1COEA

Solution conformation of cobrotoxin: a nuclear magnetic resonance and hybrid distance geometry-dynamical simulated annealing study
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
62
structure length
62
Chain Sequence
LECHNQQSSQTPTTTGCSGGETNCYKKRWRDHRGYRTERGCGCPSVKNGIEINCCTTDRCNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COBROTOXIN
publication title Solution conformation of cobrotoxin: a nuclear magnetic resonance and hybrid distance geometry-dynamical simulated annealing study.
pubmed doi rcsb
source organism Naja atra
molecule tags Short neurotoxin
total genus 5
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 1994-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1coeA00
1KBTA 3VTSA 2CRTA 4BIKB 1BXPA 2H64C 3KFDI 1CDRA 1RL5A 2ABXA 2MJ0A 1FFJA 4RUDA 1CCQA 1PLOA 1L4WA 4OM4A 1CTXA 1CDQA 1CREA 1FF4A 2I9BE 1LX5B 1JBDA 1VB0A 1NORA 2BHIA 1QKEA 2MJYA 2PJYC 1IQ9A 1CDSA 1KC4A 2J8BA 1IDLA 1F8UB 1ZADA 1KXIA 2QJ9C 2LCRA 1CDTA 2H7ZA 1DRSA 1XT3A 6EBXA 1CXNA 1B41B 1LSIA 1NYSA 1IJCA 2HLQA 1MR6A 4FAOC 1LXGA 3HH7A 3EVSC 1KU6B 2H5FA 3FEVA 4DO8A 5IMYC 1UG4A 2L03A 1ABTA 3EBXA 1KTZB 4ZQYA 1NXBA 2UWRA 1CB9A 3NEQA 1ERAA 3NDSA 2H8UA 1YWHA 5DO6A 2CDXA 1NTNA 1JGKA 2NBTA 2GOOB 2ERAA 2H62D 2MUPA 5EBXA 2QJAC 1HOYA 1KFHA 3QB4B 1RGJA 1QM7A 2MFAA 2H64B 1FSSB 3U73U 3KFDE 1TGXA 4FAOE 1KBAA 1CODA 1NTXA 1TFSA 4UY2C 1KS6A 1FASA 1FSCA 2HLRA 2N99A 2PJYB 1HAJA 2H62C 5DU1A 1CRFA 2BTXA 1V6PA 2JVEA 1F94A 2CCXA 3ERAA 4IYEA 1IDGA 4QTIU 2CTXA 1ERGA 1REWC 1LJZA 5IMTD 1JE9A 4P7UA 4BDTB 2FD6U 1KL8A 2K3GA 4OM5A 1TXBA 2MUOA 2OFSA 1CHVS 1HC9B 2CRSA 3NH7A 2QC1A 1QKDA 2L5SA 3BT2U 2QJBC 3U74U 1COEA 3LAQU 1IDIA 1I02A 2UX2A 4LFTA 1MAHF 4HQPF 3BT1U 4EY8B 2JQPA 1ES7B 1CXOA 1BTEA 1TXAA 1W6BA 1NEAA 5DZ5A 1IKCA 1S4YA 2X8BB 1HAAA 1H0JA 1IDHA 1NYUA 1ONJA 1HC9A 1G6MA 1M9ZA 2VLWA 2MJ4A 3PLCA 1CVOA 2GOOC 2MHYA 1KBSA 4AEAA 1LXHA 1FRAA 4XJJA 2H7ZB 2LA1A 1IK8A
chains in the Genus database with same CATH superfamily
