1KL8A

Nmr structural analysis of the complex formed between alpha-bungarotoxin and the principal alpha-neurotoxin binding sequence on the alpha7 subunit of a neuronal nicotinic acetylcholine receptor
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
74
structure length
74
Chain Sequence
IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords ALPHA-BUNGAROTOXIN
publication title NMR structural analysis of alpha-bungarotoxin and its complex with the principal alpha-neurotoxin-binding sequence on the alpha 7 subunit of a neuronal nicotinic acetylcholine receptor.
pubmed doi rcsb
source organism Gallus gallus
total genus 4
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2001-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1kl8A00
3FEVA 2MUOA 2J8BA 1ONJA 2CDXA 1LX5B 1CDSA 1JBDA 1B41B 1QM7A 2K3GA 1ES7B 3KFDE 3NEQA 4BIKB 2NBTA 1CDRA 5DO6A 1NTNA 2UWRA 4OM5A 1TXBA 2UX2A 2L5SA 1FF4A 4HQPF 3EBXA 1XT3A 2PJYC 3BT2U 3NH7A 1CCQA 1KL8A 1VB0A 1COEA 1I02A 2GOOB 1S4YA 2H5FA 1KFHA 5IMYC 5DZ5A 1CREA 4AEAA 3U73U 4FAOE 2JQPA 1KS6A 1IDGA 2HLQA 3PLCA 4QTIU 4RUDA 2MUPA 1RGJA 4OM4A 1YWHA 1FFJA 5IMTD 1IKCA 1UG4A 1DRSA 2CRSA 2MJYA 2X8BB 5EBXA 1FSCA 1HAAA 2CRTA 1CXOA 1KBAA 1KBTA 4EY8B 1IDLA 1ABTA 1KXIA 3VTSA 2LA1A 2H64C 3EVSC 1CDTA 1H0JA 2H62D 3BT1U 1QKDA 1CODA 4UY2C 1IDIA 1NYSA 1V6PA 1KTZB 2N99A 1LXHA 2PJYB 1CDQA 1M9ZA 2QJ9C 1G6MA 4ZQYA 1W6BA 1FSSB 1ERAA 1NEAA 2OFSA 2MHYA 1MR6A 2H7ZA 5DU1A 1F8UB 2BHIA 1IQ9A 1BTEA 4XJJA 1RL5A 1HC9A 2LCRA 1NORA 1TFSA 2ABXA 1NTXA 1HOYA 1ERGA 1CHVS 1F94A 1L4WA 2HLRA 3NDSA 1BXPA 1FRAA 2MJ0A 1IJCA 1TXAA 2H64B 2I9BE 3HH7A 1LJZA 4LFTA 1PLOA 4DO8A 1LXGA 2VLWA 2L03A 2H7ZB 1HAJA 3U74U 1CTXA 1CVOA 4FAOC 1HC9B 3KFDI 4BDTB 3LAQU 1CXNA 1CRFA 1NYUA 2GOOC 2MFAA 2BTXA 1REWC 2H62C 2MJ4A 1CB9A 1KBSA 1QKEA 2CCXA 1JGKA 4IYEA 2FD6U 3ERAA 1LSIA 1MAHF 2H8UA 2QJAC 2QJBC 2QC1A 3QB4B 1IK8A 1NXBA 2CTXA 1FASA 2ERAA 1JE9A 4P7UA 6EBXA 1IDHA 1TGXA 1KC4A 1ZADA 2JVEA 1KU6B
chains in the Genus database with same CATH superfamily
