3KFDI

Ternary complex of tgf-b1 reveals isoform-specific ligand recognition and receptor recruitment in the superfamily
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
77
structure length
66
Chain Sequence
ALQCFCHLCTKDNFTCVTDGLCFVSVTDKVIHNSMCIAEIDLIPRDRPFVCATTTYCCNQDHCNKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine/cytokine receptor
molecule keywords Transforming growth factor beta-1
publication title Ternary complex of transforming growth factor-beta1 reveals isoform-specific ligand recognition and receptor recruitment in the superfamily.
pubmed doi rcsb
source organism Homo sapiens
total genus 9
structure length 66
sequence length 77
chains with identical sequence J, K, L
ec nomenclature ec 2.7.11.30: Receptor protein serine/threonine kinase.
pdb deposition date 2009-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF01064 Activin_recp Activin types I and II receptor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 3kfdI00
1HAAA 1F8UB 2H5FA 3BT2U 5DZ5A 2CDXA 2HLRA 4ZQYA 2CCXA 1NYUA 1FSCA 1PLOA 5EBXA 1I02A 1CODA 1V6PA 1CXOA 2HLQA 1JE9A 2J8BA 2NBTA 4UY2C 1LXGA 2LCRA 2FD6U 5IMTD 1KS6A 2GOOC 2H7ZA 2MUOA 2OFSA 3KFDE 1CXNA 1IDGA 2I9BE 1XT3A 3EBXA 1NEAA 1IJCA 1MR6A 1QKDA 1MAHF 1CREA 3KFDI 1M9ZA 1NTXA 4BDTB 1FFJA 1CVOA 2K3GA 1FF4A 3LAQU 2H7ZB 1LX5B 1ONJA 2H64C 2UWRA 2H8UA 1FSSB 1LSIA 1S4YA 3FEVA 2ERAA 2QJBC 1IDHA 3BT1U 1CRFA 2QJ9C 4AEAA 2H62C 4P7UA 1FASA 1IDIA 1ZADA 2BTXA 1UG4A 2MUPA 2PJYB 3QB4B 2UX2A 1KXIA 5DO6A 1QM7A 4OM4A 3EVSC 1CDTA 4RUDA 1IK8A 3U73U 1LXHA 1NTNA 1CHVS 1HOYA 1KFHA 2MJ0A 1BXPA 1L4WA 1COEA 2VLWA 1KU6B 2N99A 1CCQA 1CDSA 1IKCA 1REWC 1NORA 4EY8B 1KBTA 5DU1A 2H62D 2X8BB 4FAOE 1YWHA 1QKEA 2ABXA 2CRTA 1ERGA 2QJAC 1HAJA 1JGKA 1RL5A 1KBAA 1NYSA 2L03A 5IMYC 1F94A 2MFAA 1CDQA 1IDLA 4FAOC 1HC9B 4BIKB 3HH7A 2JVEA 6EBXA 2JQPA 1VB0A 1KL8A 1KTZB 2LA1A 2QC1A 1CTXA 2BHIA 1LJZA 1KBSA 1RGJA 1FRAA 2MJYA 3NEQA 4XJJA 2PJYC 1TXAA 3ERAA 1CDRA 3PLCA 1JBDA 1G6MA 1IQ9A 4QTIU 1ES7B 3VTSA 1HC9A 4OM5A 1H0JA 4DO8A 1CB9A 2GOOB 1TXBA 1NXBA 2L5SA 1TFSA 3NDSA 1TGXA 2MJ4A 1ERAA 1W6BA 1BTEA 1ABTA 1KC4A 4IYEA 2CRSA 3NH7A 1B41B 2MHYA 3U74U 1DRSA 2CTXA 4HQPF 2H64B 4LFTA
