1IK8A

Nmr structure of alpha-bungarotoxin
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
74
structure length
74
Chain Sequence
IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structure of alpha-bungarotoxin free and bound to a mimotope of the nicotinic acetylcholine receptor.
pubmed doi rcsb
molecule tags Toxin
molecule keywords LONG NEUROTOXIN 1
total genus 5
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2001-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1ik8A00
1MAHF 1L4WA 1REWC 1TXAA 3HH7A 1TFSA 4ZQYA 1IDLA 1JBDA 1FASA 1CDSA 1W6BA 1HAJA 2PJYB 1B41B 2X8BB 4QTIU 2MHYA 2QJBC 2UWRA 1CDRA 3FEVA 1UG4A 1QKEA 1IDGA 1HC9A 4DO8A 1NYSA 1MR6A 1FFJA 2H64B 2QJ9C 1V6PA 1KS6A 3NEQA 2MJ0A 1KTZB 1H0JA 1LJZA 1CDQA 2NBTA 1KU6B 2MJYA 2CRTA 1F8UB 1FF4A 4OM5A 1IQ9A 1HAAA 2J8BA 1BTEA 2CDXA 3NH7A 1G6MA 2HLQA 2OFSA 1KL8A 3KFDE 2VLWA 1NORA 1QKDA 1YWHA 1VB0A 1RL5A 4AEAA 3EBXA 2ERAA 1KFHA 1ZADA 1RGJA 4FAOC 1I02A 2H7ZB 1NXBA 1IKCA 1CTXA 1CODA 2CCXA 2MFAA 4UY2C 3BT2U 2CTXA 5EBXA 4BDTB 1FRAA 1PLOA 1HC9B 3NDSA 1FSCA 1LXHA 5DO6A 3VTSA 1F94A 1CVOA 4XJJA 1DRSA 1BXPA 3QB4B 5IMYC 1NTNA 1TXBA 1NYUA 4IYEA 2MJ4A 1NEAA 2MUPA 2JQPA 2N99A 1LXGA 1TGXA 2BHIA 2L5SA 1CXNA 2H8UA 3KFDI 3ERAA 2LCRA 2L03A 2PJYC 2QJAC 3PLCA 1NTXA 1ES7B 3U74U 2BTXA 1CDTA 2GOOB 3LAQU 3EVSC 3U73U 1LX5B 4P7UA 1KC4A 5DU1A 1XT3A 2FD6U 2H7ZA 2K3GA 3BT1U 1IJCA 2ABXA 2UX2A 1CHVS 1ERGA 2HLRA 2GOOC 1CXOA 1ONJA 1ABTA 2H64C 1IDHA 1CRFA 1M9ZA 1IK8A 1FSSB 2JVEA 2H5FA 2MUOA 4RUDA 1QM7A 1JE9A 2H62D 4OM4A 1LSIA 1ERAA 1KBSA 1CB9A 4HQPF 1JGKA 2LA1A 1CCQA 2H62C 4EY8B 4BIKB 1KBAA 1KXIA 5IMTD 4LFTA 6EBXA 4FAOE 1CREA 1COEA 1S4YA 2I9BE 1IDIA 1HOYA 2QC1A 5DZ5A 1KBTA 2CRSA
chains in the Genus database with same CATH superfamily