3FEVA 2MUOA 2J8BA 1ONJA 2CDXA 1LX5B 1CDSA 1JBDA 1B41B 1QM7A 2K3GA 1ES7B 3KFDE 3NEQA 4BIKB 2NBTA 1CDRA 5DO6A 1NTNA 2UWRA 4OM5A 1TXBA 2UX2A 2L5SA 1FF4A 4HQPF 3EBXA 1XT3A 2PJYC 3BT2U 3NH7A 1CCQA 1KL8A 1VB0A 1COEA 1I02A 2GOOB 1S4YA 2H5FA 1KFHA 5IMYC 5DZ5A 1CREA 4AEAA 3U73U 4FAOE 2JQPA 1KS6A 1IDGA 2HLQA 3PLCA 4QTIU 4RUDA 2MUPA 1RGJA 4OM4A 1YWHA 1FFJA 5IMTD 1IKCA 1UG4A 1DRSA 2CRSA 2MJYA 2X8BB 5EBXA 1FSCA 1HAAA 2CRTA 1CXOA 1KBAA 1KBTA 4EY8B 1IDLA 1ABTA 1KXIA 3VTSA 2LA1A 2H64C 3EVSC 1CDTA 1H0JA 2H62D 3BT1U 1QKDA 1CODA 4UY2C 1IDIA 1NYSA 1V6PA 1KTZB 2N99A 1LXHA 2PJYB 1CDQA 1M9ZA 2QJ9C 1G6MA 4ZQYA 1W6BA 1FSSB 1ERAA 1NEAA 2OFSA 2MHYA 1MR6A 2H7ZA 5DU1A 1F8UB 2BHIA 1IQ9A 1BTEA 4XJJA 1RL5A 1HC9A 2LCRA 1NORA 1TFSA 2ABXA 1NTXA 1HOYA 1ERGA 1CHVS 1F94A 1L4WA 2HLRA 3NDSA 1BXPA 1FRAA 2MJ0A 1IJCA 1TXAA 2H64B 2I9BE 3HH7A 1LJZA 4LFTA 1PLOA 4DO8A 1LXGA 2VLWA 2L03A 2H7ZB 1HAJA 3U74U 1CTXA 1CVOA 4FAOC 1HC9B 3KFDI 4BDTB 3LAQU 1CXNA 1CRFA 1NYUA 2GOOC 2MFAA 2BTXA 1REWC 2H62C 2MJ4A 1CB9A 1KBSA 1QKEA 2CCXA 1JGKA 4IYEA 2FD6U 3ERAA 1LSIA 1MAHF 2H8UA 2QJAC 2QJBC 2QC1A 3QB4B 1IK8A 1NXBA 2CTXA 4KSNA 1FASA 2ERAA 1JE9A 4P7UA 6EBXA 1IDHA 1TGXA 1KC4A 1ZADA 2JVEA 1KU6B
chains in the Genus database with same CATH topology
3FEVA 2MUOA 2J8BA 1ONJA 2CDXA 1LX5B 1CDSA 1JBDA 1B41B 1QM7A 2K3GA 1ES7B 3KFDE 3NEQA 4BIKB 2NBTA 1CDRA 5DO6A 1NTNA 2UWRA 4OM5A 1TXBA 2UX2A 2L5SA 1FF4A 4HQPF 3EBXA 1XT3A 2PJYC 3BT2U 3NH7A 1CCQA 1KL8A 1VB0A 1COEA 1I02A 2GOOB 1S4YA 2H5FA 1KFHA 5IMYC 5DZ5A 1CREA 4AEAA 3U73U 4FAOE 2JQPA 1KS6A 1IDGA 2HLQA 3PLCA 4QTIU 4RUDA 2MUPA 1RGJA 4OM4A 1YWHA 1FFJA 5IMTD 1IKCA 1UG4A 1DRSA 2CRSA 2MJYA 2X8BB 5EBXA 1FSCA 1HAAA 2CRTA 1CXOA 1KBAA 1KBTA 4EY8B 1IDLA 1ABTA 1KXIA 3VTSA 2LA1A 2H64C 3EVSC 1CDTA 1H0JA 2H62D 3BT1U 1QKDA 1CODA 4UY2C 1IDIA 1NYSA 1V6PA 1KTZB 2N99A 1LXHA 2PJYB 1CDQA 1M9ZA 2QJ9C 1G6MA 4ZQYA 1W6BA 1FSSB 1ERAA 1NEAA 2OFSA 2MHYA 1MR6A 2H7ZA 5DU1A 1F8UB 2BHIA 1IQ9A 1BTEA 4XJJA 1RL5A 1HC9A 2LCRA 1NORA 1TFSA 2ABXA 