1IDLA

The nmr solution structure of alpha-bungarotoxin
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
74
structure length
74
Chain Sequence
IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The solution structure of the complex formed between alpha-bungarotoxin and an 18-mer cognate peptide derived from the alpha 1 subunit of the nicotinic acetylcholine receptor from Torpedo californica.
pubmed doi rcsb
molecule tags Toxin
molecule keywords ALPHA-BUNGAROTOXIN
total genus 2
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2001-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1idlA00
2UX2A 5DZ5A 2H8UA 2LCRA 1CDTA 1TXBA 3PLCA 3VTSA 3U74U 2CDXA 1KXIA 2LA1A 4BIKB 3BT1U 1LJZA 1KBSA 3HH7A 2H5FA 1FASA 1IQ9A 1QM7A 2ERAA 3LAQU 1REWC 2MFAA 2JVEA 1NORA 1TXAA 1ZADA 2H7ZB 1CB9A 1KBAA 2X8BB 1UG4A 3ERAA 1IJCA 5DU1A 1FRAA 1ABTA 1KC4A 1RL5A 2VLWA 4HQPF 1IDGA 2PJYB 4QTIU 1S4YA 2L5SA 1G6MA 1CREA 1IDHA 1CDSA 1LSIA 4P7UA 3NEQA 2QJ9C 4OM5A 2ABXA 4LFTA 2H7ZA 2MJ4A 1F8UB 2QJBC 5DO6A 1IDIA 2MJ0A 4BDTB 2H62C 1KBTA 1FSSB 4FAOE 2K3GA 2H64C 1PLOA 1LX5B 5EBXA 1NTNA 1FFJA 1BXPA 1ES7B 4AEAA 4DO8A 2H64B 1KU6B 1NXBA 2CCXA 2HLRA 1TGXA 3EBXA 1KL8A 4ZQYA 1I02A 1IKCA 1VB0A 4OM4A 1L4WA 1HOYA 3KFDE 1KS6A 1FF4A 3U73U 2MUOA 2CRTA 2H62D 1XT3A 1M9ZA 1NEAA 2GOOB 1YWHA 1BTEA 1TFSA 2HLQA 1HAAA 1DRSA 1F94A 1CXNA 1LXHA 3BT2U 4IYEA 3FEVA 3NDSA 2I9BE 3NH7A 4FAOC 1ONJA 4EY8B 1ERAA 4UY2C 1B41B 1FSCA 2L03A 3KFDI 1LXGA 1JGKA 2BTXA 1NTXA 1W6BA 1MR6A 2OFSA 2GOOC 2MJYA 1CTXA 1CXOA 2QC1A 1CHVS 4XJJA 6EBXA 1RGJA 1HAJA 1IK8A 2N99A 1CCQA 1JE9A 1CDQA 2CTXA 1HC9A 2BHIA 2CRSA 2FD6U 1COEA 1CVOA 2NBTA 1H0JA 5IMYC 3QB4B 1CDRA 2MUPA 1MAHF 1KTZB 3EVSC 1CRFA 1ERGA 1NYUA 2UWRA 5IMTD 1CODA 4RUDA 1IDLA 1KFHA 2PJYC 1JBDA 1QKEA 2JQPA 1QKDA 2QJAC 1HC9B 1V6PA 1NYSA 2MHYA 2J8BA
chains in the Genus database with same CATH superfamily
