1IK8A

Nmr structure of alpha-bungarotoxin
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
74
structure length
74
Chain Sequence
IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords LONG NEUROTOXIN 1
publication title NMR structure of alpha-bungarotoxin free and bound to a mimotope of the nicotinic acetylcholine receptor.
pubmed doi rcsb
total genus 5
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2001-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1ik8A00
4QTIU 2ERAA 1JGKA 1FF4A 1I02A 4OM4A 1CODA 1CRFA 1KC4A 3KFDI 1COEA 3LAQU 1QKEA 1KBAA 1FASA 1UG4A 1ERAA 1CXNA 2CRSA 1CHVS 2H7ZA 1BXPA 1KBTA 1LX5B 2K3GA 1W6BA 1CDQA 1XT3A 1TXAA 3U74U 1IDLA 1JBDA 3BT1U 2HLRA 1YWHA 1ABTA 4P7UA 1NORA 2MJYA 4EY8B 1KFHA 2H64B 1KU6B 3VTSA 2GOOB 2MFAA 1JE9A 1NYSA 3ERAA 1DRSA 3NEQA 1CB9A 2BHIA 1G6MA 1LSIA 1LXGA 1MAHF 1ERGA 2UX2A 2H5FA 2JQPA 2LCRA 4RUDA 2JVEA 2OFSA 1CDSA 5IMYC 1RGJA 4HQPF 1QM7A 2MUOA 2MJ0A 3NH7A 2CRTA 1CDTA 1KS6A 3BT2U 1B41B 1ONJA 3EVSC 2QJ9C 2J8BA 4BDTB 3QB4B 4ZQYA 1FSCA 1IDHA 1RL5A 2MUPA 1L4WA 1IDIA 1CREA 2HLQA 3NDSA 1LXHA 1H0JA 2CTXA 1FFJA 4FAOE 1TFSA 5IMTD 3KFDE 2H8UA 1IJCA 2NBTA 1IQ9A 2VLWA 4DO8A 1LJZA 1NTXA 1CXOA 1KBSA 2H64C 1KTZB 6EBXA 2UWRA 2GOOC 1PLOA 2MHYA 1CDRA 4IYEA 4FAOC 2ABXA 2N99A 1IK8A 1HC9B 1IDGA 1M9ZA 2MJ4A 5DU1A 1TGXA 1IKCA 2X8BB 1HOYA 1NEAA 3U73U 3HH7A 1KL8A 2FD6U 2LA1A 3PLCA 1MR6A 1VB0A 2QJAC 1QKDA 3EBXA 1HAJA 1CTXA 2H62D 2L5SA 2PJYB 1CCQA 4XJJA 1ES7B 5DZ5A 1F8UB 2CCXA 1HC9A 3FEVA 4LFTA 5DO6A 1V6PA 1FRAA 1HAAA 5EBXA 1ZADA 2I9BE 1TXBA 1BTEA 1NTNA 4BIKB 1REWC 2L03A 2QC1A 2PJYC 4AEAA 1CVOA 4OM5A 2QJBC 2H62C 1KXIA 1NXBA 1F94A 2CDXA 4UY2C 2BTXA 1S4YA 1NYUA 1FSSB 2H7ZB
chains in the Genus database with same CATH superfamily
