1KXIA

Structure of cytotoxin homolog precursor
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
62
structure length
62
Chain Sequence
b'LKCHNTQLPFIYKTCPEGKNLCFKATLKKFPLKFPVKRGCADNCPKNSALLKYVCCSTDKCN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CARDIOTOXIN V
publication title Crystal structure of cardiotoxin V from Taiwan cobra venom: pH-dependent conformational change and a novel membrane-binding motif identified in the three-finger loops of P-type cardiotoxin.
pubmed doi rcsb
source organism Naja atra
molecule tags Cytotoxin
total genus 9
structure length 62
sequence length 62
chains with identical sequence B
ec nomenclature
pdb deposition date 1996-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1kxiA00
1IQ9A 2I9BE 3NEQA 2MUOA 3QB4B 1F94A 2H62D 4DO8A 1F8UB 1NEAA 1TXAA 1KU6B 1XT3A 2MUPA 4IYEA 1COEA 1LXGA 4RUDA 1LSIA 3EVSC 2JVEA 1NTXA 1I02A 2QJBC 2QC1A 3VTSA 1TFSA 1NTNA 1ERAA 2H64B 2MFAA 1NORA 2PJYC 2UX2A 1BTEA 2H8UA 1CVOA 4BIKB 1CREA 2LCRA 1ES7B 1CDRA 2BTXA 4HQPF 1HC9B 1CRFA 1CDSA 1CXOA 2H62C 4AEAA 1IJCA 3ERAA 2MJYA 1FFJA 2MJ0A 1LXHA 2J8BA 2LA1A 2H64C 1TGXA 2NBTA 1CDTA 2PJYB 1FF4A 2N99A 5IMYC 4OM5A 1KBSA 1LJZA 1S4YA 2UWRA 1ONJA 1KS6A 2H7ZA 5EBXA 1JBDA 1CCQA 1JGKA 2L5SA 5IMTD 5DO6A 5DU1A 1KFHA 4P7UA 1BXPA 2OFSA 2X8BB 1FRAA 1FSCA 1TXBA 4EY8B 1RGJA 2VLWA 2MJ4A 4UY2C 3NDSA 1H0JA 3PLCA 2HLQA 1W6BA 3HH7A 1MAHF 3EBXA 2GOOC 1QM7A 1LX5B 1QKEA 3BT1U 2QJAC 3KFDI 4QTIU 1KL8A 1V6PA 1HAAA 1FSSB 1IDIA 2FD6U 2L03A 3U73U 4BDTB 1IDLA 1CXNA 1L4WA 2HLRA 2CRTA 1QKDA 2MHYA 1FASA 1ERGA 3NH7A 4LFTA 2GOOB 1CTXA 2CDXA 3U74U 1G6MA 2QJ9C 3FEVA 2ABXA 1REWC 1VB0A 2ERAA 2BHIA 2JQPA 4OM4A 4ZQYA 1KTZB 3KFDE 1HC9A 5DZ5A 2CTXA 1CB9A 1UG4A 1IK8A 1IKCA 1KXIA 1HOYA 1KC4A 1KBTA 2K3GA 6EBXA 1NYUA 1M9ZA 4FAOE 2CCXA 1ZADA 1KBAA 1NXBA 2H5FA 1CHVS 1ABTA 1CDQA 3BT2U 1MR6A 2CRSA 4XJJA 2H7ZB 1DRSA 1CODA 1HAJA 1IDGA 1IDHA 1PLOA 3LAQU 1NYSA 4FAOC 1JE9A 1B41B 1YWHA 1RL5A
chains in the Genus database with same CATH superfamily
