1KXIA

Structure of cytotoxin homolog precursor
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
62
structure length
62
Chain Sequence
LKCHNTQLPFIYKTCPEGKNLCFKATLKKFPLKFPVKRGCADNCPKNSALLKYVCCSTDKCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CARDIOTOXIN V
publication title Crystal structure of cardiotoxin V from Taiwan cobra venom: pH-dependent conformational change and a novel membrane-binding motif identified in the three-finger loops of P-type cardiotoxin.
pubmed doi rcsb
source organism Naja atra
molecule tags Cytotoxin
total genus 9
structure length 62
sequence length 62
chains with identical sequence B
ec nomenclature
pdb deposition date 1996-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1kxiA00
1S4YA 1FRAA 2L03A 1KFHA 3NH7A 1XT3A 2LCRA 1ZADA 4IYEA 4OM4A 1COEA 1CXOA 1KTZB 1KXIA 1TGXA 1L4WA 2N99A 1QKDA 1KC4A 1IK8A 6EBXA 1PLOA 1JE9A 3EBXA 1CREA 1G6MA 1HC9A 1JGKA 2H7ZB 4BIKB 1BTEA 4UY2C 2H62D 1V6PA 1ABTA 2NBTA 3BT1U 1MAHF 2MJ4A 2HLRA 1I02A 1TXBA 1QKEA 3PLCA 2GOOC 1NYSA 1TFSA 2QJ9C 1NTXA 4LFTA 4BDTB 4RUDA 1CODA 1NORA 1H0JA 1RL5A 1KU6B 2GOOB 1IDLA 1NTNA 1REWC 1ERGA 1IQ9A 3U74U 2J8BA 3NDSA 1IDHA 1FASA 3QB4B 4DO8A 1LSIA 3VTSA 1FF4A 1BXPA 2MUOA 2MHYA 3LAQU 3EVSC 1ES7B 2CTXA 4FAOE 1LJZA 4P7UA 5IMYC 1CVOA 2HLQA 2QC1A 2CRSA 2BTXA 1HAJA 1LXGA 3HH7A 4ZQYA 2H7ZA 2UWRA 1CDTA 2CDXA 1M9ZA 2FD6U 2JVEA 3ERAA 1CCQA 1FFJA 3NEQA 1KBAA 1ONJA 2MJYA 2ABXA 1CB9A 4XJJA 1TXAA 1VB0A 1CXNA 4FAOC 1JBDA 1IDIA 3KFDE 1HC9B 5EBXA 1KS6A 2K3GA 2H8UA 4OM5A 2LA1A 4HQPF 2CCXA 1LX5B 1NEAA 1QM7A 1IJCA 1IKCA 1W6BA 1RGJA 1NXBA 1CRFA 2UX2A 1KBSA 2BHIA 2H64C 2MUPA 5DU1A 2I9BE 2H64B 1LXHA 2VLWA 2CRTA 2JQPA 1CHVS 2OFSA 2MFAA 1FSCA 2H5FA 3FEVA 1F8UB 4QTIU 1IDGA 2X8BB 1CDRA 1CTXA 3BT2U 1CDQA 3U73U 1KL8A 1MR6A 1ERAA 1NYUA 5DO6A 2QJBC 4EY8B 2MJ0A 5IMTD 1FSSB 4AEAA 1HOYA 1KBTA 1F94A 1YWHA 3KFDI 2PJYC 2QJAC 1HAAA 1B41B 5DZ5A 2PJYB 1DRSA 2H62C 1CDSA 2ERAA 1UG4A 2L5SA
chains in the Genus database with same CATH superfamily
