1COEA

Solution conformation of cobrotoxin: a nuclear magnetic resonance and hybrid distance geometry-dynamical simulated annealing study
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
62
structure length
62
Chain Sequence
LECHNQQSSQTPTTTGCSGGETNCYKKRWRDHRGYRTERGCGCPSVKNGIEINCCTTDRCNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution conformation of cobrotoxin: a nuclear magnetic resonance and hybrid distance geometry-dynamical simulated annealing study.
pubmed doi rcsb
source organism Naja atra
molecule tags Short neurotoxin
molecule keywords COBROTOXIN
total genus 5
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 1994-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1coeA00
2MHYA 1NEAA 2LA1A 1FF4A 2NBTA 3FEVA 1KFHA 2VLWA 5DU1A 2FD6U 1QKDA 2CCXA 2CRTA 1LJZA 3NEQA 3U73U 1LSIA 1FASA 2ABXA 2H5FA 1CCQA 2PJYC 2UWRA 2H7ZA 1LX5B 1KBTA 1IKCA 1JBDA 3VTSA 1IDGA 1JE9A 1KXIA 1ONJA 1XT3A 1KTZB 1CXNA 1CODA 3EVSC 1NTXA 1CB9A 4EY8B 1HC9A 1TXBA 5IMTD 3EBXA 1NXBA 2BHIA 3BT2U 1HC9B 4P7UA 2MJ4A 2JQPA 1IDLA 1TXAA 3LAQU 1JGKA 1S4YA 4ZQYA 1V6PA 1LXHA 4OM5A 3ERAA 1MR6A 1CRFA 2QJAC 4DO8A 2QJBC 5DO6A 5DZ5A 4QTIU 2QC1A 1F94A 1IDHA 1FSCA 1ES7B 2BTXA 1LXGA 1KC4A 1NTNA 2GOOC 1TGXA 2H62C 1B41B 1FFJA 1ERGA 4BDTB 2L5SA 1H0JA 1QKEA 2OFSA 4FAOE 2MJYA 4XJJA 1IK8A 1KL8A 1NYUA 6EBXA 3U74U 4OM4A 1CXOA 1I02A 2GOOB 1RGJA 3BT1U 1BXPA 2HLRA 3KFDI 4RUDA 4LFTA 1UG4A 3NDSA 2MUPA 4UY2C 5EBXA 1DRSA 1CDRA 2H8UA 2K3GA 1PLOA 1RL5A 1HAJA 2I9BE 1CREA 2LCRA 1HOYA 2CTXA 1QM7A 1BTEA 2L03A 2CDXA 1NORA 1IDIA 1KBAA 1ABTA 1FSSB 1IJCA 1YWHA 1CDQA 1COEA 5IMYC 1VB0A 4BIKB 1ERAA 1CDTA 4HQPF 1G6MA 1CHVS 2PJYB 1MAHF 1FRAA 3NH7A 2H7ZB 1ZADA 2J8BA 2MFAA 3PLCA 2H64B 2X8BB 4IYEA 1CDSA 2H62D 2HLQA 2MUOA 1REWC 1KBSA 2QJ9C 1NYSA 1TFSA 4AEAA 3HH7A 1CVOA 1M9ZA 1HAAA 2UX2A 1KU6B 1L4WA 1F8UB 2JVEA 2N99A 1CTXA 4FAOC 2ERAA 1W6BA 1IQ9A 3QB4B 2H64C 1KS6A 2MJ0A 3KFDE 2CRSA
chains in the Genus database with same CATH superfamily