1MAHF 1L4WA 1REWC 1TXAA 3HH7A 1TFSA 4ZQYA 1IDLA 1JBDA 1FASA 1CDSA 1W6BA 1HAJA 2PJYB 1B41B 2X8BB 4QTIU 2MHYA 2QJBC 2UWRA 1CDRA 3FEVA 1UG4A 1QKEA 1IDGA 1HC9A 4DO8A 1NYSA 1MR6A 1FFJA 2H64B 2QJ9C 1V6PA 1KS6A 3NEQA 2MJ0A 1KTZB 1H0JA 1LJZA 1CDQA 2NBTA 1KU6B 2MJYA 2CRTA 1F8UB 1FF4A 4OM5A 1IQ9A 1HAAA 2J8BA 1BTEA 2CDXA 3NH7A 1G6MA 2HLQA 2OFSA 1KL8A 3KFDE 2VLWA 1NORA 1QKDA 1YWHA 1VB0A 1RL5A 4AEAA 3EBXA 2ERAA 1KFHA 1ZADA 1RGJA 4FAOC 1I02A 2H7ZB 1NXBA 1IKCA 1CTXA 1CODA 2CCXA 2MFAA 4UY2C 3BT2U 2CTXA 5EBXA 4BDTB 1FRAA 1PLOA 1HC9B 3NDSA 1FSCA 1LXHA 5DO6A 3VTSA 1F94A 1CVOA 4XJJA 1DRSA 1BXPA 3QB4B 5IMYC 1NTNA 1TXBA 1NYUA 4IYEA 2MJ4A 1NEAA 2MUPA 2JQPA 2N99A 1LXGA 1TGXA 2BHIA 2L5SA 1CXNA 2H8UA 3KFDI 3ERAA 2LCRA 2L03A 2PJYC 2QJAC 3PLCA 1NTXA 1ES7B 3U74U 2BTXA 1CDTA 2GOOB 3LAQU 3EVSC 3U73U 1LX5B 4P7UA 1KC4A 5DU1A 1XT3A 2FD6U 2H7ZA 2K3GA 3BT1U 1IJCA 2ABXA 2UX2A 1CHVS 1ERGA 2HLRA 2GOOC 1CXOA 1ONJA 1ABTA 2H64C 1IDHA 1CRFA 1M9ZA 1IK8A 1FSSB 2JVEA 2H5FA 2MUOA 4RUDA 1QM7A 1JE9A 2H62D 4OM4A 1LSIA 1ERAA 1KBSA 1CB9A 4HQPF 1JGKA 2LA1A 1CCQA 2H62C 4KSNA 4EY8B 4BIKB 1KBAA 1KXIA 5IMTD 4LFTA 6EBXA 4FAOE 1CREA 1COEA 1S4YA 2I9BE 1IDIA 1HOYA 2QC1A 5DZ5A 1KBTA 2CRSA
chains in the Genus database with same CATH topology
1MAHF 1L4WA 1REWC 1TXAA 3HH7A 1TFSA 4ZQYA 1IDLA 1JBDA 1FASA 1CDSA 1W6BA 1HAJA 2PJYB 1B41B 2X8BB 4QTIU 2MHYA 2QJBC 2UWRA 1CDRA 3FEVA 1UG4A 1QKEA 1IDGA 1HC9A 4DO8A 1NYSA 1MR6A 1FFJA 2H64B 2QJ9C 1V6PA 1KS6A 3NEQA 2MJ0A 1KTZB 1H0JA 1LJZA 1CDQA 2NBTA 1KU6B 2MJYA 2CRTA 1F8UB 1FF4A 4OM5A 1IQ9A 1HAAA 2J8BA 1BTEA 2CDXA 3NH7A 1G6MA 2HLQA 2OFSA 1KL8A 3KFDE 2VLWA 1NORA 1QKDA 1YWHA 1VB0A 1RL5A 4AEAA 3EBXA 2ERAA 1KFHA 1ZADA 1RGJA 4FAOC 1I02A 2H7ZB 1NXBA 1IKCA 1CTXA 1CODA 2CCXA 2MFAA 4UY2C 3BT2U 2CTXA 5EBXA 4BDTB 1FRAA 1PLOA 1HC9B 3NDSA 1FSCA 1LXHA 5DO6A 3VTSA 1F94A 1CVOA 4XJJA 1DRSA 1BXPA 3QB4B 5IMYC 1NTNA 1TXBA 1NYUA 4IYEA 2MJ4A 1NEAA 2MUPA 2JQPA 2N99A 1LXGA 1TGXA 2BHIA 2L5SA 1CXNA 2H8UA 3KFDI 3ERAA 2LCRA 2L03A 2PJYC 2QJAC 3PLCA 1NTXA 1ES7B 3U74U 2BTXA 1CDTA 2GOOB 3LAQU 3EVSC 3U73U 1LX5B 4P7UA 1KC4A 5DU1A 1XT3A 2FD6U 2H7ZA 2K3GA 3BT1U 1IJCA 2ABXA 2UX2A 1CHVS 1ERGA 2HLRA 