4QTIU 2ERAA 1JGKA 1FF4A 1I02A 4OM4A 1CODA 1CRFA 1KC4A 3KFDI 1COEA 3LAQU 1QKEA 1KBAA 1FASA 1UG4A 1ERAA 1CXNA 2CRSA 1CHVS 2H7ZA 1BXPA 1KBTA 1LX5B 2K3GA 1W6BA 1CDQA 1XT3A 1TXAA 3U74U 1IDLA 1JBDA 3BT1U 2HLRA 1YWHA 1ABTA 4P7UA 1NORA 2MJYA 4EY8B 1KFHA 2H64B 1KU6B 3VTSA 2GOOB 2MFAA 1JE9A 1NYSA 3ERAA 1DRSA 3NEQA 1CB9A 2BHIA 1G6MA 1LSIA 1LXGA 1MAHF 1ERGA 2UX2A 2H5FA 2JQPA 2LCRA 4RUDA 2JVEA 2OFSA 1CDSA 5IMYC 1RGJA 4HQPF 1QM7A 2MUOA 2MJ0A 3NH7A 2CRTA 1CDTA 1KS6A 3BT2U 1B41B 1ONJA 3EVSC 2QJ9C 2J8BA 4BDTB 3QB4B 4ZQYA 1FSCA 1IDHA 1RL5A 2MUPA 1L4WA 1IDIA 1CREA 2HLQA 3NDSA 1LXHA 1H0JA 2CTXA 1FFJA 4FAOE 1TFSA 5IMTD 3KFDE 2H8UA 1IJCA 4KSNA 2NBTA 1IQ9A 2VLWA 4DO8A 1LJZA 1NTXA 1CXOA 1KBSA 2H64C 1KTZB 6EBXA 2UWRA 2GOOC 1PLOA 2MHYA 1CDRA 4IYEA 4FAOC 2ABXA 2N99A 1IK8A 1HC9B 1IDGA 1M9ZA 2MJ4A 5DU1A 1TGXA 1IKCA 2X8BB 1HOYA 1NEAA 3U73U 3HH7A 1KL8A 2FD6U 2LA1A 3PLCA 1MR6A 1VB0A 2QJAC 1QKDA 3EBXA 1HAJA 1CTXA 2H62D 2L5SA 2PJYB 1CCQA 4XJJA 1ES7B 5DZ5A 1F8UB 2CCXA 1HC9A 3FEVA 4LFTA 5DO6A 1V6PA 1FRAA 1HAAA 5EBXA 1ZADA 2I9BE 1TXBA 1BTEA 1NTNA 4BIKB 1REWC 2L03A 2QC1A 2PJYC 4AEAA 1CVOA 4OM5A 2QJBC 2H62C 1KXIA 1NXBA 1F94A 2CDXA 4UY2C 2BTXA 1S4YA 1NYUA 1FSSB 2H7ZB
chains in the Genus database with same CATH topology
4QTIU 2ERAA 1JGKA 1FF4A 1I02A 4OM4A 1CODA 1CRFA 1KC4A 3KFDI 1COEA 3LAQU 1QKEA 1KBAA 1FASA 1UG4A 1ERAA 1CXNA 2CRSA 1CHVS 2H7ZA 1BXPA 1KBTA 1LX5B 2K3GA 1W6BA 1CDQA 1XT3A 1TXAA 3U74U 1IDLA 1JBDA 3BT1U 2HLRA 1YWHA 1ABTA 4P7UA 1NORA 2MJYA 4EY8B 1KFHA 2H64B 1KU6B 3VTSA 2GOOB 2MFAA 1JE9A 1NYSA 3ERAA 1DRSA 3NEQA 1CB9A 2BHIA 1G6MA 1LSIA 1LXGA 1MAHF 1ERGA 2UX2A 2H5FA 2JQPA 2LCRA 4RUDA 2JVEA 2OFSA 1CDSA 5IMYC 1RGJA 4HQPF 1QM7A 2MUOA 2MJ0A 3NH7A 2CRTA 1CDTA 1KS6A 3BT2U 1B41B 1ONJA 3EVSC 2QJ9C 2J8BA 4BDTB 3QB4B 4ZQYA 1FSCA 1IDHA 1RL5A 2MUPA 1L4WA 1IDIA 1CREA 2HLQA 3NDSA 1LXHA 1H0JA 2CTXA 1FFJA 4FAOE 1TFSA 5IMTD 3KFDE 2H8UA 1IJCA 4KSNA 2NBTA 1IQ9A 2VLWA 4DO8A 1LJZA 1NTXA 1CXOA 1KBSA 2H64C 1KTZB 6EBXA 2UWRA 2GOOC 1PLOA 2MHYA 1CDRA 4IYEA 4FAOC 2ABXA 2N99A 1IK8A 1HC9B 1IDGA 1M9ZA 2MJ4A 5DU1A 1TGXA 1IKCA 2X8BB 1HOYA 1NEAA 3U73U 3HH7A 1KL8A 2FD6U 2LA1A 3PLCA 1MR6A 1VB0A 2QJAC 1QKDA 