2UX2A 5DZ5A 2H8UA 2LCRA 1CDTA 1TXBA 3PLCA 3VTSA 3U74U 2CDXA 1KXIA 2LA1A 4BIKB 3BT1U 1LJZA 1KBSA 3HH7A 2H5FA 1FASA 1IQ9A 1QM7A 2ERAA 3LAQU 1REWC 2MFAA 2JVEA 1NORA 1TXAA 1ZADA 2H7ZB 1CB9A 1KBAA 2X8BB 1UG4A 3ERAA 1IJCA 5DU1A 1FRAA 1ABTA 1KC4A 1RL5A 2VLWA 4HQPF 1IDGA 2PJYB 4QTIU 1S4YA 2L5SA 1G6MA 1CREA 1IDHA 1CDSA 1LSIA 4P7UA 3NEQA 2QJ9C 4OM5A 2ABXA 4LFTA 2H7ZA 2MJ4A 1F8UB 2QJBC 5DO6A 1IDIA 2MJ0A 4BDTB 2H62C 1KBTA 1FSSB 4FAOE 2K3GA 2H64C 1PLOA 1LX5B 5EBXA 1NTNA 1FFJA 1BXPA 1ES7B 4AEAA 4DO8A 2H64B 1KU6B 1NXBA 2CCXA 2HLRA 1TGXA 3EBXA 1KL8A 4ZQYA 1I02A 1IKCA 1VB0A 4OM4A 1L4WA 1HOYA 3KFDE 1KS6A 1FF4A 3U73U 2MUOA 2CRTA 2H62D 1XT3A 1M9ZA 4KSNA 1NEAA 2GOOB 1YWHA 1BTEA 1TFSA 2HLQA 1HAAA 1DRSA 1F94A 1CXNA 1LXHA 3BT2U 4IYEA 3FEVA 3NDSA 2I9BE 3NH7A 4FAOC 1ONJA 4EY8B 1ERAA 4UY2C 1B41B 1FSCA 2L03A 3KFDI 1LXGA 1JGKA 2BTXA 1NTXA 1W6BA 1MR6A 2OFSA 2GOOC 2MJYA 1CTXA 1CXOA 2QC1A 1CHVS 4XJJA 6EBXA 1RGJA 1HAJA 1IK8A 2N99A 1CCQA 1JE9A 1CDQA 2CTXA 1HC9A 2BHIA 2CRSA 2FD6U 1COEA 1CVOA 2NBTA 1H0JA 5IMYC 3QB4B 1CDRA 2MUPA 1MAHF 1KTZB 3EVSC 1CRFA 1ERGA 1NYUA 2UWRA 5IMTD 1CODA 4RUDA 1IDLA 1KFHA 2PJYC 1JBDA 1QKEA 2JQPA 1QKDA 2QJAC 1HC9B 1V6PA 1NYSA 2MHYA 2J8BA
chains in the Genus database with same CATH topology
2UX2A 5DZ5A 2H8UA 2LCRA 1CDTA 1TXBA 3PLCA 3VTSA 3U74U 2CDXA 1KXIA 2LA1A 4BIKB 3BT1U 1LJZA 1KBSA 3HH7A 2H5FA 1FASA 1IQ9A 1QM7A 2ERAA 3LAQU 1REWC 2MFAA 2JVEA 1NORA 1TXAA 1ZADA 2H7ZB 1CB9A 1KBAA 2X8BB 1UG4A 3ERAA 1IJCA 5DU1A 1FRAA 1ABTA 1KC4A 1RL5A 2VLWA 4HQPF 1IDGA 2PJYB 4QTIU 1S4YA 2L5SA 1G6MA 1CREA 1IDHA 1CDSA 1LSIA 4P7UA 3NEQA 2QJ9C 4OM5A 2ABXA 4LFTA 2H7ZA 2MJ4A 1F8UB 2QJBC 5DO6A 1IDIA 2MJ0A 4BDTB 2H62C 1KBTA 1FSSB 4FAOE 2K3GA 2H64C 1PLOA 1LX5B 5EBXA 1NTNA 1FFJA 1BXPA 1ES7B 4AEAA 4DO8A 2H64B 1KU6B 1NXBA 2CCXA 2HLRA 1TGXA 3EBXA 1KL8A 4ZQYA 1I02A 1IKCA 1VB0A 4OM4A 1L4WA 1HOYA 3KFDE 1KS6A 1FF4A 3U73U 2MUOA 2CRTA 2H62D 1XT3A 1M9ZA 4KSNA 1NEAA 2GOOB 1YWHA 1BTEA 1TFSA 2HLQA 1HAAA 1DRSA 1F94A 1CXNA 1LXHA 3BT2U 4IYEA 3FEVA 3NDSA 2I9BE 3NH7A 4FAOC 1ONJA 4EY8B 1ERAA 4UY2C 1B41B 1FSCA 2L03A 3KFDI 