1NTXA 1HOYA 1ERGA 1CHVS 1F94A 1L4WA 2HLRA 3NDSA 1BXPA 1FRAA 2MJ0A 1IJCA 1TXAA 2H64B 2I9BE 3HH7A 1LJZA 4LFTA 1PLOA 4DO8A 1LXGA 2VLWA 2L03A 2H7ZB 1HAJA 3U74U 1CTXA 1CVOA 4FAOC 1HC9B 3KFDI 4BDTB 3LAQU 1CXNA 1CRFA 1NYUA 2GOOC 2MFAA 2BTXA 1REWC 2H62C 2MJ4A 1CB9A 1KBSA 1QKEA 2CCXA 1JGKA 4IYEA 2FD6U 3ERAA 1LSIA 1MAHF 2H8UA 2QJAC 2QJBC 2QC1A 3QB4B 1IK8A 1NXBA 2CTXA 4KSNA 1FASA 2ERAA 1JE9A 4P7UA 6EBXA 1IDHA 1TGXA 1KC4A 1ZADA 2JVEA 1KU6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FEV A;  2MUO A;  2J8B A;  1ONJ A;  2CDX A;  1LX5 B;  1CDS A;  1JBD A;  1B41 B;  1QM7 A;  2K3G A;  1ES7 B;  3KFD E;  3NEQ A;  4BIK B;  2NBT A;  1CDR A;  5DO6 A;  1NTN A;  2UWR A;  4OM5 A;  1TXB A;  2UX2 A;  2L5S A;  1FF4 A;  4HQP F;  3EBX A;  1XT3 A;  2PJY C;  3BT2 U;  3NH7 A;  1CCQ A;  1KL8 A;  1VB0 A;  1COE A;  1I02 A;  2GOO B;  1S4Y A;  2H5F A;  1KFH A;  5IMY C;  5DZ5 A;  1CRE A;  4AEA A;  3U73 U;  4FAO E;  2JQP A;  1KS6 A;  1IDG A;  2HLQ A;  3PLC A;  4QTI U;  4RUD A;  2MUP A;  1RGJ A;  4OM4 A;  1YWH A;  1FFJ A;  5IMT D;  1IKC A;  1UG4 A;  1DRS A;  2CRS A;  2MJY A;  2X8B B;  5EBX A;  1FSC A;  1HAA A;  2CRT A;  1CXO A;  1KBA A;  1KBT A;  4EY8 B;  1IDL A;  1ABT A;  1KXI A;  3VTS A;  2LA1 A;  2H64 C;  3EVS C;  1CDT A;  1H0J A;  2H62 D;  3BT1 U;  1QKD A;  1COD A;  4UY2 C;  1IDI A;  1NYS A;  1V6P A;  1KTZ B;  2N99 A;  1LXH A;  2PJY B;  1CDQ A;  1M9Z A;  2QJ9 C;  1G6M A;  4ZQY A;  1W6B A;  1FSS B;  1ERA A;  1NEA A;  2OFS A;  2MHY A;  1MR6 A;  2H7Z A;  5DU1 A;  1F8U B;  2BHI A;  1IQ9 A;  1BTE A;  4XJJ A;  1RL5 A;  1HC9 A;  2LCR A;  1NOR A;  1TFS A;  2ABX A;  1NTX A;  1HOY A;  1ERG A;  1CHV S;  1F94 A;  1L4W A;  2HLR A;  3NDS A;  1BXP A;  1FRA A;  2MJ0 A;  1IJC A;  1TXA A;  2H64 B;  2I9B E;  3HH7 A;  1LJZ A;  4LFT A;  1PLO A;  4DO8 A;  1LXG A;  2VLW A;  2L03 A;  2H7Z B;  1HAJ A;  3U74 U;  1CTX A;  1CVO A;  4FAO C;  1HC9 B;  3KFD I;  4BDT B;  3LAQ U;  1CXN A;  1CRF A;  1NYU A;  2GOO C;  2MFA A;  2BTX A;  1REW C;  2H62 C;  2MJ4 A;  1CB9 A;  1KBS A;  1QKE A;  2CCX A;  1JGK A;  4IYE A;  2FD6 U;  3ERA A;  1LSI A;  1MAH F;  2H8U A;  2QJA C;  2QJB C;  2QC1 A;  3QB4 B;  1IK8 A;  1NXB A;  2CTX A;  1FAS A;  2ERA A;  1JE9 A;  4P7U A;  6EBX A;  1IDH A;  1TGX A;  1KC4 A;  1ZAD A;  2JVE A;  1KU6 B; 