2MHYA 1NEAA 2LA1A 1FF4A 2NBTA 3FEVA 1KFHA 2VLWA 5DU1A 2FD6U 1QKDA 2CCXA 2CRTA 1LJZA 3NEQA 3U73U 1LSIA 1FASA 2ABXA 2H5FA 1CCQA 2PJYC 2UWRA 2H7ZA 1LX5B 1KBTA 1IKCA 1JBDA 3VTSA 1IDGA 1JE9A 1KXIA 1ONJA 1XT3A 1KTZB 1CXNA 1CODA 3EVSC 1NTXA 1CB9A 4EY8B 1HC9A 1TXBA 5IMTD 3EBXA 1NXBA 2BHIA 3BT2U 1HC9B 4P7UA 2MJ4A 2JQPA 1IDLA 1TXAA 3LAQU 1JGKA 1S4YA 4ZQYA 1V6PA 1LXHA 4OM5A 3ERAA 1MR6A 1CRFA 2QJAC 4DO8A 2QJBC 5DO6A 5DZ5A 4QTIU 2QC1A 1F94A 1IDHA 1FSCA 1ES7B 2BTXA 1LXGA 1KC4A 1NTNA 2GOOC 1TGXA 2H62C 1B41B 1FFJA 1ERGA 4BDTB 2L5SA 1H0JA 1QKEA 2OFSA 4FAOE 2MJYA 4XJJA 1IK8A 1KL8A 1NYUA 6EBXA 3U74U 4OM4A 1CXOA 1I02A 2GOOB 1RGJA 4KSNA 3BT1U 1BXPA 2HLRA 3KFDI 4RUDA 4LFTA 1UG4A 3NDSA 2MUPA 4UY2C 5EBXA 1DRSA 1CDRA 2H8UA 2K3GA 1PLOA 1RL5A 1HAJA 2I9BE 1CREA 2LCRA 1HOYA 2CTXA 1QM7A 1BTEA 2L03A 2CDXA 1NORA 1IDIA 1KBAA 1ABTA 1FSSB 1IJCA 1YWHA 1CDQA 1COEA 5IMYC 1VB0A 4BIKB 1ERAA 1CDTA 4HQPF 1G6MA 1CHVS 2PJYB 1MAHF 1FRAA 3NH7A 2H7ZB 1ZADA 2J8BA 2MFAA 3PLCA 2H64B 2X8BB 4IYEA 1CDSA 2H62D 2HLQA 2MUOA 1REWC 1KBSA 2QJ9C 1NYSA 1TFSA 4AEAA 3HH7A 1CVOA 1M9ZA 1HAAA 2UX2A 1KU6B 1L4WA 1F8UB 2JVEA 2N99A 1CTXA 4FAOC 2ERAA 1W6BA 1IQ9A 3QB4B 2H64C 1KS6A 2MJ0A 3KFDE 2CRSA
chains in the Genus database with same CATH topology
2MHYA 1NEAA 2LA1A 1FF4A 2NBTA 3FEVA 1KFHA 2VLWA 5DU1A 2FD6U 1QKDA 2CCXA 2CRTA 1LJZA 3NEQA 3U73U 1LSIA 1FASA 2ABXA 2H5FA 1CCQA 2PJYC 2UWRA 2H7ZA 1LX5B 1KBTA 1IKCA 1JBDA 3VTSA 1IDGA 1JE9A 1KXIA 1ONJA 1XT3A 1KTZB 1CXNA 1CODA 3EVSC 1NTXA 1CB9A 4EY8B 1HC9A 1TXBA 5IMTD 3EBXA 1NXBA 2BHIA 3BT2U 1HC9B 4P7UA 2MJ4A 2JQPA 1IDLA 1TXAA 3LAQU 1JGKA 1S4YA 4ZQYA 1V6PA 1LXHA 4OM5A 3ERAA 1MR6A 1CRFA 2QJAC 4DO8A 2QJBC 5DO6A 5DZ5A 4QTIU 2QC1A 1F94A 1IDHA 1FSCA 1ES7B 2BTXA 1LXGA 1KC4A 1NTNA 2GOOC 1TGXA 2H62C 1B41B 1FFJA 1ERGA 4BDTB 2L5SA 1H0JA 1QKEA 2OFSA 4FAOE 2MJYA 4XJJA 1IK8A 1KL8A 1NYUA 6EBXA 3U74U 4OM4A 1CXOA 1I02A 2GOOB 1RGJA 4KSNA 3BT1U 1BXPA 2HLRA 3KFDI 4RUDA 4LFTA 1UG4A 3NDSA 2MUPA 4UY2C 5EBXA 1DRSA 1CDRA 2H8UA 2K3GA 1PLOA 1RL5A 1HAJA 2I9BE 