1IQ9A 2I9BE 3NEQA 2MUOA 3QB4B 1F94A 2H62D 4DO8A 1F8UB 1NEAA 1TXAA 1KU6B 1XT3A 2MUPA 4IYEA 1COEA 1LXGA 4RUDA 1LSIA 3EVSC 2JVEA 1NTXA 1I02A 2QJBC 2QC1A 3VTSA 1TFSA 1NTNA 1ERAA 2H64B 2MFAA 1NORA 2PJYC 2UX2A 1BTEA 2H8UA 1CVOA 4BIKB 1CREA 2LCRA 1ES7B 1CDRA 2BTXA 4HQPF 1HC9B 1CRFA 1CDSA 1CXOA 2H62C 4AEAA 1IJCA 3ERAA 2MJYA 1FFJA 2MJ0A 1LXHA 2J8BA 2LA1A 2H64C 1TGXA 2NBTA 1CDTA 2PJYB 1FF4A 2N99A 5IMYC 4OM5A 1KBSA 1LJZA 1S4YA 2UWRA 1ONJA 1KS6A 2H7ZA 5EBXA 1JBDA 1CCQA 1JGKA 2L5SA 5IMTD 5DO6A 5DU1A 1KFHA 4P7UA 1BXPA 2OFSA 2X8BB 1FRAA 1FSCA 1TXBA 4EY8B 1RGJA 2VLWA 2MJ4A 4UY2C 3NDSA 1H0JA 3PLCA 2HLQA 1W6BA 3HH7A 1MAHF 3EBXA 2GOOC 1QM7A 1LX5B 1QKEA 3BT1U 2QJAC 3KFDI 4QTIU 1KL8A 1V6PA 1HAAA 1FSSB 1IDIA 2FD6U 2L03A 3U73U 4BDTB 1IDLA 1CXNA 1L4WA 2HLRA 2CRTA 1QKDA 2MHYA 1FASA 1ERGA 3NH7A 4LFTA 2GOOB 1CTXA 2CDXA 3U74U 1G6MA 2QJ9C 3FEVA 2ABXA 1REWC 1VB0A 2ERAA 2BHIA 2JQPA 4OM4A 4ZQYA 1KTZB 3KFDE 1HC9A 5DZ5A 2CTXA 1CB9A 1UG4A 1IK8A 1IKCA 1KXIA 1HOYA 1KC4A 1KBTA 2K3GA 6EBXA 1NYUA 1M9ZA 4FAOE 2CCXA 1ZADA 1KBAA 1NXBA 2H5FA 1CHVS 1ABTA 1CDQA 3BT2U 1MR6A 2CRSA 4XJJA 2H7ZB 1DRSA 1CODA 1HAJA 1IDGA 1IDHA 1PLOA 3LAQU 1NYSA 4FAOC 1JE9A 1B41B 1YWHA 4KSNA 1RL5A
chains in the Genus database with same CATH topology
1IQ9A 2I9BE 3NEQA 2MUOA 3QB4B 1F94A 2H62D 4DO8A 1F8UB 1NEAA 1TXAA 1KU6B 1XT3A 2MUPA 4IYEA 1COEA 1LXGA 4RUDA 1LSIA 3EVSC 2JVEA 1NTXA 1I02A 2QJBC 2QC1A 3VTSA 1TFSA 1NTNA 1ERAA 2H64B 2MFAA 1NORA 2PJYC 2UX2A 1BTEA 2H8UA 1CVOA 4BIKB 1CREA 2LCRA 1ES7B 1CDRA 2BTXA 4HQPF 1HC9B 1CRFA 1CDSA 1CXOA 2H62C 4AEAA 1IJCA 3ERAA 2MJYA 1FFJA 2MJ0A 1LXHA 2J8BA 2LA1A 2H64C 1TGXA 2NBTA 1CDTA 2PJYB 1FF4A 2N99A 5IMYC 4OM5A 1KBSA 1LJZA 1S4YA 2UWRA 1ONJA 1KS6A 2H7ZA 5EBXA 1JBDA 1CCQA 1JGKA 2L5SA 5IMTD 5DO6A 5DU1A 1KFHA 4P7UA 1BXPA 2OFSA 2X8BB 1FRAA 1FSCA 1TXBA 4EY8B 1RGJA 2VLWA 2MJ4A 4UY2C 3NDSA 1H0JA 3PLCA 2HLQA 1W6BA 3HH7A 1MAHF 3EBXA 2GOOC 1QM7A 1LX5B 1QKEA 3BT1U 2QJAC 3KFDI 4QTIU 1KL8A 1V6PA 1HAAA 1FSSB 1IDIA 2FD6U 2L03A 3U73U 4BDTB 1IDLA 