1KBTA 3VTSA 2CRTA 4BIKB 1BXPA 2H64C 3KFDI 1CDRA 1RL5A 2ABXA 2MJ0A 1FFJA 4RUDA 1CCQA 1PLOA 1L4WA 4OM4A 1CTXA 1CDQA 1CREA 1FF4A 2I9BE 1LX5B 1JBDA 1VB0A 1NORA 2BHIA 1QKEA 2MJYA 2PJYC 1IQ9A 1CDSA 1KC4A 2J8BA 1IDLA 1F8UB 1ZADA 1KXIA 2QJ9C 2LCRA 1CDTA 2H7ZA 1DRSA 1XT3A 6EBXA 1CXNA 1B41B 1LSIA 1NYSA 1IJCA 2HLQA 1MR6A 4FAOC 1LXGA 3HH7A 3EVSC 1KU6B 2H5FA 3FEVA 4DO8A 5IMYC 1UG4A 2L03A 1ABTA 3EBXA 1KTZB 4ZQYA 1NXBA 2UWRA 1CB9A 3NEQA 1ERAA 3NDSA 2H8UA 1YWHA 5DO6A 2CDXA 1NTNA 1JGKA 2NBTA 2GOOB 2ERAA 2H62D 2MUPA 5EBXA 2QJAC 1HOYA 1KFHA 3QB4B 1RGJA 1QM7A 2MFAA 2H64B 1FSSB 3U73U 3KFDE 1TGXA 4FAOE 1KBAA 1CODA 1NTXA 1TFSA 4UY2C 1KS6A 1FASA 1FSCA 2HLRA 2N99A 2PJYB 1HAJA 2H62C 5DU1A 1CRFA 2BTXA 1V6PA 2JVEA 1F94A 2CCXA 3ERAA 4IYEA 1IDGA 4QTIU 2CTXA 1ERGA 1REWC 1LJZA 5IMTD 1JE9A 4P7UA 4BDTB 2FD6U 1KL8A 2K3GA 4OM5A 1TXBA 2MUOA 2OFSA 1CHVS 4KSNA 1HC9B 2CRSA 3NH7A 2QC1A 1QKDA 2L5SA 3BT2U 2QJBC 3U74U 1COEA 3LAQU 1IDIA 1I02A 2UX2A 4LFTA 1MAHF 4HQPF 3BT1U 4EY8B 2JQPA 1ES7B 1CXOA 1BTEA 1TXAA 1W6BA 1NEAA 5DZ5A 1IKCA 1S4YA 2X8BB 1HAAA 1H0JA 1IDHA 1NYUA 1ONJA 1HC9A 1G6MA 1M9ZA 2VLWA 2MJ4A 3PLCA 1CVOA 2GOOC 2MHYA 1KBSA 4AEAA 1LXHA 1FRAA 4XJJA 2H7ZB 2LA1A 1IK8A
chains in the Genus database with same CATH topology
1KBTA 3VTSA 2CRTA 4BIKB 1BXPA 2H64C 3KFDI 1CDRA 1RL5A 2ABXA 2MJ0A 1FFJA 4RUDA 1CCQA 1PLOA 1L4WA 4OM4A 1CTXA 1CDQA 1CREA 1FF4A 2I9BE 1LX5B 1JBDA 1VB0A 1NORA 2BHIA 1QKEA 2MJYA 2PJYC 1IQ9A 1CDSA 1KC4A 2J8BA 1IDLA 1F8UB 1ZADA 1KXIA 2QJ9C 2LCRA 1CDTA 2H7ZA 1DRSA 1XT3A 6EBXA 1CXNA 1B41B 1LSIA 1NYSA 1IJCA 2HLQA 1MR6A 4FAOC 1LXGA 3HH7A 3EVSC 1KU6B 2H5FA 3FEVA 4DO8A 5IMYC 1UG4A 2L03A 1ABTA 3EBXA 1KTZB 4ZQYA 1NXBA 2UWRA 1CB9A 3NEQA 1ERAA 3NDSA 2H8UA 1YWHA 5DO6A 2CDXA 1NTNA 1JGKA 2NBTA 2GOOB 2ERAA 2H62D 2MUPA 5EBXA 2QJAC 1HOYA 1KFHA 3QB4B 1RGJA 1QM7A 2MFAA 2H64B 1FSSB 3U73U 3KFDE 1TGXA 4FAOE 1KBAA 1CODA 1NTXA 1TFSA 4UY2C 1KS6A 1FASA 1FSCA 2HLRA 2N99A 2PJYB 1HAJA 2H62C 5DU1A 1CRFA 2BTXA 1V6PA 2JVEA 1F94A 2CCXA 3ERAA 4IYEA 1IDGA 4QTIU 2CTXA 