2GOOC 1CXOA 1ONJA 1ABTA 2H64C 1IDHA 1CRFA 1M9ZA 1IK8A 1FSSB 2JVEA 2H5FA 2MUOA 4RUDA 1QM7A 1JE9A 2H62D 4OM4A 1LSIA 1ERAA 1KBSA 1CB9A 4HQPF 1JGKA 2LA1A 1CCQA 2H62C 4KSNA 4EY8B 4BIKB 1KBAA 1KXIA 5IMTD 4LFTA 6EBXA 4FAOE 1CREA 1COEA 1S4YA 2I9BE 1IDIA 1HOYA 2QC1A 5DZ5A 1KBTA 2CRSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MAH F;  1L4W A;  1REW C;  1TXA A;  3HH7 A;  1TFS A;  4ZQY A;  1IDL A;  1JBD A;  1FAS A;  1CDS A;  1W6B A;  1HAJ A;  2PJY B;  1B41 B;  2X8B B;  4QTI U;  2MHY A;  2QJB C;  2UWR A;  1CDR A;  3FEV A;  1UG4 A;  1QKE A;  1IDG A;  1HC9 A;  4DO8 A;  1NYS A;  1MR6 A;  1FFJ A;  2H64 B;  2QJ9 C;  1V6P A;  1KS6 A;  3NEQ A;  2MJ0 A;  1KTZ B;  1H0J A;  1LJZ A;  1CDQ A;  2NBT A;  1KU6 B;  2MJY A;  2CRT A;  1F8U B;  1FF4 A;  4OM5 A;  1IQ9 A;  1HAA A;  2J8B A;  1BTE A;  2CDX A;  3NH7 A;  1G6M A;  2HLQ A;  2OFS A;  1KL8 A;  3KFD E;  2VLW A;  1NOR A;  1QKD A;  1YWH A;  1VB0 A;  1RL5 A;  4AEA A;  3EBX A;  2ERA A;  1KFH A;  1ZAD A;  1RGJ A;  4FAO C;  1I02 A;  2H7Z B;  1NXB A;  1IKC A;  1CTX A;  1COD A;  2CCX A;  2MFA A;  4UY2 C;  3BT2 U;  2CTX A;  5EBX A;  4BDT B;  1FRA A;  1PLO A;  1HC9 B;  3NDS A;  1FSC A;  1LXH A;  5DO6 A;  3VTS A;  1F94 A;  1CVO A;  4XJJ A;  1DRS A;  1BXP A;  3QB4 B;  5IMY C;  1NTN A;  1TXB A;  1NYU A;  4IYE A;  2MJ4 A;  1NEA A;  2MUP A;  2JQP A;  2N99 A;  1LXG A;  1TGX A;  2BHI A;  2L5S A;  1CXN A;  2H8U A;  3KFD I;  3ERA A;  2LCR A;  2L03 A;  2PJY C;  2QJA C;  3PLC A;  1NTX A;  1ES7 B;  3U74 U;  2BTX A;  1CDT A;  2GOO B;  3LAQ U;  3EVS C;  3U73 U;  1LX5 B;  4P7U A;  1KC4 A;  5DU1 A;  1XT3 A;  2FD6 U;  2H7Z A;  2K3G A;  3BT1 U;  1IJC A;  2ABX A;  2UX2 A;  1CHV S;  1ERG A;  2HLR A;  2GOO C;  1CXO A;  1ONJ A;  1ABT A;  2H64 C;  1IDH A;  1CRF A;  1M9Z A;  1IK8 A;  1FSS B;  2JVE A;  2H5F A;  2MUO A;  4RUD A;  1QM7 A;  1JE9 A;  2H62 D;  4OM4 A;  1LSI A;  1ERA A;  1KBS A;  1CB9 A;  4HQP F;  1JGK A;  2LA1 A;  1CCQ A;  2H62 C;  4EY8 B;  4BIK B;  1KBA A;  1KXI A;  5IMT D;  4LFT A;  6EBX A;  4FAO E;  1CRE A;  1COE A;  1S4Y A;  2I9B E;  1IDI A;  1HOY A;  2QC1 A;  5DZ5 A;  1KBT A;  2CRS A; 
