1KL8A

Nmr structural analysis of the complex formed between alpha-bungarotoxin and the principal alpha-neurotoxin binding sequence on the alpha7 subunit of a neuronal nicotinic acetylcholine receptor
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
74
structure length
74
Chain Sequence
IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structural analysis of alpha-bungarotoxin and its complex with the principal alpha-neurotoxin-binding sequence on the alpha 7 subunit of a neuronal nicotinic acetylcholine receptor.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Toxin
molecule keywords ALPHA-BUNGAROTOXIN
total genus 4
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2001-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1kl8A00
5IMYC 4DO8A 2L03A 2MFAA 4HQPF 1KBSA 2H64C 5IMTD 2X8BB 1CDQA 2K3GA 2CRTA 1CDRA 1YWHA 3HH7A 1KU6B 4IYEA 2NBTA 2J8BA 3QB4B 4LFTA 1FASA 3LAQU 2GOOB 1CB9A 2CDXA 1FSSB 1S4YA 4XJJA 3BT1U 1CTXA 2MHYA 5DU1A 1KS6A 2HLQA 2VLWA 2QJAC 2QJBC 1NYSA 1ERAA 2PJYC 1IDLA 3VTSA 2LCRA 1ERGA 1FF4A 1G6MA 1NORA 3BT2U 1KFHA 2H62D 2ERAA 2MUPA 1IDIA 5DO6A 1CCQA 1KXIA 2H62C 1TXBA 1TGXA 2L5SA 2BHIA 4UY2C 1B41B 1NTXA 1TFSA 3ERAA 1CVOA 2CCXA 3EVSC 2JQPA 1HC9A 1IDHA 2UWRA 1KTZB 1CREA 1NEAA 4EY8B 3NDSA 1LSIA 4OM4A 1DRSA 1BTEA 1QM7A 1IK8A 1LXHA 2QJ9C 4FAOC 1IDGA 1LJZA 1CRFA 2JVEA 1V6PA 3NH7A 1PLOA 3KFDI 1QKEA 1NXBA 1JGKA 1MAHF 2H5FA 1RGJA 1KL8A 1KBAA 2BTXA 3U73U 4BDTB 2ABXA 1XT3A 1CDTA 1FSCA 1MR6A 6EBXA 1ZADA 2FD6U 1F8UB 1ONJA 1REWC 1IJCA 3EBXA 1NYUA 1LX5B 1QKDA 2HLRA 1JBDA 1F94A 1CODA 5EBXA 1CDSA 1FRAA 2PJYB 1ES7B 1HAJA 1FFJA 1IKCA 1BXPA 1KC4A 1W6BA 2CTXA 4QTIU 2LA1A 2MJ4A 2OFSA 1I02A 1IQ9A 1M9ZA 2UX2A 1JE9A 4AEAA 2MJYA 3U74U 1COEA 1HOYA 1NTNA 1ABTA 3PLCA 1KBTA 2H7ZA 1CHVS 4ZQYA 2H64B 1HAAA 4BIKB 2I9BE 1TXAA 1HC9B 4RUDA 4FAOE 2N99A 2MJ0A 1CXOA 1L4WA 1LXGA 2MUOA 3KFDE 1H0JA 5DZ5A 2QC1A 2GOOC 2H8UA 2CRSA 3NEQA 4P7UA 2H7ZB 4OM5A 1RL5A 1VB0A 3FEVA 1UG4A 1CXNA