1ERGA 1REWC 1LJZA 5IMTD 1JE9A 4P7UA 4BDTB 2FD6U 1KL8A 2K3GA 4OM5A 1TXBA 2MUOA 2OFSA 1CHVS 4KSNA 1HC9B 2CRSA 3NH7A 2QC1A 1QKDA 2L5SA 3BT2U 2QJBC 3U74U 1COEA 3LAQU 1IDIA 1I02A 2UX2A 4LFTA 1MAHF 4HQPF 3BT1U 4EY8B 2JQPA 1ES7B 1CXOA 1BTEA 1TXAA 1W6BA 1NEAA 5DZ5A 1IKCA 1S4YA 2X8BB 1HAAA 1H0JA 1IDHA 1NYUA 1ONJA 1HC9A 1G6MA 1M9ZA 2VLWA 2MJ4A 3PLCA 1CVOA 2GOOC 2MHYA 1KBSA 4AEAA 1LXHA 1FRAA 4XJJA 2H7ZB 2LA1A 1IK8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KBT A;  3VTS A;  2CRT A;  4BIK B;  1BXP A;  2H64 C;  3KFD I;  1CDR A;  1RL5 A;  2ABX A;  2MJ0 A;  1FFJ A;  4RUD A;  1CCQ A;  1PLO A;  1L4W A;  4OM4 A;  1CTX A;  1CDQ A;  1CRE A;  1FF4 A;  2I9B E;  1LX5 B;  1JBD A;  1VB0 A;  1NOR A;  2BHI A;  1QKE A;  2MJY A;  2PJY C;  1IQ9 A;  1CDS A;  1KC4 A;  2J8B A;  1IDL A;  1F8U B;  1ZAD A;  1KXI A;  2QJ9 C;  2LCR A;  1CDT A;  2H7Z A;  1DRS A;  1XT3 A;  6EBX A;  1CXN A;  1B41 B;  1LSI A;  1NYS A;  1IJC A;  2HLQ A;  1MR6 A;  4FAO C;  1LXG A;  3HH7 A;  3EVS C;  1KU6 B;  2H5F A;  3FEV A;  4DO8 A;  5IMY C;  1UG4 A;  2L03 A;  1ABT A;  3EBX A;  1KTZ B;  4ZQY A;  1NXB A;  2UWR A;  1CB9 A;  3NEQ A;  1ERA A;  3NDS A;  2H8U A;  1YWH A;  5DO6 A;  2CDX A;  1NTN A;  1JGK A;  2NBT A;  2GOO B;  2ERA A;  2H62 D;  2MUP A;  5EBX A;  2QJA C;  1HOY A;  1KFH A;  3QB4 B;  1RGJ A;  1QM7 A;  2MFA A;  2H64 B;  1FSS B;  3U73 U;  3KFD E;  1TGX A;  4FAO E;  1KBA A;  1COD A;  1NTX A;  1TFS A;  4UY2 C;  1KS6 A;  1FAS A;  1FSC A;  2HLR A;  2N99 A;  2PJY B;  1HAJ A;  2H62 C;  5DU1 A;  1CRF A;  2BTX A;  1V6P A;  2JVE A;  1F94 A;  2CCX A;  3ERA A;  4IYE A;  1IDG A;  4QTI U;  2CTX A;  1ERG A;  1REW C;  1LJZ A;  5IMT D;  1JE9 A;  4P7U A;  4BDT B;  2FD6 U;  1KL8 A;  2K3G A;  4OM5 A;  1TXB A;  2MUO A;  2OFS A;  1CHV S;  1HC9 B;  2CRS A;  3NH7 A;  2QC1 A;  1QKD A;  2L5S A;  3BT2 U;  2QJB C;  3U74 U;  1COE A;  3LAQ U;  1IDI A;  1I02 A;  2UX2 A;  4LFT A;  1MAH F;  4HQP F;  3BT1 U;  4EY8 B;  2JQP A;  1ES7 B;  1CXO A;  1BTE A;  1TXA A;  1W6B A;  1NEA A;  5DZ5 A;  1IKC A;  1S4Y A;  2X8B B;  1HAA A;  1H0J A;  1IDH A;  1NYU A;  1ONJ A;  1HC9 A;  1G6M A;  1M9Z A;  2VLW A;  2MJ4 A;  3PLC A;  1CVO A;  2GOO C;  2MHY A;  1KBS A;  4AEA A;  1LXH A;  1FRA A;  4XJJ A;  2H7Z B;  2LA1 A;  1IK8 A; 