chains in the Genus database with same CATH superfamily
1HAAA 1F8UB 2H5FA 3BT2U 5DZ5A 2CDXA 2HLRA 4ZQYA 2CCXA 1NYUA 1FSCA 1PLOA 5EBXA 1I02A 1CODA 1V6PA 1CXOA 2HLQA 1JE9A 2J8BA 2NBTA 4UY2C 1LXGA 2LCRA 2FD6U 5IMTD 1KS6A 2GOOC 2H7ZA 2MUOA 2OFSA 3KFDE 1CXNA 1IDGA 2I9BE 1XT3A 3EBXA 4KSNA 1NEAA 1IJCA 1MR6A 1QKDA 1MAHF 1CREA 3KFDI 1M9ZA 1NTXA 4BDTB 1FFJA 1CVOA 2K3GA 1FF4A 3LAQU 2H7ZB 1LX5B 1ONJA 2H64C 2UWRA 2H8UA 1FSSB 1LSIA 1S4YA 3FEVA 2ERAA 2QJBC 1IDHA 3BT1U 1CRFA 2QJ9C 4AEAA 2H62C 4P7UA 1FASA 1IDIA 1ZADA 2BTXA 1UG4A 2MUPA 2PJYB 3QB4B 2UX2A 1KXIA 5DO6A 1QM7A 4OM4A 3EVSC 1CDTA 4RUDA 1IK8A 3U73U 1LXHA 1NTNA 1CHVS 1HOYA 1KFHA 2MJ0A 1BXPA 1L4WA 1COEA 2VLWA 1KU6B 2N99A 1CCQA 1CDSA 1IKCA 1REWC 1NORA 4EY8B 1KBTA 5DU1A 2H62D 2X8BB 4FAOE 1YWHA 1QKEA 2ABXA 2CRTA 1ERGA 2QJAC 1HAJA 1JGKA 1RL5A 1KBAA 1NYSA 2L03A 5IMYC 1F94A 2MFAA 1CDQA 1IDLA 4FAOC 1HC9B 4BIKB 3HH7A 2JVEA 6EBXA 2JQPA 1VB0A 1KL8A 1KTZB 2LA1A 2QC1A 1CTXA 2BHIA 1LJZA 1KBSA 1RGJA 1FRAA 2MJYA 3NEQA 4XJJA 2PJYC 1TXAA 3ERAA 1CDRA 3PLCA 1JBDA 1G6MA 1IQ9A 4QTIU 1ES7B 3VTSA 1HC9A 4OM5A 1H0JA 4DO8A 1CB9A 2GOOB 1TXBA 1NXBA 2L5SA 1TFSA 3NDSA 1TGXA 2MJ4A 1ERAA 1W6BA 1BTEA 1ABTA 1KC4A 4IYEA 2CRSA 3NH7A 1B41B 2MHYA 3U74U 1DRSA 2CTXA 4HQPF 2H64B 4LFTA
chains in the Genus database with same CATH topology
1HAAA 1F8UB 2H5FA 3BT2U 5DZ5A 2CDXA 2HLRA 4ZQYA 2CCXA 1NYUA 1FSCA 1PLOA 5EBXA 1I02A 1CODA 1V6PA 1CXOA 2HLQA 1JE9A 2J8BA 2NBTA 4UY2C 1LXGA 2LCRA 2FD6U 5IMTD 1KS6A 2GOOC 2H7ZA 2MUOA 2OFSA 3KFDE 1CXNA 1IDGA 2I9BE 1XT3A 3EBXA 4KSNA 1NEAA 1IJCA 1MR6A 1QKDA 1MAHF 1CREA 3KFDI 1M9ZA 1NTXA 4BDTB 1FFJA 1CVOA 2K3GA 1FF4A 3LAQU 2H7ZB 1LX5B 1ONJA 2H64C 2UWRA 2H8UA 1FSSB 1LSIA 1S4YA 3FEVA 2ERAA 2QJBC 1IDHA 3BT1U 1CRFA 2QJ9C 4AEAA 2H62C 4P7UA 1FASA 1IDIA 1ZADA 2BTXA 1UG4A 2MUPA 2PJYB 3QB4B 2UX2A 1KXIA 5DO6A 1QM7A 4OM4A 3EVSC 1CDTA 4RUDA 1IK8A 3U73U 1LXHA 1NTNA 1CHVS 1HOYA 1KFHA 2MJ0A 1BXPA 1L4WA 