chains in the Genus database with same CATH superfamily
5IMYC 4DO8A 2L03A 2MFAA 4HQPF 1KBSA 2H64C 5IMTD 2X8BB 1CDQA 2K3GA 2CRTA 1CDRA 1YWHA 3HH7A 1KU6B 4IYEA 2NBTA 2J8BA 3QB4B 4LFTA 1FASA 3LAQU 2GOOB 1CB9A 2CDXA 1FSSB 1S4YA 4XJJA 3BT1U 1CTXA 2MHYA 5DU1A 1KS6A 2HLQA 2VLWA 2QJAC 2QJBC 1NYSA 1ERAA 2PJYC 1IDLA 3VTSA 2LCRA 1ERGA 1FF4A 1G6MA 1NORA 3BT2U 1KFHA 2H62D 2ERAA 2MUPA 1IDIA 5DO6A 1CCQA 1KXIA 2H62C 1TXBA 1TGXA 2L5SA 2BHIA 4UY2C 1B41B 1NTXA 1TFSA 3ERAA 1CVOA 2CCXA 3EVSC 2JQPA 1HC9A 1IDHA 2UWRA 1KTZB 1CREA 1NEAA 4EY8B 3NDSA 1LSIA 4OM4A 1DRSA 1BTEA 1QM7A 1IK8A 1LXHA 2QJ9C 4FAOC 1IDGA 1LJZA 1CRFA 2JVEA 1V6PA 3NH7A 1PLOA 3KFDI 1QKEA 1NXBA 1JGKA 1MAHF 2H5FA 1RGJA 1KL8A 1KBAA 2BTXA 3U73U 4BDTB 2ABXA 1XT3A 1CDTA 1FSCA 1MR6A 6EBXA 1ZADA 2FD6U 1F8UB 1ONJA 1REWC 1IJCA 3EBXA 1NYUA 1LX5B 1QKDA 2HLRA 1JBDA 1F94A 1CODA 5EBXA 1CDSA 1FRAA 2PJYB 1ES7B 1HAJA 1FFJA 1IKCA 4KSNA 1BXPA 1KC4A 1W6BA 2CTXA 4QTIU 2LA1A 2MJ4A 2OFSA 1I02A 1IQ9A 1M9ZA 2UX2A 1JE9A 4AEAA 2MJYA 3U74U 1COEA 1HOYA 1NTNA 1ABTA 3PLCA 1KBTA 2H7ZA 1CHVS 4ZQYA 2H64B 1HAAA 4BIKB 2I9BE 1TXAA 1HC9B 4RUDA 4FAOE 2N99A 2MJ0A 1CXOA 1L4WA 1LXGA 2MUOA 3KFDE 1H0JA 5DZ5A 2QC1A 2GOOC 2H8UA 2CRSA 3NEQA 4P7UA 2H7ZB 4OM5A 1RL5A 1VB0A 3FEVA 1UG4A 1CXNA
chains in the Genus database with same CATH topology
5IMYC 4DO8A 2L03A 2MFAA 4HQPF 1KBSA 2H64C 5IMTD 2X8BB 1CDQA 2K3GA 2CRTA 1CDRA 1YWHA 3HH7A 1KU6B 4IYEA 2NBTA 2J8BA 3QB4B 4LFTA 1FASA 3LAQU 2GOOB 1CB9A 2CDXA 1FSSB 1S4YA 4XJJA 3BT1U 1CTXA 2MHYA 5DU1A 1KS6A 2HLQA 2VLWA 2QJAC 2QJBC 1NYSA 1ERAA 2PJYC 1IDLA 3VTSA 2LCRA 1ERGA 1FF4A 1G6MA 1NORA 3BT2U 1KFHA 2H62D 2ERAA 2MUPA 1IDIA 5DO6A 1CCQA 1KXIA 2H62C 1TXBA 1TGXA 2L5SA 2BHIA 4UY2C 1B41B 1NTXA 1TFSA 3ERAA 1CVOA 2CCXA 3EVSC 2JQPA 1HC9A 1IDHA 2UWRA 1KTZB 1CREA 1NEAA 4EY8B 3NDSA 1LSIA 4OM4A 1DRSA 1BTEA 1QM7A 1IK8A 1LXHA 2QJ9C 4FAOC 1IDGA 1LJZA 1CRFA 2JVEA 1V6PA 3NH7A 1PLOA 3KFDI 1QKEA 1NXBA 1JGKA 1MAHF 2H5FA 1RGJA 1KL8A 1KBAA 2BTXA 3U73U 4BDTB 2ABXA 1XT3A 1CDTA 1FSCA 1MR6A 6EBXA 