1KXIA

Structure of cytotoxin homolog precursor
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
62
structure length
62
Chain Sequence
LKCHNTQLPFIYKTCPEGKNLCFKATLKKFPLKFPVKRGCADNCPKNSALLKYVCCSTDKCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytotoxin
molecule keywords CARDIOTOXIN V
publication title Crystal structure of cardiotoxin V from Taiwan cobra venom: pH-dependent conformational change and a novel membrane-binding motif identified in the three-finger loops of P-type cardiotoxin.
pubmed doi rcsb
source organism Naja atra
total genus 9
structure length 62
sequence length 62
chains with identical sequence B
ec nomenclature
pdb deposition date 1996-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1kxiA00
2NBTA 2H62C 1JGKA 3U74U 4UY2C 1HC9B 1KTZB 1CXNA 1COEA 1B41B 1KXIA 1KBAA 1IDLA 5DZ5A 1G6MA 1F94A 1CDSA 1KC4A 2QJAC 1NYSA 1MAHF 3KFDE 2H8UA 2I9BE 1CXOA 2VLWA 1CTXA 1IDGA 4ZQYA 1KBSA 4BIKB 1ERAA 1IQ9A 1CDTA 1FFJA 1ZADA 1CREA 1H0JA 2MUOA 1CRFA 1XT3A 6EBXA 2MJ0A 1NXBA 2CDXA 4OM5A 1IKCA 1ONJA 1TXBA 1REWC 1IJCA 1LSIA 5EBXA 1IDIA 2H7ZB 1L4WA 2MJYA 1CB9A 2MJ4A 2MHYA 1I02A 2OFSA 2CRTA 1ABTA 1IDHA 4HQPF 3LAQU 4BDTB 1DRSA 4XJJA 2L5SA 3NEQA 1PLOA 3EBXA 1UG4A 1KS6A 1QM7A 1HAAA 3ERAA 3KFDI 2CTXA 2BTXA 1KU6B 2JQPA 1TXAA 1CHVS 2L03A 1NYUA 2ABXA 1BTEA 3NH7A 1HC9A 1JE9A 4FAOC 2QJBC 1RGJA 4IYEA 1ES7B 1LXHA 1CDRA 1FSCA 3BT2U 4LFTA 1KBTA 1RL5A 3NDSA 3QB4B 2H62D 2PJYB 2HLQA 2J8BA 2BHIA 1BXPA 1HOYA 2PJYC 1CVOA 1NTNA 1JBDA 1MR6A 1YWHA 2H7ZA 1FSSB 1LX5B 1F8UB 5DU1A 3HH7A 1CDQA 1QKEA 5IMTD 3BT1U 1M9ZA 2QJ9C 1TGXA 1TFSA 2JVEA 2UWRA 3EVSC 1QKDA 2H5FA 2FD6U 5IMYC 2ERAA 2MFAA 2LA1A 4RUDA 4QTIU 4EY8B 2HLRA 4OM4A 2X8BB 1CCQA 4AEAA 1ERGA 1HAJA 1FRAA 2CRSA 3FEVA 4DO8A 2GOOB 2MUPA 3U73U 2LCRA 1VB0A 2GOOC 1V6PA 2H64B 1FF4A 1NTXA 3PLCA 1FASA 4FAOE 3VTSA 2H64C 5DO6A 1NORA 1IK8A 1LJZA 2N99A 2UX2A 2CCXA 4P7UA 1NEAA 1CODA 2K3GA 1KL8A 2QC1A 1KFHA 1W6BA 1S4YA 1LXGA
chains in the Genus database with same CATH superfamily