#chains in the Genus database with same CATH topology
 3FEV A;  2MUO A;  2J8B A;  1ONJ A;  2CDX A;  1LX5 B;  1CDS A;  1JBD A;  1B41 B;  1QM7 A;  2K3G A;  1ES7 B;  3KFD E;  3NEQ A;  4BIK B;  2NBT A;  1CDR A;  5DO6 A;  1NTN A;  2UWR A;  4OM5 A;  1TXB A;  2UX2 A;  2L5S A;  1FF4 A;  4HQP F;  3EBX A;  1XT3 A;  2PJY C;  3BT2 U;  3NH7 A;  1CCQ A;  1KL8 A;  1VB0 A;  1COE A;  1I02 A;  2GOO B;  1S4Y A;  2H5F A;  1KFH A;  5IMY C;  5DZ5 A;  1CRE A;  4AEA A;  3U73 U;  4FAO E;  2JQP A;  1KS6 A;  1IDG A;  2HLQ A;  3PLC A;  4QTI U;  4RUD A;  2MUP A;  1RGJ A;  4OM4 A;  1YWH A;  1FFJ A;  5IMT D;  1IKC A;  1UG4 A;  1DRS A;  2CRS A;  2MJY A;  2X8B B;  5EBX A;  1FSC A;  1HAA A;  2CRT A;  1CXO A;  1KBA A;  1KBT A;  4EY8 B;  1IDL A;  1ABT A;  1KXI A;  3VTS A;  2LA1 A;  2H64 C;  3EVS C;  1CDT A;  1H0J A;  2H62 D;  3BT1 U;  1QKD A;  1COD A;  4UY2 C;  1IDI A;  1NYS A;  1V6P A;  1KTZ B;  2N99 A;  1LXH A;  2PJY B;  1CDQ A;  1M9Z A;  2QJ9 C;  1G6M A;  4ZQY A;  1W6B A;  1FSS B;  1ERA A;  1NEA A;  2OFS A;  2MHY A;  1MR6 A;  2H7Z A;  5DU1 A;  1F8U B;  2BHI A;  1IQ9 A;  1BTE A;  4XJJ A;  1RL5 A;  1HC9 A;  2LCR A;  1NOR A;  1TFS A;  2ABX A;  1NTX A;  1HOY A;  1ERG A;  1CHV S;  1F94 A;  1L4W A;  2HLR A;  3NDS A;  1BXP A;  1FRA A;  2MJ0 A;  1IJC A;  1TXA A;  2H64 B;  2I9B E;  3HH7 A;  1LJZ A;  4LFT A;  1PLO A;  4DO8 A;  1LXG A;  2VLW A;  2L03 A;  2H7Z B;  1HAJ A;  3U74 U;  1CTX A;  1CVO A;  4FAO C;  1HC9 B;  3KFD I;  4BDT B;  3LAQ U;  1CXN A;  1CRF A;  1NYU A;  2GOO C;  2MFA A;  2BTX A;  1REW C;  2H62 C;  2MJ4 A;  1CB9 A;  1KBS A;  1QKE A;  2CCX A;  1JGK A;  4IYE A;  2FD6 U;  3ERA A;  1LSI A;  1MAH F;  2H8U A;  2QJA C;  2QJB C;  2QC1 A;  3QB4 B;  1IK8 A;  1NXB A;  2CTX A;  4KSN A;  1FAS A;  2ERA A;  1JE9 A;  4P7U A;  6EBX A;  1IDH A;  1TGX A;  1KC4 A;  1ZAD A;  2JVE A;  1KU6 B; 