1COEA 2VLWA 1KU6B 2N99A 1CCQA 1CDSA 1IKCA 1REWC 1NORA 4EY8B 1KBTA 5DU1A 2H62D 2X8BB 4FAOE 1YWHA 1QKEA 2ABXA 2CRTA 1ERGA 2QJAC 1HAJA 1JGKA 1RL5A 1KBAA 1NYSA 2L03A 5IMYC 1F94A 2MFAA 1CDQA 1IDLA 4FAOC 1HC9B 4BIKB 3HH7A 2JVEA 6EBXA 2JQPA 1VB0A 1KL8A 1KTZB 2LA1A 2QC1A 1CTXA 2BHIA 1LJZA 1KBSA 1RGJA 1FRAA 2MJYA 3NEQA 4XJJA 2PJYC 1TXAA 3ERAA 1CDRA 3PLCA 1JBDA 1G6MA 1IQ9A 4QTIU 1ES7B 3VTSA 1HC9A 4OM5A 1H0JA 4DO8A 1CB9A 2GOOB 1TXBA 1NXBA 2L5SA 1TFSA 3NDSA 1TGXA 2MJ4A 1ERAA 1W6BA 1BTEA 1ABTA 1KC4A 4IYEA 2CRSA 3NH7A 1B41B 2MHYA 3U74U 1DRSA 2CTXA 4HQPF 2H64B 4LFTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HAA A;  1F8U B;  2H5F A;  3BT2 U;  5DZ5 A;  2CDX A;  2HLR A;  4ZQY A;  2CCX A;  1NYU A;  1FSC A;  1PLO A;  5EBX A;  1I02 A;  1COD A;  1V6P A;  1CXO A;  2HLQ A;  1JE9 A;  2J8B A;  2NBT A;  4UY2 C;  1LXG A;  2LCR A;  2FD6 U;  5IMT D;  1KS6 A;  2GOO C;  2H7Z A;  2MUO A;  2OFS A;  3KFD E;  1CXN A;  1IDG A;  2I9B E;  1XT3 A;  3EBX A;  1NEA A;  1IJC A;  1MR6 A;  1QKD A;  1MAH F;  1CRE A;  3KFD I;  1M9Z A;  1NTX A;  4BDT B;  1FFJ A;  1CVO A;  2K3G A;  1FF4 A;  3LAQ U;  2H7Z B;  1LX5 B;  1ONJ A;  2H64 C;  2UWR A;  2H8U A;  1FSS B;  1LSI A;  1S4Y A;  3FEV A;  2ERA A;  2QJB C;  1IDH A;  3BT1 U;  1CRF A;  2QJ9 C;  4AEA A;  2H62 C;  4P7U A;  1FAS A;  1IDI A;  1ZAD A;  2BTX A;  1UG4 A;  2MUP A;  2PJY B;  3QB4 B;  2UX2 A;  1KXI A;  5DO6 A;  1QM7 A;  4OM4 A;  3EVS C;  1CDT A;  4RUD A;  1IK8 A;  3U73 U;  1LXH A;  1NTN A;  1CHV S;  1HOY A;  1KFH A;  2MJ0 A;  1BXP A;  1L4W A;  1COE A;  2VLW A;  1KU6 B;  2N99 A;  1CCQ A;  1CDS A;  1IKC A;  1REW C;  1NOR A;  4EY8 B;  1KBT A;  5DU1 A;  2H62 D;  2X8B B;  4FAO E;  1YWH A;  1QKE A;  2ABX A;  2CRT A;  1ERG A;  2QJA C;  1HAJ A;  1JGK A;  1RL5 A;  1KBA A;  1NYS A;  2L03 A;  5IMY C;  1F94 A;  2MFA A;  1CDQ A;  1IDL A;  4FAO C;  1HC9 B;  4BIK B;  3HH7 A;  2JVE A;  6EBX A;  2JQP A;  1VB0 A;  1KL8 A;  1KTZ B;  2LA1 A;  2QC1 A;  1CTX A;  2BHI A;  1LJZ A;  1KBS A;  1RGJ A;  1FRA A;  2MJY A;  3NEQ A;  4XJJ A;  2PJY C;  1TXA