A;  3LAQ U;  1XT3 A;  2H8U A;  2QJ9 C;  2LCR A;  2H62 C;  3EBX A;  1IJC A;  1KBA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...