1LXGA 1JGKA 2BTXA 1NTXA 1W6BA 1MR6A 2OFSA 2GOOC 2MJYA 1CTXA 1CXOA 2QC1A 1CHVS 4XJJA 6EBXA 1RGJA 1HAJA 1IK8A 2N99A 1CCQA 1JE9A 1CDQA 2CTXA 1HC9A 2BHIA 2CRSA 2FD6U 1COEA 1CVOA 2NBTA 1H0JA 5IMYC 3QB4B 1CDRA 2MUPA 1MAHF 1KTZB 3EVSC 1CRFA 1ERGA 1NYUA 2UWRA 5IMTD 1CODA 4RUDA 1IDLA 1KFHA 2PJYC 1JBDA 1QKEA 2JQPA 1QKDA 2QJAC 1HC9B 1V6PA 1NYSA 2MHYA 2J8BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UX2 A;  5DZ5 A;  2H8U A;  2LCR A;  1CDT A;  1TXB A;  3PLC A;  3VTS A;  3U74 U;  2CDX A;  1KXI A;  2LA1 A;  4BIK B;  3BT1 U;  1LJZ A;  1KBS A;  3HH7 A;  2H5F A;  1FAS A;  1IQ9 A;  1QM7 A;  2ERA A;  3LAQ U;  1REW C;  2MFA A;  2JVE A;  1NOR A;  1TXA A;  1ZAD A;  2H7Z B;  1CB9 A;  1KBA A;  2X8B B;  1UG4 A;  3ERA A;  1IJC A;  5DU1 A;  1FRA A;  1ABT A;  1KC4 A;  1RL5 A;  2VLW A;  4HQP F;  1IDG A;  2PJY B;  4QTI U;  1S4Y A;  2L5S A;  1G6M A;  1CRE A;  1IDH A;  1CDS A;  1LSI A;  4P7U A;  3NEQ A;  2QJ9 C;  4OM5 A;  2ABX A;  4LFT A;  2H7Z A;  2MJ4 A;  1F8U B;  2QJB C;  5DO6 A;  1IDI A;  2MJ0 A;  4BDT B;  2H62 C;  1KBT A;  1FSS B;  4FAO E;  2K3G A;  2H64 C;  1PLO A;  1LX5 B;  5EBX A;  1NTN A;  1FFJ A;  1BXP A;  1ES7 B;  4AEA A;  4DO8 A;  2H64 B;  1KU6 B;  1NXB A;  2CCX A;  2HLR A;  1TGX A;  3EBX A;  1KL8 A;  4ZQY A;  1I02 A;  1IKC A;  1VB0 A;  4OM4 A;  1L4W A;  1HOY A;  3KFD E;  1KS6 A;  1FF4 A;  3U73 U;  2MUO A;  2CRT A;  2H62 D;  1XT3 A;  1M9Z A;  1NEA A;  2GOO B;  1YWH A;  1BTE A;  1TFS A;  2HLQ A;  1HAA A;  1DRS A;  1F94 A;  1CXN A;  1LXH A;  3BT2 U;  4IYE A;  3FEV A;  3NDS A;  2I9B E;  3NH7 A;  4FAO C;  1ONJ A;  4EY8 B;  1ERA A;  4UY2 C;  1B41 B;  1FSC A;  2L03 A;  3KFD I;  1LXG A;  1JGK A;  2BTX A;  1NTX A;  1W6B A;  1MR6 A;  2OFS A;  2GOO C;  2MJY A;  1CTX A;  1CXO A;  2QC1 A;  1CHV S;  4XJJ A;  6EBX A;  1RGJ A;  1HAJ A;  1IK8 A;  2N99 A;  1CCQ A;  1JE9 A;  1CDQ A;  2CTX A;  1HC9 A;  2BHI A;  2CRS A;  2FD6 U;  1COE A;  1CVO A;  2NBT A;  1H0J A;  5IMY C;  3QB4 B;  1CDR A;  2MUP A;  1MAH F;  1KTZ B;  3EVS C;  1CRF A;  1ERG A;  1NYU A;  2UWR A;  5IMT D;  1COD A;  4RUD A;  1IDL A;  1KFH A;  2PJY C;  1JBD A;  1QKE A;  2JQP A;  1QKD A;  2QJA C;  1HC9 B;  1V6P A;  1NYS A;  2MHY A;  2J8B A; 