1CXNA 1L4WA 2HLRA 2CRTA 1QKDA 2MHYA 1FASA 1ERGA 3NH7A 4LFTA 2GOOB 1CTXA 2CDXA 3U74U 1G6MA 2QJ9C 3FEVA 2ABXA 1REWC 1VB0A 2ERAA 2BHIA 2JQPA 4OM4A 4ZQYA 1KTZB 3KFDE 1HC9A 5DZ5A 2CTXA 1CB9A 1UG4A 1IK8A 1IKCA 1KXIA 1HOYA 1KC4A 1KBTA 2K3GA 6EBXA 1NYUA 1M9ZA 4FAOE 2CCXA 1ZADA 1KBAA 1NXBA 2H5FA 1CHVS 1ABTA 1CDQA 3BT2U 1MR6A 2CRSA 4XJJA 2H7ZB 1DRSA 1CODA 1HAJA 1IDGA 1IDHA 1PLOA 3LAQU 1NYSA 4FAOC 1JE9A 1B41B 1YWHA 4KSNA 1RL5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IQ9 A;  2I9B E;  3NEQ A;  2MUO A;  3QB4 B;  1F94 A;  2H62 D;  4DO8 A;  1F8U B;  1NEA A;  1TXA A;  1KU6 B;  1XT3 A;  2MUP A;  4IYE A;  1COE A;  1LXG A;  4RUD A;  1LSI A;  3EVS C;  2JVE A;  1NTX A;  1I02 A;  2QJB C;  2QC1 A;  3VTS A;  1TFS A;  1NTN A;  1ERA A;  2H64 B;  2MFA A;  1NOR A;  2PJY C;  2UX2 A;  1BTE A;  2H8U A;  1CVO A;  4BIK B;  1CRE A;  2LCR A;  1ES7 B;  1CDR A;  2BTX A;  4HQP F;  1HC9 B;  1CRF A;  1CDS A;  1CXO A;  2H62 C;  4AEA A;  1IJC A;  3ERA A;  2MJY A;  1FFJ A;  2MJ0 A;  1LXH A;  2J8B A;  2LA1 A;  2H64 C;  1TGX A;  2NBT A;  1CDT A;  2PJY B;  1FF4 A;  2N99 A;  5IMY C;  4OM5 A;  1KBS A;  1LJZ A;  1S4Y A;  2UWR A;  1ONJ A;  1KS6 A;  2H7Z A;  5EBX A;  1JBD A;  1CCQ A;  1JGK A;  2L5S A;  5IMT D;  5DO6 A;  5DU1 A;  1KFH A;  4P7U A;  1BXP A;  2OFS A;  2X8B B;  1FRA A;  1FSC A;  1TXB A;  4EY8 B;  1RGJ A;  2VLW A;  2MJ4 A;  4UY2 C;  3NDS A;  1H0J A;  3PLC A;  2HLQ A;  1W6B A;  3HH7 A;  1MAH F;  3EBX A;  2GOO C;  1QM7 A;  1LX5 B;  1QKE A;  3BT1 U;  2QJA C;  3KFD I;  4QTI U;  1KL8 A;  1V6P A;  1HAA A;  1FSS B;  1IDI A;  2FD6 U;  2L03 A;  3U73 U;  4BDT B;  1IDL A;  1CXN A;  1L4W A;  2HLR A;  2CRT A;  1QKD A;  2MHY A;  1FAS A;  1ERG A;  3NH7 A;  4LFT A;  2GOO B;  1CTX A;  2CDX A;  3U74 U;  1G6M A;  2QJ9 C;  3FEV A;  2ABX A;  1REW C;  1VB0 A;  2ERA A;  2BHI A;  2JQP A;  4OM4 A;  4ZQY A;  1KTZ B;  3KFD E;  1HC9 A;  5DZ5 A;  2CTX A;  1CB9 A;  1UG4 A;  1IK8 A;  1IKC A;  1KXI A;  1HOY A;  1KC4 A;  1KBT A;  2K3G A;  6EBX A;  1NYU A;  1M9Z A;  4FAO E;  2CCX A;  1ZAD A;  1KBA A;  1NXB A;  2H5F A;  1CHV S;  1ABT A;  1CDQ A;  3BT2 U;  1MR6 A;  2CRS A;  4XJJ A;  2H7Z B;  1DRS A;  1COD A;  1HAJ A;  1IDG A;  1IDH A;  1PLO A;  3LAQ U;  1NYS A;  4FAO C;  1JE9 A;  1B41 B;  1YWH A;  1RL5 A; 