#chains in the Genus database with same CATH topology
 1KBT A;  3VTS A;  2CRT A;  4BIK B;  1BXP A;  2H64 C;  3KFD I;  1CDR A;  1RL5 A;  2ABX A;  2MJ0 A;  1FFJ A;  4RUD A;  1CCQ A;  1PLO A;  1L4W A;  4OM4 A;  1CTX A;  1CDQ A;  1CRE A;  1FF4 A;  2I9B E;  1LX5 B;  1JBD A;  1VB0 A;  1NOR A;  2BHI A;  1QKE A;  2MJY A;  2PJY C;  1IQ9 A;  1CDS A;  1KC4 A;  2J8B A;  1IDL A;  1F8U B;  1ZAD A;  1KXI A;  2QJ9 C;  2LCR A;  1CDT A;  2H7Z A;  1DRS A;  1XT3 A;  6EBX A;  1CXN A;  1B41 B;  1LSI A;  1NYS A;  1IJC A;  2HLQ A;  1MR6 A;  4FAO C;  1LXG A;  3HH7 A;  3EVS C;  1KU6 B;  2H5F A;  3FEV A;  4DO8 A;  5IMY C;  1UG4 A;  2L03 A;  1ABT A;  3EBX A;  1KTZ B;  4ZQY A;  1NXB A;  2UWR A;  1CB9 A;  3NEQ A;  1ERA A;  3NDS A;  2H8U A;  1YWH A;  5DO6 A;  2CDX A;  1NTN A;  1JGK A;  2NBT A;  2GOO B;  2ERA A;  2H62 D;  2MUP A;  5EBX A;  2QJA C;  1HOY A;  1KFH A;  3QB4 B;  1RGJ A;  1QM7 A;  2MFA A;  2H64 B;  1FSS B;  3U73 U;  3KFD E;  1TGX A;  4FAO E;  1KBA A;  1COD A;  1NTX A;  1TFS A;  4UY2 C;  1KS6 A;  1FAS A;  1FSC A;  2HLR A;  2N99 A;  2PJY B;  1HAJ A;  2H62 C;  5DU1 A;  1CRF A;  2BTX A;  1V6P A;  2JVE A;  1F94 A;  2CCX A;  3ERA A;  4IYE A;  1IDG A;  4QTI U;  2CTX A;  1ERG A;  1REW C;  1LJZ A;  5IMT D;  1JE9 A;  4P7U A;  4BDT B;  2FD6 U;  1KL8 A;  2K3G A;  4OM5 A;  1TXB A;  2MUO A;  2OFS A;  1CHV S;  4KSN A;  1HC9 B;  2CRS A;  3NH7 A;  2QC1 A;  1QKD A;  2L5S A;  3BT2 U;  2QJB C;  3U74 U;  1COE A;  3LAQ U;  1IDI A;  1I02 A;  2UX2 A;  4LFT A;  1MAH F;  4HQP F;  3BT1 U;  4EY8 B;  2JQP A;  1ES7 B;  1CXO A;  1BTE A;  1TXA A;  1W6B A;  1NEA A;  5DZ5 A;  1IKC A;  1S4Y A;  2X8B B;  1HAA A;  1H0J A;  1IDH A;  1NYU A;  1ONJ A;  1HC9 A;  1G6M A;  1M9Z A;  2VLW A;  2MJ4 A;  3PLC A;  1CVO A;  2GOO C;  2MHY A;  1KBS A;  4AEA A;  1LXH A;  1FRA A;  4XJJ A;  2H7Z B;  2LA1 A;  1IK8 A; 