#chains in the Genus database with same CATH topology
 2UX2 A;  5DZ5 A;  2H8U A;  2LCR A;  1CDT A;  1TXB A;  3PLC A;  3VTS A;  3U74 U;  2CDX A;  1KXI A;  2LA1 A;  4BIK B;  3BT1 U;  1LJZ A;  1KBS A;  3HH7 A;  2H5F A;  1FAS A;  1IQ9 A;  1QM7 A;  2ERA A;  3LAQ U;  1REW C;  2MFA A;  2JVE A;  1NOR A;  1TXA A;  1ZAD A;  2H7Z B;  1CB9 A;  1KBA A;  2X8B B;  1UG4 A;  3ERA A;  1IJC A;  5DU1 A;  1FRA A;  1ABT A;  1KC4 A;  1RL5 A;  2VLW A;  4HQP F;  1IDG A;  2PJY B;  4QTI U;  1S4Y A;  2L5S A;  1G6M A;  1CRE A;  1IDH A;  1CDS A;  1LSI A;  4P7U A;  3NEQ A;  2QJ9 C;  4OM5 A;  2ABX A;  4LFT A;  2H7Z A;  2MJ4 A;  1F8U B;  2QJB C;  5DO6 A;  1IDI A;  2MJ0 A;  4BDT B;  2H62 C;  1KBT A;  1FSS B;  4FAO E;  2K3G A;  2H64 C;  1PLO A;  1LX5 B;  5EBX A;  1NTN A;  1FFJ A;  1BXP A;  1ES7 B;  4AEA A;  4DO8 A;  2H64 B;  1KU6 B;  1NXB A;  2CCX A;  2HLR A;  1TGX A;  3EBX A;  1KL8 A;  4ZQY A;  1I02 A;  1IKC A;  1VB0 A;  4OM4 A;  1L4W A;  1HOY A;  3KFD E;  1KS6 A;  1FF4 A;  3U73 U;  2MUO A;  2CRT A;  2H62 D;  1XT3 A;  1M9Z A;  4KSN A;  1NEA A;  2GOO B;  1YWH A;  1BTE A;  1TFS A;  2HLQ A;  1HAA A;  1DRS A;  1F94 A;  1CXN A;  1LXH A;  3BT2 U;  4IYE A;  3FEV A;  3NDS A;  2I9B E;  3NH7 A;  4FAO C;  1ONJ A;  4EY8 B;  1ERA A;  4UY2 C;  1B41 B;  1FSC A;  2L03 A;  3KFD I;  1LXG A;  1JGK A;  2BTX A;  1NTX A;  1W6B A;  1MR6 A;  2OFS A;  2GOO C;  2MJY A;  1CTX A;  1CXO A;  2QC1 A;  1CHV S;  4XJJ A;  6EBX A;  1RGJ A;  1HAJ A;  1IK8 A;  2N99 A;  1CCQ A;  1JE9 A;  1CDQ A;  2CTX A;  1HC9 A;  2BHI A;  2CRS A;  2FD6 U;  1COE A;  1CVO A;  2NBT A;  1H0J A;  5IMY C;  3QB4 B;  1CDR A;  2MUP A;  1MAH F;  1KTZ B;  3EVS C;  1CRF A;  1ERG A;  1NYU A;  2UWR A;  5IMT D;  1COD A;  4RUD A;  1IDL A;  1KFH A;  2PJY C;  1JBD A;  1QKE A;  2JQP A;  1QKD A;  2QJA C;  1HC9 B;  1V6P A;  1NYS A;  2MHY A;  2J8B A; 