#chains in the Genus database with same CATH topology
 1MAH F;  1L4W A;  1REW C;  1TXA A;  3HH7 A;  1TFS A;  4ZQY A;  1IDL A;  1JBD A;  1FAS A;  1CDS A;  1W6B A;  1HAJ A;  2PJY B;  1B41 B;  2X8B B;  4QTI U;  2MHY A;  2QJB C;  2UWR A;  1CDR A;  3FEV A;  1UG4 A;  1QKE A;  1IDG A;  1HC9 A;  4DO8 A;  1NYS A;  1MR6 A;  1FFJ A;  2H64 B;  2QJ9 C;  1V6P A;  1KS6 A;  3NEQ A;  2MJ0 A;  1KTZ B;  1H0J A;  1LJZ A;  1CDQ A;  2NBT A;  1KU6 B;  2MJY A;  2CRT A;  1F8U B;  1FF4 A;  4OM5 A;  1IQ9 A;  1HAA A;  2J8B A;  1BTE A;  2CDX A;  3NH7 A;  1G6M A;  2HLQ A;  2OFS A;  1KL8 A;  3KFD E;  2VLW A;  1NOR A;  1QKD A;  1YWH A;  1VB0 A;  1RL5 A;  4AEA A;  3EBX A;  2ERA A;  1KFH A;  1ZAD A;  1RGJ A;  4FAO C;  1I02 A;  2H7Z B;  1NXB A;  1IKC A;  1CTX A;  1COD A;  2CCX A;  2MFA A;  4UY2 C;  3BT2 U;  2CTX A;  5EBX A;  4BDT B;  1FRA A;  1PLO A;  1HC9 B;  3NDS A;  1FSC A;  1LXH A;  5DO6 A;  3VTS A;  1F94 A;  1CVO A;  4XJJ A;  1DRS A;  1BXP A;  3QB4 B;  5IMY C;  1NTN A;  1TXB A;  1NYU A;  4IYE A;  2MJ4 A;  1NEA A;  2MUP A;  2JQP A;  2N99 A;  1LXG A;  1TGX A;  2BHI A;  2L5S A;  1CXN A;  2H8U A;  3KFD I;  3ERA A;  2LCR A;  2L03 A;  2PJY C;  2QJA C;  3PLC A;  1NTX A;  1ES7 B;  3U74 U;  2BTX A;  1CDT A;  2GOO B;  3LAQ U;  3EVS C;  3U73 U;  1LX5 B;  4P7U A;  1KC4 A;  5DU1 A;  1XT3 A;  2FD6 U;  2H7Z A;  2K3G A;  3BT1 U;  1IJC A;  2ABX A;  2UX2 A;  1CHV S;  1ERG A;  2HLR A;  2GOO C;  1CXO A;  1ONJ A;  1ABT A;  2H64 C;  1IDH A;  1CRF A;  1M9Z A;  1IK8 A;  1FSS B;  2JVE A;  2H5F A;  2MUO A;  4RUD A;  1QM7 A;  1JE9 A;  2H62 D;  4OM4 A;  1LSI A;  1ERA A;  1KBS A;  1CB9 A;  4HQP F;  1JGK A;  2LA1 A;  1CCQ A;  2H62 C;  4KSN A;  4EY8 B;  4BIK B;  1KBA A;  1KXI A;  5IMT D;  4LFT A;  6EBX A;  4FAO E;  1CRE A;  1COE A;  1S4Y A;  2I9B E;  1IDI A;  1HOY A;  2QC1 A;  5DZ5 A;  1KBT A;  2CRS A; 