1S4YA 1FRAA 2L03A 1KFHA 3NH7A 1XT3A 2LCRA 1ZADA 4IYEA 4OM4A 1COEA 1CXOA 1KTZB 1KXIA 1TGXA 1L4WA 2N99A 1QKDA 1KC4A 1IK8A 6EBXA 1PLOA 1JE9A 3EBXA 1CREA 1G6MA 1HC9A 1JGKA 2H7ZB 4BIKB 1BTEA 4KSNA 2H62D 4UY2C 1V6PA 1ABTA 2NBTA 3BT1U 1MAHF 2MJ4A 2HLRA 1I02A 1TXBA 1QKEA 3PLCA 2GOOC 1NYSA 1TFSA 2QJ9C 1NTXA 4LFTA 4BDTB 4RUDA 1CODA 1NORA 1H0JA 1RL5A 1KU6B 2GOOB 1IDLA 1NTNA 1REWC 1ERGA 1IQ9A 3U74U 2J8BA 3NDSA 1IDHA 1FASA 3QB4B 4DO8A 1LSIA 3VTSA 1FF4A 1BXPA 2MUOA 2MHYA 3LAQU 3EVSC 1ES7B 2CTXA 4FAOE 1LJZA 4P7UA 5IMYC 1CVOA 2HLQA 2QC1A 2CRSA 2BTXA 1HAJA 1LXGA 3HH7A 4ZQYA 2H7ZA 2UWRA 1CDTA 2CDXA 1M9ZA 2FD6U 2JVEA 3ERAA 1CCQA 1FFJA 3NEQA 1KBAA 1ONJA 2MJYA 2ABXA 1CB9A 4XJJA 1TXAA 1VB0A 1CXNA 4FAOC 1JBDA 1IDIA 3KFDE 1HC9B 5EBXA 1KS6A 2K3GA 2H8UA 4OM5A 2LA1A 4HQPF 2CCXA 1LX5B 1NEAA 1QM7A 1IJCA 1IKCA 1W6BA 1RGJA 1NXBA 1CRFA 2UX2A 1KBSA 2BHIA 2H64C 2MUPA 5DU1A 2I9BE 2H64B 1LXHA 2VLWA 2CRTA 2JQPA 1CHVS 2OFSA 2MFAA 1FSCA 2H5FA 3FEVA 1F8UB 4QTIU 1IDGA 2X8BB 1CDRA 1CTXA 3BT2U 1CDQA 3U73U 1KL8A 1MR6A 1ERAA 1NYUA 5DO6A 2QJBC 4EY8B 2MJ0A 5IMTD 1FSSB 4AEAA 1HOYA 1KBTA 1F94A 1YWHA 3KFDI 2PJYC 2QJAC 1HAAA 1B41B 5DZ5A 2PJYB 1DRSA 2H62C 1CDSA 2ERAA 1UG4A 2L5SA
chains in the Genus database with same CATH topology
1S4YA 1FRAA 2L03A 1KFHA 3NH7A 1XT3A 2LCRA 1ZADA 4IYEA 4OM4A 1COEA 1CXOA 1KTZB 1KXIA 1TGXA 1L4WA 2N99A 1QKDA 1KC4A 1IK8A 6EBXA 1PLOA 1JE9A 3EBXA 1CREA 1G6MA 1HC9A 1JGKA 2H7ZB 4BIKB 1BTEA 4KSNA 2H62D 4UY2C 1V6PA 1ABTA 2NBTA 3BT1U 1MAHF 2MJ4A 2HLRA 1I02A 1TXBA 1QKEA 3PLCA 2GOOC 1NYSA 1TFSA 2QJ9C 1NTXA 4LFTA 4BDTB 4RUDA 1CODA 1NORA 1H0JA 1RL5A 1KU6B 2GOOB 1IDLA 1NTNA 1REWC 1ERGA 1IQ9A 3U74U 2J8BA 3NDSA 1IDHA 1FASA 3QB4B 4DO8A 1LSIA 3VTSA 1FF4A 1BXPA 2MUOA 2MHYA 3LAQU 3EVSC 1ES7B 2CTXA 4FAOE 1LJZA 4P7UA 5IMYC 1CVOA 2HLQA 2QC1A 2CRSA 2BTXA 1HAJA 1LXGA 3HH7A 4ZQYA 2H7ZA 2UWRA 1CDTA 2CDXA 1M9ZA 2FD6U 2JVEA 3ERAA 1CCQA 1FFJA 3NEQA 1KBAA 1ONJA 2MJYA 2ABXA 1CB9A 4XJJA 1TXAA 1VB0A 1CXNA 4FAOC 1JBDA 1IDIA 3KFDE 1HC9B 5EBXA 1KS6A 