1ZADA 2FD6U 1F8UB 1ONJA 1REWC 1IJCA 3EBXA 1NYUA 1LX5B 1QKDA 2HLRA 1JBDA 1F94A 1CODA 5EBXA 1CDSA 1FRAA 2PJYB 1ES7B 1HAJA 1FFJA 1IKCA 4KSNA 1BXPA 1KC4A 1W6BA 2CTXA 4QTIU 2LA1A 2MJ4A 2OFSA 1I02A 1IQ9A 1M9ZA 2UX2A 1JE9A 4AEAA 2MJYA 3U74U 1COEA 1HOYA 1NTNA 1ABTA 3PLCA 1KBTA 2H7ZA 1CHVS 4ZQYA 2H64B 1HAAA 4BIKB 2I9BE 1TXAA 1HC9B 4RUDA 4FAOE 2N99A 2MJ0A 1CXOA 1L4WA 1LXGA 2MUOA 3KFDE 1H0JA 5DZ5A 2QC1A 2GOOC 2H8UA 2CRSA 3NEQA 4P7UA 2H7ZB 4OM5A 1RL5A 1VB0A 3FEVA 1UG4A 1CXNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IMY C;  4DO8 A;  2L03 A;  2MFA A;  4HQP F;  1KBS A;  2H64 C;  5IMT D;  2X8B B;  1CDQ A;  2K3G A;  2CRT A;  1CDR A;  1YWH A;  3HH7 A;  1KU6 B;  4IYE A;  2NBT A;  2J8B A;  3QB4 B;  4LFT A;  1FAS A;  3LAQ U;  2GOO B;  1CB9 A;  2CDX A;  1FSS B;  1S4Y A;  4XJJ A;  3BT1 U;  1CTX A;  2MHY A;  5DU1 A;  1KS6 A;  2HLQ A;  2VLW A;  2QJA C;  2QJB C;  1NYS A;  1ERA A;  2PJY C;  1IDL A;  3VTS A;  2LCR A;  1ERG A;  1FF4 A;  1G6M A;  1NOR A;  3BT2 U;  1KFH A;  2H62 D;  2ERA A;  2MUP A;  1IDI A;  5DO6 A;  1CCQ A;  1KXI A;  2H62 C;  1TXB A;  1TGX A;  2L5S A;  2BHI A;  4UY2 C;  1B41 B;  1NTX A;  1TFS A;  3ERA A;  1CVO A;  2CCX A;  3EVS C;  2JQP A;  1HC9 A;  1IDH A;  2UWR A;  1KTZ B;  1CRE A;  1NEA A;  4EY8 B;  3NDS A;  1LSI A;  4OM4 A;  1DRS A;  1BTE A;  1QM7 A;  1IK8 A;  1LXH A;  2QJ9 C;  4FAO C;  1IDG A;  1LJZ A;  1CRF A;  2JVE A;  1V6P A;  3NH7 A;  1PLO A;  3KFD I;  1QKE A;  1NXB A;  1JGK A;  1MAH F;  2H5F A;  1RGJ A;  1KL8 A;  1KBA A;  2BTX A;  3U73 U;  4BDT B;  2ABX A;  1XT3 A;  1CDT A;  1FSC A;  1MR6 A;  6EBX A;  1ZAD A;  2FD6 U;  1F8U B;  1ONJ A;  1REW C;  1IJC A;  3EBX A;  1NYU A;  1LX5 B;  1QKD A;  2HLR A;  1JBD A;  1F94 A;  1COD A;  5EBX A;  1CDS A;  1FRA A;  2PJY B;  1ES7 B;  1HAJ A;  1FFJ A;  1IKC A;  1BXP A;  1KC4 A;  1W6B A;  2CTX A;  4QTI U;  2LA1 A;  2MJ4 A;  2OFS A;  1I02 A;  1IQ9 A;  1M9Z A;  2UX2 A;  1JE9 A;  4AEA A;  2MJY A;  3U74 U;  1COE A;  1HOY A;  1NTN A;  1ABT A;  