#chains in the Genus database with same CATH homology
 1KBT A;  3VTS A;  2CRT A;  4BIK B;  1BXP A;  2H64 C;  3KFD I;  1CDR A;  1RL5 A;  2ABX A;  2MJ0 A;  1FFJ A;  4RUD A;  1CCQ A;  1PLO A;  1L4W A;  4OM4 A;  1CTX A;  1CDQ A;  1CRE A;  1FF4 A;  2I9B E;  1LX5 B;  1JBD A;  1VB0 A;  1NOR A;  2BHI A;  1QKE A;  2MJY A;  2PJY C;  1IQ9 A;  1CDS A;  1KC4 A;  2J8B A;  1IDL A;  1F8U B;  1ZAD A;  1KXI A;  2QJ9 C;  2LCR A;  1CDT A;  2H7Z A;  1DRS A;  1XT3 A;  6EBX A;  1CXN A;  1B41 B;  1LSI A;  1NYS A;  1IJC A;  2HLQ A;  1MR6 A;  4FAO C;  1LXG A;  3HH7 A;  3EVS C;  1KU6 B;  2H5F A;  3FEV A;  4DO8 A;  5IMY C;  1UG4 A;  2L03 A;  1ABT A;  3EBX A;  1KTZ B;  4ZQY A;  1NXB A;  2UWR A;  1CB9 A;  3NEQ A;  1ERA A;  3NDS A;  2H8U A;  1YWH A;  5DO6 A;  2CDX A;  1NTN A;  1JGK A;  2NBT A;  2GOO B;  2ERA A;  2H62 D;  2MUP A;  5EBX A;  2QJA C;  1HOY A;  1KFH A;  3QB4 B;  1RGJ A;  1QM7 A;  2MFA A;  2H64 B;  1FSS B;  3U73 U;  3KFD E;  1TGX A;  4FAO E;  1KBA A;  1COD A;  1NTX A;  1TFS A;  4UY2 C;  1KS6 A;  1FAS A;  1FSC A;  2HLR A;  2N99 A;  2PJY B;  1HAJ A;  2H62 C;  5DU1 A;  1CRF A;  2BTX A;  1V6P A;  2JVE A;  1F94 A;  2CCX A;  3ERA A;  4IYE A;  1IDG A;  4QTI U;  2CTX A;  1ERG A;  1REW C;  1LJZ A;  5IMT D;  1JE9 A;  4P7U A;  4BDT B;  2FD6 U;  1KL8 A;  2K3G A;  4OM5 A;  1TXB A;  2MUO A;  2OFS A;  1CHV S;  4KSN A;  1HC9 B;  2CRS A;  3NH7 A;  2QC1 A;  1QKD A;  2L5S A;  3BT2 U;  2QJB C;  3U74 U;  1COE A;  3LAQ U;  1IDI A;  1I02 A;  2UX2 A;  4LFT A;  1MAH F;  4HQP F;  3BT1 U;  4EY8 B;  2JQP A;  1ES7 B;  1CXO A;  1BTE A;  1TXA A;  1W6B A;  1NEA A;  5DZ5 A;  1IKC A;  1S4Y A;  2X8B B;  1HAA A;  1H0J A;  1IDH A;  1NYU A;  1ONJ A;  1HC9 A;  1G6M A;  1M9Z A;  2VLW A;  2MJ4 A;  3PLC A;  1CVO A;  2GOO C;  2MHY A;  1KBS A;  4AEA A;  1LXH A;  1FRA A;  4XJJ A;  2H7Z B;  2LA1 A;  1IK8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...