#chains in the Genus database with same CATH topology
 1IQ9 A;  2I9B E;  3NEQ A;  2MUO A;  3QB4 B;  1F94 A;  2H62 D;  4DO8 A;  1F8U B;  1NEA A;  1TXA A;  1KU6 B;  1XT3 A;  2MUP A;  4IYE A;  1COE A;  1LXG A;  4RUD A;  1LSI A;  3EVS C;  2JVE A;  1NTX A;  1I02 A;  2QJB C;  2QC1 A;  3VTS A;  1TFS A;  1NTN A;  1ERA A;  2H64 B;  2MFA A;  1NOR A;  2PJY C;  2UX2 A;  1BTE A;  2H8U A;  1CVO A;  4BIK B;  1CRE A;  2LCR A;  1ES7 B;  1CDR A;  2BTX A;  4HQP F;  1HC9 B;  1CRF A;  1CDS A;  1CXO A;  2H62 C;  4AEA A;  1IJC A;  3ERA A;  2MJY A;  1FFJ A;  2MJ0 A;  1LXH A;  2J8B A;  2LA1 A;  2H64 C;  1TGX A;  2NBT A;  1CDT A;  2PJY B;  1FF4 A;  2N99 A;  5IMY C;  4OM5 A;  1KBS A;  1LJZ A;  1S4Y A;  2UWR A;  1ONJ A;  1KS6 A;  2H7Z A;  5EBX A;  1JBD A;  1CCQ A;  1JGK A;  2L5S A;  5IMT D;  5DO6 A;  5DU1 A;  1KFH A;  4P7U A;  1BXP A;  2OFS A;  2X8B B;  1FRA A;  1FSC A;  1TXB A;  4EY8 B;  1RGJ A;  2VLW A;  2MJ4 A;  4UY2 C;  3NDS A;  1H0J A;  3PLC A;  2HLQ A;  1W6B A;  3HH7 A;  1MAH F;  3EBX A;  2GOO C;  1QM7 A;  1LX5 B;  1QKE A;  3BT1 U;  2QJA C;  3KFD I;  4QTI U;  1KL8 A;  1V6P A;  1HAA A;  1FSS B;  1IDI A;  2FD6 U;  2L03 A;  3U73 U;  4BDT B;  1IDL A;  1CXN A;  1L4W A;  2HLR A;  2CRT A;  1QKD A;  2MHY A;  1FAS A;  1ERG A;  3NH7 A;  4LFT A;  2GOO B;  1CTX A;  2CDX A;  3U74 U;  1G6M A;  2QJ9 C;  3FEV A;  2ABX A;  1REW C;  1VB0 A;  2ERA A;  2BHI A;  2JQP A;  4OM4 A;  4ZQY A;  1KTZ B;  3KFD E;  1HC9 A;  5DZ5 A;  2CTX A;  1CB9 A;  1UG4 A;  1IK8 A;  1IKC A;  1KXI A;  1HOY A;  1KC4 A;  1KBT A;  2K3G A;  6EBX A;  1NYU A;  1M9Z A;  4FAO E;  2CCX A;  1ZAD A;  1KBA A;  1NXB A;  2H5F A;  1CHV S;  1ABT A;  1CDQ A;  3BT2 U;  1MR6 A;  2CRS A;  4XJJ A;  2H7Z B;  1DRS A;  1COD A;  1HAJ A;  1IDG A;  1IDH A;  1PLO A;  3LAQ U;  1NYS A;  4FAO C;  1JE9 A;  1B41 B;  1YWH A;  4KSN A;  1RL5 A; 