3EBXA 1HAJA 1CTXA 2H62D 2L5SA 2PJYB 1CCQA 4XJJA 1ES7B 5DZ5A 1F8UB 2CCXA 1HC9A 3FEVA 4LFTA 5DO6A 1V6PA 1FRAA 1HAAA 5EBXA 1ZADA 2I9BE 1TXBA 1BTEA 1NTNA 4BIKB 1REWC 2L03A 2QC1A 2PJYC 4AEAA 1CVOA 4OM5A 2QJBC 2H62C 1KXIA 1NXBA 1F94A 2CDXA 4UY2C 2BTXA 1S4YA 1NYUA 1FSSB 2H7ZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QTI U;  2ERA A;  1JGK A;  1FF4 A;  1I02 A;  4OM4 A;  1COD A;  1CRF A;  1KC4 A;  3KFD I;  1COE A;  3LAQ U;  1QKE A;  1KBA A;  1FAS A;  1UG4 A;  1ERA A;  1CXN A;  2CRS A;  1CHV S;  2H7Z A;  1BXP A;  1KBT A;  1LX5 B;  2K3G A;  1W6B A;  1CDQ A;  1XT3 A;  1TXA A;  3U74 U;  1IDL A;  1JBD A;  3BT1 U;  2HLR A;  1YWH A;  1ABT A;  4P7U A;  1NOR A;  2MJY A;  4EY8 B;  1KFH A;  2H64 B;  1KU6 B;  3VTS A;  2GOO B;  2MFA A;  1JE9 A;  1NYS A;  3ERA A;  1DRS A;  3NEQ A;  1CB9 A;  2BHI A;  1G6M A;  1LSI A;  1LXG A;  1MAH F;  1ERG A;  2UX2 A;  2H5F A;  2JQP A;  2LCR A;  4RUD A;  2JVE A;  2OFS A;  1CDS A;  5IMY C;  1RGJ A;  4HQP F;  1QM7 A;  2MUO A;  2MJ0 A;  3NH7 A;  2CRT A;  1CDT A;  1KS6 A;  3BT2 U;  1B41 B;  1ONJ A;  3EVS C;  2QJ9 C;  2J8B A;  4BDT B;  3QB4 B;  4ZQY A;  1FSC A;  1IDH A;  1RL5 A;  2MUP A;  1L4W A;  1IDI A;  1CRE A;  2HLQ A;  3NDS A;  1LXH A;  1H0J A;  2CTX A;  1FFJ A;  4FAO E;  1TFS A;  5IMT D;  3KFD E;  2H8U A;  1IJC A;  2NBT A;  1IQ9 A;  2VLW A;  4DO8 A;  1LJZ A;  1NTX A;  1CXO A;  1KBS A;  2H64 C;  1KTZ B;  6EBX A;  2UWR A;  2GOO C;  1PLO A;  2MHY A;  1CDR A;  4IYE A;  4FAO C;  2ABX A;  2N99 A;  1IK8 A;  1HC9 B;  1IDG A;  1M9Z A;  2MJ4 A;  5DU1 A;  1TGX A;  1IKC A;  2X8B B;  1HOY A;  1NEA A;  3U73 U;  3HH7 A;  1KL8 A;  2FD6 U;  2LA1 A;  3PLC A;  1MR6 A;  1VB0 A;  2QJA C;  1QKD A;  3EBX A;  1HAJ A;  1CTX A;  2H62 D;  2L5S A;  2PJY B;  1CCQ A;  4XJJ A;  1ES7 B;  5DZ5 A;  1F8U B;  2CCX A;  1HC9 A;  3FEV A;  4LFT A;  5DO6 A;  1V6P A;  1FRA A;  1HAA A;  5EBX A;  1ZAD A;  2I9B E;  1TXB A;  1BTE A;  1NTN A;  4BIK B;  1REW C;  2L03 A;  2QC1 A;  2PJY C;  4AEA A;  1CVO A;  4OM5 A;  2QJB C;  2H62 C;  1KXI A;  1NXB A;  1F94 A;  2CDX A;  4UY2 C;  2BTX A;  1S4Y A;  1NYU A;  1FSS B;  2H7Z B; 