#chains in the Genus database with same CATH homology
 3FEV A;  2MUO A;  2J8B A;  1ONJ A;  2CDX A;  1LX5 B;  1CDS A;  1JBD A;  1B41 B;  1QM7 A;  2K3G A;  1ES7 B;  3KFD E;  3NEQ A;  4BIK B;  2NBT A;  1CDR A;  5DO6 A;  1NTN A;  2UWR A;  4OM5 A;  1TXB A;  2UX2 A;  2L5S A;  1FF4 A;  4HQP F;  3EBX A;  1XT3 A;  2PJY C;  3BT2 U;  3NH7 A;  1CCQ A;  1KL8 A;  1VB0 A;  1COE A;  1I02 A;  2GOO B;  1S4Y A;  2H5F A;  1KFH A;  5IMY C;  5DZ5 A;  1CRE A;  4AEA A;  3U73 U;  4FAO E;  2JQP A;  1KS6 A;  1IDG A;  2HLQ A;  3PLC A;  4QTI U;  4RUD A;  2MUP A;  1RGJ A;  4OM4 A;  1YWH A;  1FFJ A;  5IMT D;  1IKC A;  1UG4 A;  1DRS A;  2CRS A;  2MJY A;  2X8B B;  5EBX A;  1FSC A;  1HAA A;  2CRT A;  1CXO A;  1KBA A;  1KBT A;  4EY8 B;  1IDL A;  1ABT A;  1KXI A;  3VTS A;  2LA1 A;  2H64 C;  3EVS C;  1CDT A;  1H0J A;  2H62 D;  3BT1 U;  1QKD A;  1COD A;  4UY2 C;  1IDI A;  1NYS A;  1V6P A;  1KTZ B;  2N99 A;  1LXH A;  2PJY B;  1CDQ A;  1M9Z A;  2QJ9 C;  1G6M A;  4ZQY A;  1W6B A;  1FSS B;  1ERA A;  1NEA A;  2OFS A;  2MHY A;  1MR6 A;  2H7Z A;  5DU1 A;  1F8U B;  2BHI A;  1IQ9 A;  1BTE A;  4XJJ A;  1RL5 A;  1HC9 A;  2LCR A;  1NOR A;  1TFS A;  2ABX A;  1NTX A;  1HOY A;  1ERG A;  1CHV S;  1F94 A;  1L4W A;  2HLR A;  3NDS A;  1BXP A;  1FRA A;  2MJ0 A;  1IJC A;  1TXA A;  2H64 B;  2I9B E;  3HH7 A;  1LJZ A;  4LFT A;  1PLO A;  4DO8 A;  1LXG A;  2VLW A;  2L03 A;  2H7Z B;  1HAJ A;  3U74 U;  1CTX A;  1CVO A;  4FAO C;  1HC9 B;  3KFD I;  4BDT B;  3LAQ U;  1CXN A;  1CRF A;  1NYU A;  2GOO C;  2MFA A;  2BTX A;  1REW C;  2H62 C;  2MJ4 A;  1CB9 A;  1KBS A;  1QKE A;  2CCX A;  1JGK A;  4IYE A;  2FD6 U;  3ERA A;  1LSI A;  1MAH F;  2H8U A;  2QJA C;  2QJB C;  2QC1 A;  3QB4 B;  1IK8 A;  1NXB A;  2CTX A;  4KSN A;  1FAS A;  2ERA A;  1JE9 A;  4P7U A;  6EBX A;  1IDH A;  1TGX A;  1KC4 A;  1ZAD A;  2JVE A;  1KU6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...