2NBTA 2H62C 1JGKA 3U74U 4UY2C 1HC9B 1KTZB 1CXNA 1COEA 1B41B 1KXIA 1KBAA 1IDLA 5DZ5A 1G6MA 1F94A 1CDSA 1KC4A 2QJAC 1NYSA 1MAHF 3KFDE 2H8UA 2I9BE 1CXOA 2VLWA 1CTXA 1IDGA 4ZQYA 1KBSA 4BIKB 1ERAA 1IQ9A 1CDTA 1FFJA 1ZADA 1CREA 1H0JA 2MUOA 1CRFA 1XT3A 6EBXA 2MJ0A 1NXBA 2CDXA 4OM5A 1IKCA 1ONJA 1TXBA 1REWC 1IJCA 1LSIA 5EBXA 1IDIA 2H7ZB 1L4WA 2MJYA 1CB9A 2MJ4A 2MHYA 1I02A 2OFSA 2CRTA 1ABTA 1IDHA 4HQPF 3LAQU 4BDTB 1DRSA 4XJJA 2L5SA 3NEQA 1PLOA 3EBXA 1UG4A 1KS6A 1QM7A 1HAAA 3ERAA 3KFDI 2CTXA 2BTXA 1KU6B 4KSNA 2JQPA 1TXAA 1CHVS 2L03A 1NYUA 2ABXA 1BTEA 3NH7A 1HC9A 1JE9A 4FAOC 2QJBC 1RGJA 4IYEA 1ES7B 1LXHA 1CDRA 1FSCA 3BT2U 4LFTA 1KBTA 1RL5A 3NDSA 3QB4B 2H62D 2PJYB 2HLQA 2J8BA 2BHIA 1BXPA 1HOYA 2PJYC 1CVOA 1NTNA 1JBDA 1MR6A 1YWHA 2H7ZA 1FSSB 1LX5B 1F8UB 5DU1A 3HH7A 1CDQA 1QKEA 5IMTD 3BT1U 1M9ZA 2QJ9C 1TGXA 1TFSA 2JVEA 2UWRA 3EVSC 1QKDA 2H5FA 2FD6U 5IMYC 2ERAA 2MFAA 2LA1A 4RUDA 4QTIU 4EY8B 2HLRA 4OM4A 2X8BB 1CCQA 4AEAA 1ERGA 1HAJA 1FRAA 2CRSA 3FEVA 4DO8A 2GOOB 2MUPA 3U73U 2LCRA 1VB0A 2GOOC 1V6PA 2H64B 1FF4A 1NTXA 3PLCA 1FASA 4FAOE 3VTSA 2H64C 5DO6A 1NORA 1IK8A 1LJZA 2N99A 2UX2A 2CCXA 4P7UA 1NEAA 1CODA 2K3GA 1KL8A 2QC1A 1KFHA 1W6BA 1S4YA 1LXGA
chains in the Genus database with same CATH topology
2NBTA 2H62C 1JGKA 3U74U 4UY2C 1HC9B 1KTZB 1CXNA 1COEA 1B41B 1KXIA 1KBAA 1IDLA 5DZ5A 1G6MA 1F94A 1CDSA 1KC4A 2QJAC 1NYSA 1MAHF 3KFDE 2H8UA 2I9BE 1CXOA 2VLWA 1CTXA 1IDGA 4ZQYA 1KBSA 4BIKB 1ERAA 1IQ9A 1CDTA 1FFJA 1ZADA 1CREA 1H0JA 2MUOA 1CRFA 1XT3A 6EBXA 2MJ0A 1NXBA 2CDXA 4OM5A 1IKCA 1ONJA 1TXBA 1REWC 1IJCA 1LSIA 5EBXA 1IDIA 2H7ZB 1L4WA 2MJYA 1CB9A 2MJ4A 2MHYA 1I02A 2OFSA 2CRTA 1ABTA 1IDHA 4HQPF 3LAQU 4BDTB 1DRSA 4XJJA 2L5SA 3NEQA 1PLOA 3EBXA 1UG4A 1KS6A 1QM7A 1HAAA 3ERAA 3KFDI 2CTXA 2BTXA 1KU6B 4KSNA 2JQPA 1TXAA 1CHVS 2L03A 1NYUA 2ABXA 1BTEA 3NH7A 1HC9A 1JE9A 4FAOC 2QJBC 1RGJA 4IYEA 1ES7B 1LXHA 1CDRA 1FSCA 3BT2U 4LFTA 1KBTA 1RL5A 3NDSA 3QB4B 2H62D 2PJYB 2HLQA 2J8BA 2BHIA 1BXPA 1HOYA 2PJYC 1CVOA 1NTNA 1JBDA 1MR6A 1YWHA 