#chains in the Genus database with same CATH homology
 2UX2 A;  5DZ5 A;  2H8U A;  2LCR A;  1CDT A;  1TXB A;  3PLC A;  3VTS A;  3U74 U;  2CDX A;  1KXI A;  2LA1 A;  4BIK B;  3BT1 U;  1LJZ A;  1KBS A;  3HH7 A;  2H5F A;  1FAS A;  1IQ9 A;  1QM7 A;  2ERA A;  3LAQ U;  1REW C;  2MFA A;  2JVE A;  1NOR A;  1TXA A;  1ZAD A;  2H7Z B;  1CB9 A;  1KBA A;  2X8B B;  1UG4 A;  3ERA A;  1IJC A;  5DU1 A;  1FRA A;  1ABT A;  1KC4 A;  1RL5 A;  2VLW A;  4HQP F;  1IDG A;  2PJY B;  4QTI U;  1S4Y A;  2L5S A;  1G6M A;  1CRE A;  1IDH A;  1CDS A;  1LSI A;  4P7U A;  3NEQ A;  2QJ9 C;  4OM5 A;  2ABX A;  4LFT A;  2H7Z A;  2MJ4 A;  1F8U B;  2QJB C;  5DO6 A;  1IDI A;  2MJ0 A;  4BDT B;  2H62 C;  1KBT A;  1FSS B;  4FAO E;  2K3G A;  2H64 C;  1PLO A;  1LX5 B;  5EBX A;  1NTN A;  1FFJ A;  1BXP A;  1ES7 B;  4AEA A;  4DO8 A;  2H64 B;  1KU6 B;  1NXB A;  2CCX A;  2HLR A;  1TGX A;  3EBX A;  1KL8 A;  4ZQY A;  1I02 A;  1IKC A;  1VB0 A;  4OM4 A;  1L4W A;  1HOY A;  3KFD E;  1KS6 A;  1FF4 A;  3U73 U;  2MUO A;  2CRT A;  2H62 D;  1XT3 A;  1M9Z A;  4KSN A;  1NEA A;  2GOO B;  1YWH A;  1BTE A;  1TFS A;  2HLQ A;  1HAA A;  1DRS A;  1F94 A;  1CXN A;  1LXH A;  3BT2 U;  4IYE A;  3FEV A;  3NDS A;  2I9B E;  3NH7 A;  4FAO C;  1ONJ A;  4EY8 B;  1ERA A;  4UY2 C;  1B41 B;  1FSC A;  2L03 A;  3KFD I;  1LXG A;  1JGK A;  2BTX A;  1NTX A;  1W6B A;  1MR6 A;  2OFS A;  2GOO C;  2MJY A;  1CTX A;  1CXO A;  2QC1 A;  1CHV S;  4XJJ A;  6EBX A;  1RGJ A;  1HAJ A;  1IK8 A;  2N99 A;  1CCQ A;  1JE9 A;  1CDQ A;  2CTX A;  1HC9 A;  2BHI A;  2CRS A;  2FD6 U;  1COE A;  1CVO A;  2NBT A;  1H0J A;  5IMY C;  3QB4 B;  1CDR A;  2MUP A;  1MAH F;  1KTZ B;  3EVS C;  1CRF A;  1ERG A;  1NYU A;  2UWR A;  5IMT D;  1COD A;  4RUD A;  1IDL A;  1KFH A;  2PJY C;  1JBD A;  1QKE A;  2JQP A;  1QKD A;  2QJA C;  1HC9 B;  1V6P A;  1NYS A;  2MHY A;  2J8B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...