#chains in the Genus database with same CATH homology
 1MAH F;  1L4W A;  1REW C;  1TXA A;  3HH7 A;  1TFS A;  4ZQY A;  1IDL A;  1JBD A;  1FAS A;  1CDS A;  1W6B A;  1HAJ A;  2PJY B;  1B41 B;  2X8B B;  4QTI U;  2MHY A;  2QJB C;  2UWR A;  1CDR A;  3FEV A;  1UG4 A;  1QKE A;  1IDG A;  1HC9 A;  4DO8 A;  1NYS A;  1MR6 A;  1FFJ A;  2H64 B;  2QJ9 C;  1V6P A;  1KS6 A;  3NEQ A;  2MJ0 A;  1KTZ B;  1H0J A;  1LJZ A;  1CDQ A;  2NBT A;  1KU6 B;  2MJY A;  2CRT A;  1F8U B;  1FF4 A;  4OM5 A;  1IQ9 A;  1HAA A;  2J8B A;  1BTE A;  2CDX A;  3NH7 A;  1G6M A;  2HLQ A;  2OFS A;  1KL8 A;  3KFD E;  2VLW A;  1NOR A;  1QKD A;  1YWH A;  1VB0 A;  1RL5 A;  4AEA A;  3EBX A;  2ERA A;  1KFH A;  1ZAD A;  1RGJ A;  4FAO C;  1I02 A;  2H7Z B;  1NXB A;  1IKC A;  1CTX A;  1COD A;  2CCX A;  2MFA A;  4UY2 C;  3BT2 U;  2CTX A;  5EBX A;  4BDT B;  1FRA A;  1PLO A;  1HC9 B;  3NDS A;  1FSC A;  1LXH A;  5DO6 A;  3VTS A;  1F94 A;  1CVO A;  4XJJ A;  1DRS A;  1BXP A;  3QB4 B;  5IMY C;  1NTN A;  1TXB A;  1NYU A;  4IYE A;  2MJ4 A;  1NEA A;  2MUP A;  2JQP A;  2N99 A;  1LXG A;  1TGX A;  2BHI A;  2L5S A;  1CXN A;  2H8U A;  3KFD I;  3ERA A;  2LCR A;  2L03 A;  2PJY C;  2QJA C;  3PLC A;  1NTX A;  1ES7 B;  3U74 U;  2BTX A;  1CDT A;  2GOO B;  3LAQ U;  3EVS C;  3U73 U;  1LX5 B;  4P7U A;  1KC4 A;  5DU1 A;  1XT3 A;  2FD6 U;  2H7Z A;  2K3G A;  3BT1 U;  1IJC A;  2ABX A;  2UX2 A;  1CHV S;  1ERG A;  2HLR A;  2GOO C;  1CXO A;  1ONJ A;  1ABT A;  2H64 C;  1IDH A;  1CRF A;  1M9Z A;  1IK8 A;  1FSS B;  2JVE A;  2H5F A;  2MUO A;  4RUD A;  1QM7 A;  1JE9 A;  2H62 D;  4OM4 A;  1LSI A;  1ERA A;  1KBS A;  1CB9 A;  4HQP F;  1JGK A;  2LA1 A;  1CCQ A;  2H62 C;  4KSN A;  4EY8 B;  4BIK B;  1KBA A;  1KXI A;  5IMT D;  4LFT A;  6EBX A;  4FAO E;  1CRE A;  1COE A;  1S4Y A;  2I9B E;  1IDI A;  1HOY A;  2QC1 A;  5DZ5 A;  1KBT A;  2CRS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...