2H7ZA 1FSSB 1LX5B 1F8UB 5DU1A 3HH7A 1CDQA 1QKEA 5IMTD 3BT1U 1M9ZA 2QJ9C 1TGXA 1TFSA 2JVEA 2UWRA 3EVSC 1QKDA 2H5FA 2FD6U 5IMYC 2ERAA 2MFAA 2LA1A 4RUDA 4QTIU 4EY8B 2HLRA 4OM4A 2X8BB 1CCQA 4AEAA 1ERGA 1HAJA 1FRAA 2CRSA 3FEVA 4DO8A 2GOOB 2MUPA 3U73U 2LCRA 1VB0A 2GOOC 1V6PA 2H64B 1FF4A 1NTXA 3PLCA 1FASA 4FAOE 3VTSA 2H64C 5DO6A 1NORA 1IK8A 1LJZA 2N99A 2UX2A 2CCXA 4P7UA 1NEAA 1CODA 2K3GA 1KL8A 2QC1A 1KFHA 1W6BA 1S4YA 1LXGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NBT A;  2H62 C;  1JGK A;  3U74 U;  4UY2 C;  1HC9 B;  1KTZ B;  1CXN A;  1COE A;  1B41 B;  1KXI A;  1KBA A;  1IDL A;  5DZ5 A;  1G6M A;  1F94 A;  1CDS A;  1KC4 A;  2QJA C;  1NYS A;  1MAH F;  3KFD E;  2H8U A;  2I9B E;  1CXO A;  2VLW A;  1CTX A;  1IDG A;  4ZQY A;  1KBS A;  4BIK B;  1ERA A;  1IQ9 A;  1CDT A;  1FFJ A;  1ZAD A;  1CRE A;  1H0J A;  2MUO A;  1CRF A;  1XT3 A;  6EBX A;  2MJ0 A;  1NXB A;  2CDX A;  4OM5 A;  1IKC A;  1ONJ A;  1TXB A;  1REW C;  1IJC A;  1LSI A;  5EBX A;  1IDI A;  2H7Z B;  1L4W A;  2MJY A;  1CB9 A;  2MJ4 A;  2MHY A;  1I02 A;  2OFS A;  2CRT A;  1ABT A;  1IDH A;  4HQP F;  3LAQ U;  4BDT B;  1DRS A;  4XJJ A;  2L5S A;  3NEQ A;  1PLO A;  3EBX A;  1UG4 A;  1KS6 A;  1QM7 A;  1HAA A;  3ERA A;  3KFD I;  2CTX A;  2BTX A;  1KU6 B;  2JQP A;  1TXA A;  1CHV S;  2L03 A;  1NYU A;  2ABX A;  1BTE A;  3NH7 A;  1HC9 A;  1JE9 A;  4FAO C;  2QJB C;  1RGJ A;  4IYE A;  1ES7 B;  1LXH A;  1CDR A;  1FSC A;  3BT2 U;  4LFT A;  1KBT A;  1RL5 A;  3NDS A;  3QB4 B;  2H62 D;  2PJY B;  2HLQ A;  2J8B A;  2BHI A;  1BXP A;  1HOY A;  2PJY C;  1CVO A;  1NTN A;  1JBD A;  1MR6 A;  1YWH A;  2H7Z A;  1FSS B;  1LX5 B;  1F8U B;  5DU1 A;  3HH7 A;  1CDQ A;  1QKE A;  5IMT D;  3BT1 U;  1M9Z A;  2QJ9 C;  1TGX A;  1TFS A;  2JVE A;  2UWR A;  3EVS C;  1QKD A;  2H5F A;  2FD6 U;  5IMY C;  2ERA A;  2MFA A;  2LA1 A;  4RUD A;  4QTI U;  4EY8 B;  2HLR A;  4OM4 A;  2X8B B;  1CCQ A;  4AEA A;  1ERG A;  1HAJ A;  1FRA A;  2CRS A;  3FEV A;  4DO8 A;  2GOO B;  2MUP A;  3U73 U;  2LCR A;  1VB0 A;  2GOO C;  1V6P A;  2H64 B;  1FF4 A;  1NTX A;  3PLC A;  1FAS A;  4FAO E;  3VTS A;  2H64 C;  5DO6 A;  1NOR A;  1IK8 A;  1LJZ A;  2N99 A;  2UX2 A;  2CCX A;  4P7U A;  1NEA A;  1COD A;  2K3G A;  1KL8 A;  2QC1 A;  1KFH A;  1W6B A;  1S4Y A;  1LXG A; 