3PLC A;  1KBT A;  2H7Z A;  1CHV S;  4ZQY A;  2H64 B;  1HAA A;  4BIK B;  2I9B E;  1TXA A;  1HC9 B;  4RUD A;  4FAO E;  2N99 A;  2MJ0 A;  1CXO A;  1L4W A;  1LXG A;  2MUO A;  3KFD E;  1H0J A;  5DZ5 A;  2QC1 A;  2GOO C;  2H8U A;  2CRS A;  3NEQ A;  4P7U A;  2H7Z B;  4OM5 A;  1RL5 A;  1VB0 A;  3FEV A;  1UG4 A;  1CXN A; 
#chains in the Genus database with same CATH topology
 5IMY C;  4DO8 A;  2L03 A;  2MFA A;  4HQP F;  1KBS A;  2H64 C;  5IMT D;  2X8B B;  1CDQ A;  2K3G A;  2CRT A;  1CDR A;  1YWH A;  3HH7 A;  1KU6 B;  4IYE A;  2NBT A;  2J8B A;  3QB4 B;  4LFT A;  1FAS A;  3LAQ U;  2GOO B;  1CB9 A;  2CDX A;  1FSS B;  1S4Y A;  4XJJ A;  3BT1 U;  1CTX A;  2MHY A;  5DU1 A;  1KS6 A;  2HLQ A;  2VLW A;  2QJA C;  2QJB C;  1NYS A;  1ERA A;  2PJY C;  1IDL A;  3VTS A;  2LCR A;  1ERG A;  1FF4 A;  1G6M A;  1NOR A;  3BT2 U;  1KFH A;  2H62 D;  2ERA A;  2MUP A;  1IDI A;  5DO6 A;  1CCQ A;  1KXI A;  2H62 C;  1TXB A;  1TGX A;  2L5S A;  2BHI A;  4UY2 C;  1B41 B;  1NTX A;  1TFS A;  3ERA A;  1CVO A;  2CCX A;  3EVS C;  2JQP A;  1HC9 A;  1IDH A;  2UWR A;  1KTZ B;  1CRE A;  1NEA A;  4EY8 B;  3NDS A;  1LSI A;  4OM4 A;  1DRS A;  1BTE A;  1QM7 A;  1IK8 A;  1LXH A;  2QJ9 C;  4FAO C;  1IDG A;  1LJZ A;  1CRF A;  2JVE A;  1V6P A;  3NH7 A;  1PLO A;  3KFD I;  1QKE A;  1NXB A;  1JGK A;  1MAH F;  2H5F A;  1RGJ A;  1KL8 A;  1KBA A;  2BTX A;  3U73 U;  4BDT B;  2ABX A;  1XT3 A;  1CDT A;  1FSC A;  1MR6 A;  6EBX A;  1ZAD A;  2FD6 U;  1F8U B;  1ONJ A;  1REW C;  1IJC A;  3EBX A;  1NYU A;  1LX5 B;  1QKD A;  2HLR A;  1JBD A;  1F94 A;  1COD A;  5EBX A;  1CDS A;  1FRA A;  2PJY B;  1ES7 B;  1HAJ A;  1FFJ A;  1IKC A;  4KSN A;  1BXP A;  1KC4 A;  1W6B A;  2CTX A;  4QTI U;  2LA1 A;  2MJ4 A;  2OFS A;  1I02 A;  1IQ9 A;  1M9Z A;  2UX2 A;  1JE9 A;  4AEA A;  2MJY A;  3U74 U;  1COE A;  1HOY A;  1NTN A;  1ABT A;  3PLC A;  1KBT A;  2H7Z A;  1CHV S;  4ZQY A;  2H64 B;  1HAA A;  4BIK B;  2I9B E;  1TXA A;  1HC9 B;  4RUD A;  4FAO E;  2N99 A;  2MJ0 A;  1CXO A;  1L4W A;  1LXG A;  2MUO A;  3KFD E;  1H0J A;  5DZ5 A;  2QC1 A;  2GOO C;  2H8U A;  2CRS A;  3NEQ A;  4P7U A;  2H7Z B;  4OM5 A;  1RL5 A;  1VB0 A;  3FEV A;  1UG4 A;  1CXN A; 