1CREA 2LCRA 1HOYA 2CTXA 1QM7A 1BTEA 2L03A 2CDXA 1NORA 1IDIA 1KBAA 1ABTA 1FSSB 1IJCA 1YWHA 1CDQA 1COEA 5IMYC 1VB0A 4BIKB 1ERAA 1CDTA 4HQPF 1G6MA 1CHVS 2PJYB 1MAHF 1FRAA 3NH7A 2H7ZB 1ZADA 2J8BA 2MFAA 3PLCA 2H64B 2X8BB 4IYEA 1CDSA 2H62D 2HLQA 2MUOA 1REWC 1KBSA 2QJ9C 1NYSA 1TFSA 4AEAA 3HH7A 1CVOA 1M9ZA 1HAAA 2UX2A 1KU6B 1L4WA 1F8UB 2JVEA 2N99A 1CTXA 4FAOC 2ERAA 1W6BA 1IQ9A 3QB4B 2H64C 1KS6A 2MJ0A 3KFDE 2CRSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MHY A;  1NEA A;  2LA1 A;  1FF4 A;  2NBT A;  3FEV A;  1KFH A;  2VLW A;  5DU1 A;  2FD6 U;  1QKD A;  2CCX A;  2CRT A;  1LJZ A;  3NEQ A;  3U73 U;  1LSI A;  1FAS A;  2ABX A;  2H5F A;  1CCQ A;  2PJY C;  2UWR A;  2H7Z A;  1LX5 B;  1KBT A;  1IKC A;  1JBD A;  3VTS A;  1IDG A;  1JE9 A;  1KXI A;  1ONJ A;  1XT3 A;  1KTZ B;  1CXN A;  1COD A;  3EVS C;  1NTX A;  1CB9 A;  4EY8 B;  1HC9 A;  1TXB A;  5IMT D;  3EBX A;  1NXB A;  2BHI A;  3BT2 U;  1HC9 B;  4P7U A;  2MJ4 A;  2JQP A;  1IDL A;  1TXA A;  3LAQ U;  1JGK A;  1S4Y A;  4ZQY A;  1V6P A;  1LXH A;  4OM5 A;  3ERA A;  1MR6 A;  1CRF A;  2QJA C;  4DO8 A;  2QJB C;  5DO6 A;  5DZ5 A;  4QTI U;  2QC1 A;  1F94 A;  1IDH A;  1FSC A;  1ES7 B;  2BTX A;  1LXG A;  1KC4 A;  1NTN A;  2GOO C;  1TGX A;  2H62 C;  1B41 B;  1FFJ A;  1ERG A;  4BDT B;  2L5S A;  1H0J A;  1QKE A;  2OFS A;  4FAO E;  2MJY A;  4XJJ A;  1IK8 A;  1KL8 A;  1NYU A;  6EBX A;  3U74 U;  4OM4 A;  1CXO A;  1I02 A;  2GOO B;  1RGJ A;  3BT1 U;  1BXP A;  2HLR A;  3KFD I;  4RUD A;  4LFT A;  1UG4 A;  3NDS A;  2MUP A;  4UY2 C;  5EBX A;  1DRS A;  1CDR A;  2H8U A;  2K3G A;  1PLO A;  1RL5 A;  1HAJ A;  2I9B E;  1CRE A;  2LCR A;  1HOY A;  2CTX A;  1QM7 A;  1BTE A;  2L03 A;  2CDX A;  1NOR A;  1IDI A;  1KBA A;  1ABT A;  1FSS B;  1IJC A;  1YWH A;  1CDQ A;  1COE A;  5IMY C;  1VB0 A;  4BIK B;  1ERA A;  1CDT A;  4HQP F;  1G6M A;  1CHV S;  2PJY B;  1MAH F;  1FRA A;  3NH7 A;  2H7Z B;  1ZAD A;  2J8B A;  2MFA A;  3PLC A;  2H64 B;  2X8B B;  4IYE A;  1CDS A;  2H62 D;  2HLQ A;  2MUO A;  1REW C;  1KBS A;  2QJ9 C;  1NYS A;  1TFS A;  4AEA A;  3HH7 A;  1CVO A;  1M9Z A;  1HAA A;  2UX2 A;  1KU6 B;  1L4W A;  1F8U B;  2JVE A;  2N99 A;  1CTX A;  4FAO C;  2ERA A;  1W6B A;  1IQ9 A;  3QB4 B;  2H64 C;  1KS6 A;  2MJ0 A;  3KFD E;  2CRS A; 