#chains in the Genus database with same CATH topology
 2NBT A;  2H62 C;  1JGK A;  3U74 U;  4UY2 C;  1HC9 B;  1KTZ B;  1CXN A;  1COE A;  1B41 B;  1KXI A;  1KBA A;  1IDL A;  5DZ5 A;  1G6M A;  1F94 A;  1CDS A;  1KC4 A;  2QJA C;  1NYS A;  1MAH F;  3KFD E;  2H8U A;  2I9B E;  1CXO A;  2VLW A;  1CTX A;  1IDG A;  4ZQY A;  1KBS A;  4BIK B;  1ERA A;  1IQ9 A;  1CDT A;  1FFJ A;  1ZAD A;  1CRE A;  1H0J A;  2MUO A;  1CRF A;  1XT3 A;  6EBX A;  2MJ0 A;  1NXB A;  2CDX A;  4OM5 A;  1IKC A;  1ONJ A;  1TXB A;  1REW C;  1IJC A;  1LSI A;  5EBX A;  1IDI A;  2H7Z B;  1L4W A;  2MJY A;  1CB9 A;  2MJ4 A;  2MHY A;  1I02 A;  2OFS A;  2CRT A;  1ABT A;  1IDH A;  4HQP F;  3LAQ U;  4BDT B;  1DRS A;  4XJJ A;  2L5S A;  3NEQ A;  1PLO A;  3EBX A;  1UG4 A;  1KS6 A;  1QM7 A;  1HAA A;  3ERA A;  3KFD I;  2CTX A;  2BTX A;  1KU6 B;  4KSN A;  2JQP A;  1TXA A;  1CHV S;  2L03 A;  1NYU A;  2ABX A;  1BTE A;  3NH7 A;  1HC9 A;  1JE9 A;  4FAO C;  2QJB C;  1RGJ A;  4IYE A;  1ES7 B;  1LXH A;  1CDR A;  1FSC A;  3BT2 U;  4LFT A;  1KBT A;  1RL5 A;  3NDS A;  3QB4 B;  2H62 D;  2PJY B;  2HLQ A;  2J8B A;  2BHI A;  1BXP A;  1HOY A;  2PJY C;  1CVO A;  1NTN A;  1JBD A;  1MR6 A;  1YWH A;  2H7Z A;  1FSS B;  1LX5 B;  1F8U B;  5DU1 A;  3HH7 A;  1CDQ A;  1QKE A;  5IMT D;  3BT1 U;  1M9Z A;  2QJ9 C;  1TGX A;  1TFS A;  2JVE A;  2UWR A;  3EVS C;  1QKD A;  2H5F A;  2FD6 U;  5IMY C;  2ERA A;  2MFA A;  2LA1 A;  4RUD A;  4QTI U;  4EY8 B;  2HLR A;  4OM4 A;  2X8B B;  1CCQ A;  4AEA A;  1ERG A;  1HAJ A;  1FRA A;  2CRS A;  3FEV A;  4DO8 A;  2GOO B;  2MUP A;  3U73 U;  2LCR A;  1VB0 A;  2GOO C;  1V6P A;  2H64 B;  1FF4 A;  1NTX A;  3PLC A;  1FAS A;  4FAO E;  3VTS A;  2H64 C;  5DO6 A;  1NOR A;  1IK8 A;  1LJZ A;  2N99 A;  2UX2 A;  2CCX A;  4P7U A;  1NEA A;  1COD A;  2K3G A;  1KL8 A;  2QC1 A;  1KFH A;  1W6B A;  1S4Y A;  1LXG A; 