A;  3ERA A;  1CDR A;  3PLC A;  1JBD A;  1G6M A;  1IQ9 A;  4QTI U;  1ES7 B;  3VTS A;  1HC9 A;  4OM5 A;  1H0J A;  4DO8 A;  1CB9 A;  2GOO B;  1TXB A;  1NXB A;  2L5S A;  1TFS A;  3NDS A;  1TGX A;  2MJ4 A;  1ERA A;  1W6B A;  1BTE A;  1ABT A;  1KC4 A;  4IYE A;  2CRS A;  3NH7 A;  1B41 B;  2MHY A;  3U74 U;  1DRS A;  2CTX A;  4HQP F;  2H64 B;  4LFT A; 
#chains in the Genus database with same CATH topology
 1HAA A;  1F8U B;  2H5F A;  3BT2 U;  5DZ5 A;  2CDX A;  2HLR A;  4ZQY A;  2CCX A;  1NYU A;  1FSC A;  1PLO A;  5EBX A;  1I02 A;  1COD A;  1V6P A;  1CXO A;  2HLQ A;  1JE9 A;  2J8B A;  2NBT A;  4UY2 C;  1LXG A;  2LCR A;  2FD6 U;  5IMT D;  1KS6 A;  2GOO C;  2H7Z A;  2MUO A;  2OFS A;  3KFD E;  1CXN A;  1IDG A;  2I9B E;  1XT3 A;  3EBX A;  4KSN A;  1NEA A;  1IJC A;  1MR6 A;  1QKD A;  1MAH F;  1CRE A;  3KFD I;  1M9Z A;  1NTX A;  4BDT B;  1FFJ A;  1CVO A;  2K3G A;  1FF4 A;  3LAQ U;  2H7Z B;  1LX5 B;  1ONJ A;  2H64 C;  2UWR A;  2H8U A;  1FSS B;  1LSI A;  1S4Y A;  3FEV A;  2ERA A;  2QJB C;  1IDH A;  3BT1 U;  1CRF A;  2QJ9 C;  4AEA A;  2H62 C;  4P7U A;  1FAS A;  1IDI A;  1ZAD A;  2BTX A;  1UG4 A;  2MUP A;  2PJY B;  3QB4 B;  2UX2 A;  1KXI A;  5DO6 A;  1QM7 A;  4OM4 A;  3EVS C;  1CDT A;  4RUD A;  1IK8 A;  3U73 U;  1LXH A;  1NTN A;  1CHV S;  1HOY A;  1KFH A;  2MJ0 A;  1BXP A;  1L4W A;  1COE A;  2VLW A;  1KU6 B;  2N99 A;  1CCQ A;  1CDS A;  1IKC A;  1REW C;  1NOR A;  4EY8 B;  1KBT A;  5DU1 A;  2H62 D;  2X8B B;  4FAO E;  1YWH A;  1QKE A;  2ABX A;  2CRT A;  1ERG A;  2QJA C;  1HAJ A;  1JGK A;  1RL5 A;  1KBA A;  1NYS A;  2L03 A;  5IMY C;  1F94 A;  2MFA A;  1CDQ A;  1IDL A;  4FAO C;  1HC9 B;  4BIK B;  3HH7 A;  2JVE A;  6EBX A;  2JQP A;  1VB0 A;  1KL8 A;  1KTZ B;  2LA1 A;  2QC1 A;  1CTX A;  2BHI A;  1LJZ A;  1KBS A;  1RGJ A;  1FRA A;  2MJY A;  3NEQ A;  4XJJ A;  2PJY C;  1TXA A;  3ERA A;  1CDR A;  3PLC A;  1JBD A;  1G6M A;  1IQ9 A;  4QTI U;  1ES7 B;  3VTS A;  1HC9 A;  4OM5 A;  1H0J A;  4DO8 A;  1CB9 A;  2GOO B;  1TXB A;  1NXB A;  2L5S A;  1TFS A;  3NDS A;  1TGX A;  2MJ4 A;  1ERA A;  1W6B A;  1BTE A;  1ABT A;  1KC4 A;  4IYE A;  2CRS A;  3NH7 A;  1B41 B;  2MHY A;  3U74 U;  1DRS A;  2CTX A;  4HQP F;  2H64 B;  4LFT A; 