#chains in the Genus database with same CATH homology
 1IQ9 A;  2I9B E;  3NEQ A;  2MUO A;  3QB4 B;  1F94 A;  2H62 D;  4DO8 A;  1F8U B;  1NEA A;  1TXA A;  1KU6 B;  1XT3 A;  2MUP A;  4IYE A;  1COE A;  1LXG A;  4RUD A;  1LSI A;  3EVS C;  2JVE A;  1NTX A;  1I02 A;  2QJB C;  2QC1 A;  3VTS A;  1TFS A;  1NTN A;  1ERA A;  2H64 B;  2MFA A;  1NOR A;  2PJY C;  2UX2 A;  1BTE A;  2H8U A;  1CVO A;  4BIK B;  1CRE A;  2LCR A;  1ES7 B;  1CDR A;  2BTX A;  4HQP F;  1HC9 B;  1CRF A;  1CDS A;  1CXO A;  2H62 C;  4AEA A;  1IJC A;  3ERA A;  2MJY A;  1FFJ A;  2MJ0 A;  1LXH A;  2J8B A;  2LA1 A;  2H64 C;  1TGX A;  2NBT A;  1CDT A;  2PJY B;  1FF4 A;  2N99 A;  5IMY C;  4OM5 A;  1KBS A;  1LJZ A;  1S4Y A;  2UWR A;  1ONJ A;  1KS6 A;  2H7Z A;  5EBX A;  1JBD A;  1CCQ A;  1JGK A;  2L5S A;  5IMT D;  5DO6 A;  5DU1 A;  1KFH A;  4P7U A;  1BXP A;  2OFS A;  2X8B B;  1FRA A;  1FSC A;  1TXB A;  4EY8 B;  1RGJ A;  2VLW A;  2MJ4 A;  4UY2 C;  3NDS A;  1H0J A;  3PLC A;  2HLQ A;  1W6B A;  3HH7 A;  1MAH F;  3EBX A;  2GOO C;  1QM7 A;  1LX5 B;  1QKE A;  3BT1 U;  2QJA C;  3KFD I;  4QTI U;  1KL8 A;  1V6P A;  1HAA A;  1FSS B;  1IDI A;  2FD6 U;  2L03 A;  3U73 U;  4BDT B;  1IDL A;  1CXN A;  1L4W A;  2HLR A;  2CRT A;  1QKD A;  2MHY A;  1FAS A;  1ERG A;  3NH7 A;  4LFT A;  2GOO B;  1CTX A;  2CDX A;  3U74 U;  1G6M A;  2QJ9 C;  3FEV A;  2ABX A;  1REW C;  1VB0 A;  2ERA A;  2BHI A;  2JQP A;  4OM4 A;  4ZQY A;  1KTZ B;  3KFD E;  1HC9 A;  5DZ5 A;  2CTX A;  1CB9 A;  1UG4 A;  1IK8 A;  1IKC A;  1KXI A;  1HOY A;  1KC4 A;  1KBT A;  2K3G A;  6EBX A;  1NYU A;  1M9Z A;  4FAO E;  2CCX A;  1ZAD A;  1KBA A;  1NXB A;  2H5F A;  1CHV S;  1ABT A;  1CDQ A;  3BT2 U;  1MR6 A;  2CRS A;  4XJJ A;  2H7Z B;  1DRS A;  1COD A;  1HAJ A;  1IDG A;  1IDH A;  1PLO A;  3LAQ U;  1NYS A;  4FAO C;  1JE9 A;  1B41 B;  1YWH A;  4KSN A;  1RL5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...