2K3GA 2H8UA 4OM5A 2LA1A 4HQPF 2CCXA 1LX5B 1NEAA 1QM7A 1IJCA 1IKCA 1W6BA 1RGJA 1NXBA 1CRFA 2UX2A 1KBSA 2BHIA 2H64C 2MUPA 5DU1A 2I9BE 2H64B 1LXHA 2VLWA 2CRTA 2JQPA 1CHVS 2OFSA 2MFAA 1FSCA 2H5FA 3FEVA 1F8UB 4QTIU 1IDGA 2X8BB 1CDRA 1CTXA 3BT2U 1CDQA 3U73U 1KL8A 1MR6A 1ERAA 1NYUA 5DO6A 2QJBC 4EY8B 2MJ0A 5IMTD 1FSSB 4AEAA 1HOYA 1KBTA 1F94A 1YWHA 3KFDI 2PJYC 2QJAC 1HAAA 1B41B 5DZ5A 2PJYB 1DRSA 2H62C 1CDSA 2ERAA 1UG4A 2L5SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S4Y A;  1FRA A;  2L03 A;  1KFH A;  3NH7 A;  1XT3 A;  2LCR A;  1ZAD A;  4IYE A;  4OM4 A;  1COE A;  1CXO A;  1KTZ B;  1KXI A;  1TGX A;  1L4W A;  2N99 A;  1QKD A;  1KC4 A;  1IK8 A;  6EBX A;  1PLO A;  1JE9 A;  3EBX A;  1CRE A;  1G6M A;  1HC9 A;  1JGK A;  2H7Z B;  4BIK B;  1BTE A;  4UY2 C;  2H62 D;  1V6P A;  1ABT A;  2NBT A;  3BT1 U;  1MAH F;  2MJ4 A;  2HLR A;  1I02 A;  1TXB A;  1QKE A;  3PLC A;  2GOO C;  1NYS A;  1TFS A;  2QJ9 C;  1NTX A;  4LFT A;  4BDT B;  4RUD A;  1COD A;  1NOR A;  1H0J A;  1RL5 A;  1KU6 B;  2GOO B;  1IDL A;  1NTN A;  1REW C;  1ERG A;  1IQ9 A;  3U74 U;  2J8B A;  3NDS A;  1IDH A;  1FAS A;  3QB4 B;  4DO8 A;  1LSI A;  3VTS A;  1FF4 A;  1BXP A;  2MUO A;  2MHY A;  3LAQ U;  3EVS C;  1ES7 B;  2CTX A;  4FAO E;  1LJZ A;  4P7U A;  5IMY C;  1CVO A;  2HLQ A;  2QC1 A;  2CRS A;  2BTX A;  1HAJ A;  1LXG A;  3HH7 A;  4ZQY A;  2H7Z A;  2UWR A;  1CDT A;  2CDX A;  1M9Z A;  2FD6 U;  2JVE A;  3ERA A;  1CCQ A;  1FFJ A;  3NEQ A;  1KBA A;  1ONJ A;  2MJY A;  2ABX A;  1CB9 A;  4XJJ A;  1TXA A;  1VB0 A;  1CXN A;  4FAO C;  1JBD A;  1IDI A;  3KFD E;  1HC9 B;  5EBX A;  1KS6 A;  2K3G A;  2H8U A;  4OM5 A;  2LA1 A;  4HQP F;  2CCX A;  1LX5 B;  1NEA A;  1QM7 A;  1IJC A;  1IKC A;  1W6B A;  1RGJ A;  1NXB A;  1CRF A;  2UX2 A;  1KBS A;  2BHI A;  2H64 C;  2MUP A;  5DU1 A;  2I9B E;  2H64 B;  1LXH A;  2VLW A;  2CRT A;  2JQP A;  1CHV S;  2OFS A;  2MFA A;  1FSC A;  2H5F A;  3FEV A;  1F8U B;  4QTI U;  1IDG A;  2X8B B;  1CDR A;  1CTX A;  3BT2 U;  1CDQ A;  3U73 U;  1KL8 A;  1MR6 A;  1ERA A;  1NYU A;  5DO6 A;  2QJB C;  4EY8 B;  2MJ0 A;  5IMT D;  1FSS B;  4AEA A;  1HOY A;  1KBT A;  1F94 A;  1YWH A;  3KFD I;  2PJY C;  2QJA C;  1HAA A;  1B41 B;  5DZ5 A;  2PJY B;  1DRS A;  2H62 C;  1CDS A;  2ERA A;  1UG4 A;  2L5S A; 