#chains in the Genus database with same CATH topology
 4QTI U;  2ERA A;  1JGK A;  1FF4 A;  1I02 A;  4OM4 A;  1COD A;  1CRF A;  1KC4 A;  3KFD I;  1COE A;  3LAQ U;  1QKE A;  1KBA A;  1FAS A;  1UG4 A;  1ERA A;  1CXN A;  2CRS A;  1CHV S;  2H7Z A;  1BXP A;  1KBT A;  1LX5 B;  2K3G A;  1W6B A;  1CDQ A;  1XT3 A;  1TXA A;  3U74 U;  1IDL A;  1JBD A;  3BT1 U;  2HLR A;  1YWH A;  1ABT A;  4P7U A;  1NOR A;  2MJY A;  4EY8 B;  1KFH A;  2H64 B;  1KU6 B;  3VTS A;  2GOO B;  2MFA A;  1JE9 A;  1NYS A;  3ERA A;  1DRS A;  3NEQ A;  1CB9 A;  2BHI A;  1G6M A;  1LSI A;  1LXG A;  1MAH F;  1ERG A;  2UX2 A;  2H5F A;  2JQP A;  2LCR A;  4RUD A;  2JVE A;  2OFS A;  1CDS A;  5IMY C;  1RGJ A;  4HQP F;  1QM7 A;  2MUO A;  2MJ0 A;  3NH7 A;  2CRT A;  1CDT A;  1KS6 A;  3BT2 U;  1B41 B;  1ONJ A;  3EVS C;  2QJ9 C;  2J8B A;  4BDT B;  3QB4 B;  4ZQY A;  1FSC A;  1IDH A;  1RL5 A;  2MUP A;  1L4W A;  1IDI A;  1CRE A;  2HLQ A;  3NDS A;  1LXH A;  1H0J A;  2CTX A;  1FFJ A;  4FAO E;  1TFS A;  5IMT D;  3KFD E;  2H8U A;  1IJC A;  4KSN A;  2NBT A;  1IQ9 A;  2VLW A;  4DO8 A;  1LJZ A;  1NTX A;  1CXO A;  1KBS A;  2H64 C;  1KTZ B;  6EBX A;  2UWR A;  2GOO C;  1PLO A;  2MHY A;  1CDR A;  4IYE A;  4FAO C;  2ABX A;  2N99 A;  1IK8 A;  1HC9 B;  1IDG A;  1M9Z A;  2MJ4 A;  5DU1 A;  1TGX A;  1IKC A;  2X8B B;  1HOY A;  1NEA A;  3U73 U;  3HH7 A;  1KL8 A;  2FD6 U;  2LA1 A;  3PLC A;  1MR6 A;  1VB0 A;  2QJA C;  1QKD A;  3EBX A;  1HAJ A;  1CTX A;  2H62 D;  2L5S A;  2PJY B;  1CCQ A;  4XJJ A;  1ES7 B;  5DZ5 A;  1F8U B;  2CCX A;  1HC9 A;  3FEV A;  4LFT A;  5DO6 A;  1V6P A;  1FRA A;  1HAA A;  5EBX A;  1ZAD A;  2I9B E;  1TXB A;  1BTE A;  1NTN A;  4BIK B;  1REW C;  2L03 A;  2QC1 A;  2PJY C;  4AEA A;  1CVO A;  4OM5 A;  2QJB C;  2H62 C;  1KXI A;  1NXB A;  1F94 A;  2CDX A;  4UY2 C;  2BTX A;  1S4Y A;  1NYU A;  1FSS B;  2H7Z B; 