#chains in the Genus database with same CATH homology
 1HAA A;  1F8U B;  2H5F A;  3BT2 U;  5DZ5 A;  2CDX A;  2HLR A;  4ZQY A;  2CCX A;  1NYU A;  1FSC A;  1PLO A;  5EBX A;  1I02 A;  1COD A;  1V6P A;  1CXO A;  2HLQ A;  1JE9 A;  2J8B A;  2NBT A;  4UY2 C;  1LXG A;  2LCR A;  2FD6 U;  5IMT D;  1KS6 A;  2GOO C;  2H7Z A;  2MUO A;  2OFS A;  3KFD E;  1CXN A;  1IDG A;  2I9B E;  1XT3 A;  3EBX A;  4KSN A;  1NEA A;  1IJC A;  1MR6 A;  1QKD A;  1MAH F;  1CRE A;  3KFD I;  1M9Z A;  1NTX A;  4BDT B;  1FFJ A;  1CVO A;  2K3G A;  1FF4 A;  3LAQ U;  2H7Z B;  1LX5 B;  1ONJ A;  2H64 C;  2UWR A;  2H8U A;  1FSS B;  1LSI A;  1S4Y A;  3FEV A;  2ERA A;  2QJB C;  1IDH A;  3BT1 U;  1CRF A;  2QJ9 C;  4AEA A;  2H62 C;  4P7U A;  1FAS A;  1IDI A;  1ZAD A;  2BTX A;  1UG4 A;  2MUP A;  2PJY B;  3QB4 B;  2UX2 A;  1KXI A;  5DO6 A;  1QM7 A;  4OM4 A;  3EVS C;  1CDT A;  4RUD A;  1IK8 A;  3U73 U;  1LXH A;  1NTN A;  1CHV S;  1HOY A;  1KFH A;  2MJ0 A;  1BXP A;  1L4W A;  1COE A;  2VLW A;  1KU6 B;  2N99 A;  1CCQ A;  1CDS A;  1IKC A;  1REW C;  1NOR A;  4EY8 B;  1KBT A;  5DU1 A;  2H62 D;  2X8B B;  4FAO E;  1YWH A;  1QKE A;  2ABX A;  2CRT A;  1ERG A;  2QJA C;  1HAJ A;  1JGK A;  1RL5 A;  1KBA A;  1NYS A;  2L03 A;  5IMY C;  1F94 A;  2MFA A;  1CDQ A;  1IDL A;  4FAO C;  1HC9 B;  4BIK B;  3HH7 A;  2JVE A;  6EBX A;  2JQP A;  1VB0 A;  1KL8 A;  1KTZ B;  2LA1 A;  2QC1 A;  1CTX A;  2BHI A;  1LJZ A;  1KBS A;  1RGJ A;  1FRA A;  2MJY A;  3NEQ A;  4XJJ A;  2PJY C;  1TXA A;  3ERA A;  1CDR A;  3PLC A;  1JBD A;  1G6M A;  1IQ9 A;  4QTI U;  1ES7 B;  3VTS A;  1HC9 A;  4OM5 A;  1H0J A;  4DO8 A;  1CB9 A;  2GOO B;  1TXB A;  1NXB A;  2L5S A;  1TFS A;  3NDS A;  1TGX A;  2MJ4 A;  1ERA A;  1W6B A;  1BTE A;  1ABT A;  1KC4 A;  4IYE A;  2CRS A;  3NH7 A;  1B41 B;  2MHY A;  3U74 U;  1DRS A;  2CTX A;  4HQP F;  2H64 B;  4LFT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...