#chains in the Genus database with same CATH topology
 1S4Y A;  1FRA A;  2L03 A;  1KFH A;  3NH7 A;  1XT3 A;  2LCR A;  1ZAD A;  4IYE A;  4OM4 A;  1COE A;  1CXO A;  1KTZ B;  1KXI A;  1TGX A;  1L4W A;  2N99 A;  1QKD A;  1KC4 A;  1IK8 A;  6EBX A;  1PLO A;  1JE9 A;  3EBX A;  1CRE A;  1G6M A;  1HC9 A;  1JGK A;  2H7Z B;  4BIK B;  1BTE A;  4KSN A;  2H62 D;  4UY2 C;  1V6P A;  1ABT A;  2NBT A;  3BT1 U;  1MAH F;  2MJ4 A;  2HLR A;  1I02 A;  1TXB A;  1QKE A;  3PLC A;  2GOO C;  1NYS A;  1TFS A;  2QJ9 C;  1NTX A;  4LFT A;  4BDT B;  4RUD A;  1COD A;  1NOR A;  1H0J A;  1RL5 A;  1KU6 B;  2GOO B;  1IDL A;  1NTN A;  1REW C;  1ERG A;  1IQ9 A;  3U74 U;  2J8B A;  3NDS A;  1IDH A;  1FAS A;  3QB4 B;  4DO8 A;  1LSI A;  3VTS A;  1FF4 A;  1BXP A;  2MUO A;  2MHY A;  3LAQ U;  3EVS C;  1ES7 B;  2CTX A;  4FAO E;  1LJZ A;  4P7U A;  5IMY C;  1CVO A;  2HLQ A;  2QC1 A;  2CRS A;  2BTX A;  1HAJ A;  1LXG A;  3HH7 A;  4ZQY A;  2H7Z A;  2UWR A;  1CDT A;  2CDX A;  1M9Z A;  2FD6 U;  2JVE A;  3ERA A;  1CCQ A;  1FFJ A;  3NEQ A;  1KBA A;  1ONJ A;  2MJY A;  2ABX A;  1CB9 A;  4XJJ A;  1TXA A;  1VB0 A;  1CXN A;  4FAO C;  1JBD A;  1IDI A;  3KFD E;  1HC9 B;  5EBX A;  1KS6 A;  2K3G A;  2H8U A;  4OM5 A;  2LA1 A;  4HQP F;  2CCX A;  1LX5 B;  1NEA A;  1QM7 A;  1IJC A;  1IKC A;  1W6B A;  1RGJ A;  1NXB A;  1CRF A;  2UX2 A;  1KBS A;  2BHI A;  2H64 C;  2MUP A;  5DU1 A;  2I9B E;  2H64 B;  1LXH A;  2VLW A;  2CRT A;  2JQP A;  1CHV S;  2OFS A;  2MFA A;  1FSC A;  2H5F A;  3FEV A;  1F8U B;  4QTI U;  1IDG A;  2X8B B;  1CDR A;  1CTX A;  3BT2 U;  1CDQ A;  3U73 U;  1KL8 A;  1MR6 A;  1ERA A;  1NYU A;  5DO6 A;  2QJB C;  4EY8 B;  2MJ0 A;  5IMT D;  1FSS B;  4AEA A;  1HOY A;  1KBT A;  1F94 A;  1YWH A;  3KFD I;  2PJY C;  2QJA C;  1HAA A;  1B41 B;  5DZ5 A;  2PJY B;  1DRS A;  2H62 C;  1CDS A;  2ERA A;  1UG4 A;  2L5S A; 