#chains in the Genus database with same CATH homology
 4QTI U;  2ERA A;  1JGK A;  1FF4 A;  1I02 A;  4OM4 A;  1COD A;  1CRF A;  1KC4 A;  3KFD I;  1COE A;  3LAQ U;  1QKE A;  1KBA A;  1FAS A;  1UG4 A;  1ERA A;  1CXN A;  2CRS A;  1CHV S;  2H7Z A;  1BXP A;  1KBT A;  1LX5 B;  2K3G A;  1W6B A;  1CDQ A;  1XT3 A;  1TXA A;  3U74 U;  1IDL A;  1JBD A;  3BT1 U;  2HLR A;  1YWH A;  1ABT A;  4P7U A;  1NOR A;  2MJY A;  4EY8 B;  1KFH A;  2H64 B;  1KU6 B;  3VTS A;  2GOO B;  2MFA A;  1JE9 A;  1NYS A;  3ERA A;  1DRS A;  3NEQ A;  1CB9 A;  2BHI A;  1G6M A;  1LSI A;  1LXG A;  1MAH F;  1ERG A;  2UX2 A;  2H5F A;  2JQP A;  2LCR A;  4RUD A;  2JVE A;  2OFS A;  1CDS A;  5IMY C;  1RGJ A;  4HQP F;  1QM7 A;  2MUO A;  2MJ0 A;  3NH7 A;  2CRT A;  1CDT A;  1KS6 A;  3BT2 U;  1B41 B;  1ONJ A;  3EVS C;  2QJ9 C;  2J8B A;  4BDT B;  3QB4 B;  4ZQY A;  1FSC A;  1IDH A;  1RL5 A;  2MUP A;  1L4W A;  1IDI A;  1CRE A;  2HLQ A;  3NDS A;  1LXH A;  1H0J A;  2CTX A;  1FFJ A;  4FAO E;  1TFS A;  5IMT D;  3KFD E;  2H8U A;  1IJC A;  4KSN A;  2NBT A;  1IQ9 A;  2VLW A;  4DO8 A;  1LJZ A;  1NTX A;  1CXO A;  1KBS A;  2H64 C;  1KTZ B;  6EBX A;  2UWR A;  2GOO C;  1PLO A;  2MHY A;  1CDR A;  4IYE A;  4FAO C;  2ABX A;  2N99 A;  1IK8 A;  1HC9 B;  1IDG A;  1M9Z A;  2MJ4 A;  5DU1 A;  1TGX A;  1IKC A;  2X8B B;  1HOY A;  1NEA A;  3U73 U;  3HH7 A;  1KL8 A;  2FD6 U;  2LA1 A;  3PLC A;  1MR6 A;  1VB0 A;  2QJA C;  1QKD A;  3EBX A;  1HAJ A;  1CTX A;  2H62 D;  2L5S A;  2PJY B;  1CCQ A;  4XJJ A;  1ES7 B;  5DZ5 A;  1F8U B;  2CCX A;  1HC9 A;  3FEV A;  4LFT A;  5DO6 A;  1V6P A;  1FRA A;  1HAA A;  5EBX A;  1ZAD A;  2I9B E;  1TXB A;  1BTE A;  1NTN A;  4BIK B;  1REW C;  2L03 A;  2QC1 A;  2PJY C;  4AEA A;  1CVO A;  4OM5 A;  2QJB C;  2H62 C;  1KXI A;  1NXB A;  1F94 A;  2CDX A;  4UY2 C;  2BTX A;  1S4Y A;  1NYU A;  1FSS B;  2H7Z B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...