#chains in the Genus database with same CATH topology
 2MHY A;  1NEA A;  2LA1 A;  1FF4 A;  2NBT A;  3FEV A;  1KFH A;  2VLW A;  5DU1 A;  2FD6 U;  1QKD A;  2CCX A;  2CRT A;  1LJZ A;  3NEQ A;  3U73 U;  1LSI A;  1FAS A;  2ABX A;  2H5F A;  1CCQ A;  2PJY C;  2UWR A;  2H7Z A;  1LX5 B;  1KBT A;  1IKC A;  1JBD A;  3VTS A;  1IDG A;  1JE9 A;  1KXI A;  1ONJ A;  1XT3 A;  1KTZ B;  1CXN A;  1COD A;  3EVS C;  1NTX A;  1CB9 A;  4EY8 B;  1HC9 A;  1TXB A;  5IMT D;  3EBX A;  1NXB A;  2BHI A;  3BT2 U;  1HC9 B;  4P7U A;  2MJ4 A;  2JQP A;  1IDL A;  1TXA A;  3LAQ U;  1JGK A;  1S4Y A;  4ZQY A;  1V6P A;  1LXH A;  4OM5 A;  3ERA A;  1MR6 A;  1CRF A;  2QJA C;  4DO8 A;  2QJB C;  5DO6 A;  5DZ5 A;  4QTI U;  2QC1 A;  1F94 A;  1IDH A;  1FSC A;  1ES7 B;  2BTX A;  1LXG A;  1KC4 A;  1NTN A;  2GOO C;  1TGX A;  2H62 C;  1B41 B;  1FFJ A;  1ERG A;  4BDT B;  2L5S A;  1H0J A;  1QKE A;  2OFS A;  4FAO E;  2MJY A;  4XJJ A;  1IK8 A;  1KL8 A;  1NYU A;  6EBX A;  3U74 U;  4OM4 A;  1CXO A;  1I02 A;  2GOO B;  1RGJ A;  4KSN A;  3BT1 U;  1BXP A;  2HLR A;  3KFD I;  4RUD A;  4LFT A;  1UG4 A;  3NDS A;  2MUP A;  4UY2 C;  5EBX A;  1DRS A;  1CDR A;  2H8U A;  2K3G A;  1PLO A;  1RL5 A;  1HAJ A;  2I9B E;  1CRE A;  2LCR A;  1HOY A;  2CTX A;  1QM7 A;  1BTE A;  2L03 A;  2CDX A;  1NOR A;  1IDI A;  1KBA A;  1ABT A;  1FSS B;  1IJC A;  1YWH A;  1CDQ A;  1COE A;  5IMY C;  1VB0 A;  4BIK B;  1ERA A;  1CDT A;  4HQP F;  1G6M A;  1CHV S;  2PJY B;  1MAH F;  1FRA A;  3NH7 A;  2H7Z B;  1ZAD A;  2J8B A;  2MFA A;  3PLC A;  2H64 B;  2X8B B;  4IYE A;  1CDS A;  2H62 D;  2HLQ A;  2MUO A;  1REW C;  1KBS A;  2QJ9 C;  1NYS A;  1TFS A;  4AEA A;  3HH7 A;  1CVO A;  1M9Z A;  1HAA A;  2UX2 A;  1KU6 B;  1L4W A;  1F8U B;  2JVE A;  2N99 A;  1CTX A;  4FAO C;  2ERA A;  1W6B A;  1IQ9 A;  3QB4 B;  2H64 C;  1KS6 A;  2MJ0 A;  3KFD E;  2CRS A; 