#chains in the Genus database with same CATH homology
 1S4Y A;  1FRA A;  2L03 A;  1KFH A;  3NH7 A;  1XT3 A;  2LCR A;  1ZAD A;  4IYE A;  4OM4 A;  1COE A;  1CXO A;  1KTZ B;  1KXI A;  1TGX A;  1L4W A;  2N99 A;  1QKD A;  1KC4 A;  1IK8 A;  6EBX A;  1PLO A;  1JE9 A;  3EBX A;  1CRE A;  1G6M A;  1HC9 A;  1JGK A;  2H7Z B;  4BIK B;  1BTE A;  4KSN A;  2H62 D;  4UY2 C;  1V6P A;  1ABT A;  2NBT A;  3BT1 U;  1MAH F;  2MJ4 A;  2HLR A;  1I02 A;  1TXB A;  1QKE A;  3PLC A;  2GOO C;  1NYS A;  1TFS A;  2QJ9 C;  1NTX A;  4LFT A;  4BDT B;  4RUD A;  1COD A;  1NOR A;  1H0J A;  1RL5 A;  1KU6 B;  2GOO B;  1IDL A;  1NTN A;  1REW C;  1ERG A;  1IQ9 A;  3U74 U;  2J8B A;  3NDS A;  1IDH A;  1FAS A;  3QB4 B;  4DO8 A;  1LSI A;  3VTS A;  1FF4 A;  1BXP A;  2MUO A;  2MHY A;  3LAQ U;  3EVS C;  1ES7 B;  2CTX A;  4FAO E;  1LJZ A;  4P7U A;  5IMY C;  1CVO A;  2HLQ A;  2QC1 A;  2CRS A;  2BTX A;  1HAJ A;  1LXG A;  3HH7 A;  4ZQY A;  2H7Z A;  2UWR A;  1CDT A;  2CDX A;  1M9Z A;  2FD6 U;  2JVE A;  3ERA A;  1CCQ A;  1FFJ A;  3NEQ A;  1KBA A;  1ONJ A;  2MJY A;  2ABX A;  1CB9 A;  4XJJ A;  1TXA A;  1VB0 A;  1CXN A;  4FAO C;  1JBD A;  1IDI A;  3KFD E;  1HC9 B;  5EBX A;  1KS6 A;  2K3G A;  2H8U A;  4OM5 A;  2LA1 A;  4HQP F;  2CCX A;  1LX5 B;  1NEA A;  1QM7 A;  1IJC A;  1IKC A;  1W6B A;  1RGJ A;  1NXB A;  1CRF A;  2UX2 A;  1KBS A;  2BHI A;  2H64 C;  2MUP A;  5DU1 A;  2I9B E;  2H64 B;  1LXH A;  2VLW A;  2CRT A;  2JQP A;  1CHV S;  2OFS A;  2MFA A;  1FSC A;  2H5F A;  3FEV A;  1F8U B;  4QTI U;  1IDG A;  2X8B B;  1CDR A;  1CTX A;  3BT2 U;  1CDQ A;  3U73 U;  1KL8 A;  1MR6 A;  1ERA A;  1NYU A;  5DO6 A;  2QJB C;  4EY8 B;  2MJ0 A;  5IMT D;  1FSS B;  4AEA A;  1HOY A;  1KBT A;  1F94 A;  1YWH A;  3KFD I;  2PJY C;  2QJA C;  1HAA A;  1B41 B;  5DZ5 A;  2PJY B;  1DRS A;  2H62 C;  1CDS A;  2ERA A;  1UG4 A;  2L5S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...