#chains in the Genus database with same CATH homology
 2NBT A;  2H62 C;  1JGK A;  3U74 U;  4UY2 C;  1HC9 B;  1KTZ B;  1CXN A;  1COE A;  1B41 B;  1KXI A;  1KBA A;  1IDL A;  5DZ5 A;  1G6M A;  1F94 A;  1CDS A;  1KC4 A;  2QJA C;  1NYS A;  1MAH F;  3KFD E;  2H8U A;  2I9B E;  1CXO A;  2VLW A;  1CTX A;  1IDG A;  4ZQY A;  1KBS A;  4BIK B;  1ERA A;  1IQ9 A;  1CDT A;  1FFJ A;  1ZAD A;  1CRE A;  1H0J A;  2MUO A;  1CRF A;  1XT3 A;  6EBX A;  2MJ0 A;  1NXB A;  2CDX A;  4OM5 A;  1IKC A;  1ONJ A;  1TXB A;  1REW C;  1IJC A;  1LSI A;  5EBX A;  1IDI A;  2H7Z B;  1L4W A;  2MJY A;  1CB9 A;  2MJ4 A;  2MHY A;  1I02 A;  2OFS A;  2CRT A;  1ABT A;  1IDH A;  4HQP F;  3LAQ U;  4BDT B;  1DRS A;  4XJJ A;  2L5S A;  3NEQ A;  1PLO A;  3EBX A;  1UG4 A;  1KS6 A;  1QM7 A;  1HAA A;  3ERA A;  3KFD I;  2CTX A;  2BTX A;  1KU6 B;  4KSN A;  2JQP A;  1TXA A;  1CHV S;  2L03 A;  1NYU A;  2ABX A;  1BTE A;  3NH7 A;  1HC9 A;  1JE9 A;  4FAO C;  2QJB C;  1RGJ A;  4IYE A;  1ES7 B;  1LXH A;  1CDR A;  1FSC A;  3BT2 U;  4LFT A;  1KBT A;  1RL5 A;  3NDS A;  3QB4 B;  2H62 D;  2PJY B;  2HLQ A;  2J8B A;  2BHI A;  1BXP A;  1HOY A;  2PJY C;  1CVO A;  1NTN A;  1JBD A;  1MR6 A;  1YWH A;  2H7Z A;  1FSS B;  1LX5 B;  1F8U B;  5DU1 A;  3HH7 A;  1CDQ A;  1QKE A;  5IMT D;  3BT1 U;  1M9Z A;  2QJ9 C;  1TGX A;  1TFS A;  2JVE A;  2UWR A;  3EVS C;  1QKD A;  2H5F A;  2FD6 U;  5IMY C;  2ERA A;  2MFA A;  2LA1 A;  4RUD A;  4QTI U;  4EY8 B;  2HLR A;  4OM4 A;  2X8B B;  1CCQ A;  4AEA A;  1ERG A;  1HAJ A;  1FRA A;  2CRS A;  3FEV A;  4DO8 A;  2GOO B;  2MUP A;  3U73 U;  2LCR A;  1VB0 A;  2GOO C;  1V6P A;  2H64 B;  1FF4 A;  1NTX A;  3PLC A;  1FAS A;  4FAO E;  3VTS A;  2H64 C;  5DO6 A;  1NOR A;  1IK8 A;  1LJZ A;  2N99 A;  2UX2 A;  2CCX A;  4P7U A;  1NEA A;  1COD A;  2K3G A;  1KL8 A;  2QC1 A;  1KFH A;  1W6B A;  1S4Y A;  1LXG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...