#chains in the Genus database with same CATH homology
 2MHY A;  1NEA A;  2LA1 A;  1FF4 A;  2NBT A;  3FEV A;  1KFH A;  2VLW A;  5DU1 A;  2FD6 U;  1QKD A;  2CCX A;  2CRT A;  1LJZ A;  3NEQ A;  3U73 U;  1LSI A;  1FAS A;  2ABX A;  2H5F A;  1CCQ A;  2PJY C;  2UWR A;  2H7Z A;  1LX5 B;  1KBT A;  1IKC A;  1JBD A;  3VTS A;  1IDG A;  1JE9 A;  1KXI A;  1ONJ A;  1XT3 A;  1KTZ B;  1CXN A;  1COD A;  3EVS C;  1NTX A;  1CB9 A;  4EY8 B;  1HC9 A;  1TXB A;  5IMT D;  3EBX A;  1NXB A;  2BHI A;  3BT2 U;  1HC9 B;  4P7U A;  2MJ4 A;  2JQP A;  1IDL A;  1TXA A;  3LAQ U;  1JGK A;  1S4Y A;  4ZQY A;  1V6P A;  1LXH A;  4OM5 A;  3ERA A;  1MR6 A;  1CRF A;  2QJA C;  4DO8 A;  2QJB C;  5DO6 A;  5DZ5 A;  4QTI U;  2QC1 A;  1F94 A;  1IDH A;  1FSC A;  1ES7 B;  2BTX A;  1LXG A;  1KC4 A;  1NTN A;  2GOO C;  1TGX A;  2H62 C;  1B41 B;  1FFJ A;  1ERG A;  4BDT B;  2L5S A;  1H0J A;  1QKE A;  2OFS A;  4FAO E;  2MJY A;  4XJJ A;  1IK8 A;  1KL8 A;  1NYU A;  6EBX A;  3U74 U;  4OM4 A;  1CXO A;  1I02 A;  2GOO B;  1RGJ A;  4KSN A;  3BT1 U;  1BXP A;  2HLR A;  3KFD I;  4RUD A;  4LFT A;  1UG4 A;  3NDS A;  2MUP A;  4UY2 C;  5EBX A;  1DRS A;  1CDR A;  2H8U A;  2K3G A;  1PLO A;  1RL5 A;  1HAJ A;  2I9B E;  1CRE A;  2LCR A;  1HOY A;  2CTX A;  1QM7 A;  1BTE A;  2L03 A;  2CDX A;  1NOR A;  1IDI A;  1KBA A;  1ABT A;  1FSS B;  1IJC A;  1YWH A;  1CDQ A;  1COE A;  5IMY C;  1VB0 A;  4BIK B;  1ERA A;  1CDT A;  4HQP F;  1G6M A;  1CHV S;  2PJY B;  1MAH F;  1FRA A;  3NH7 A;  2H7Z B;  1ZAD A;  2J8B A;  2MFA A;  3PLC A;  2H64 B;  2X8B B;  4IYE A;  1CDS A;  2H62 D;  2HLQ A;  2MUO A;  1REW C;  1KBS A;  2QJ9 C;  1NYS A;  1TFS A;  4AEA A;  3HH7 A;  1CVO A;  1M9Z A;  1HAA A;  2UX2 A;  1KU6 B;  1L4W A;  1F8U B;  2JVE A;  2N99 A;  1CTX A;  4FAO C;  2ERA A;  1W6B A;  1IQ9 A;  3QB4 B;  2H64 C;  1KS6 A;  2MJ0 A;  3KFD E;  2CRS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...