#chains in the Genus database with same CATH homology
 5IMY C;  4DO8 A;  2L03 A;  2MFA A;  4HQP F;  1KBS A;  2H64 C;  5IMT D;  2X8B B;  1CDQ A;  2K3G A;  2CRT A;  1CDR A;  1YWH A;  3HH7 A;  1KU6 B;  4IYE A;  2NBT A;  2J8B A;  3QB4 B;  4LFT A;  1FAS A;  3LAQ U;  2GOO B;  1CB9 A;  2CDX A;  1FSS B;  1S4Y A;  4XJJ A;  3BT1 U;  1CTX A;  2MHY A;  5DU1 A;  1KS6 A;  2HLQ A;  2VLW A;  2QJA C;  2QJB C;  1NYS A;  1ERA A;  2PJY C;  1IDL A;  3VTS A;  2LCR A;  1ERG A;  1FF4 A;  1G6M A;  1NOR A;  3BT2 U;  1KFH A;  2H62 D;  2ERA A;  2MUP A;  1IDI A;  5DO6 A;  1CCQ A;  1KXI A;  2H62 C;  1TXB A;  1TGX A;  2L5S A;  2BHI A;  4UY2 C;  1B41 B;  1NTX A;  1TFS A;  3ERA A;  1CVO A;  2CCX A;  3EVS C;  2JQP A;  1HC9 A;  1IDH A;  2UWR A;  1KTZ B;  1CRE A;  1NEA A;  4EY8 B;  3NDS A;  1LSI A;  4OM4 A;  1DRS A;  1BTE A;  1QM7 A;  1IK8 A;  1LXH A;  2QJ9 C;  4FAO C;  1IDG A;  1LJZ A;  1CRF A;  2JVE A;  1V6P A;  3NH7 A;  1PLO A;  3KFD I;  1QKE A;  1NXB A;  1JGK A;  1MAH F;  2H5F A;  1RGJ A;  1KL8 A;  1KBA A;  2BTX A;  3U73 U;  4BDT B;  2ABX A;  1XT3 A;  1CDT A;  1FSC A;  1MR6 A;  6EBX A;  1ZAD A;  2FD6 U;  1F8U B;  1ONJ A;  1REW C;  1IJC A;  3EBX A;  1NYU A;  1LX5 B;  1QKD A;  2HLR A;  1JBD A;  1F94 A;  1COD A;  5EBX A;  1CDS A;  1FRA A;  2PJY B;  1ES7 B;  1HAJ A;  1FFJ A;  1IKC A;  4KSN A;  1BXP A;  1KC4 A;  1W6B A;  2CTX A;  4QTI U;  2LA1 A;  2MJ4 A;  2OFS A;  1I02 A;  1IQ9 A;  1M9Z A;  2UX2 A;  1JE9 A;  4AEA A;  2MJY A;  3U74 U;  1COE A;  1HOY A;  1NTN A;  1ABT A;  3PLC A;  1KBT A;  2H7Z A;  1CHV S;  4ZQY A;  2H64 B;  1HAA A;  4BIK B;  2I9B E;  1TXA A;  1HC9 B;  4RUD A;  4FAO E;  2N99 A;  2MJ0 A;  1CXO A;  1L4W A;  1LXG A;  2MUO A;  3KFD E;  1H0J A;  5DZ5 A;  2QC1 A;  2GOO C;  2H8U A;  2CRS A;  3NEQ A;  4P7U A;  2H7Z B;  4OM5 A;  1RL5 A;  1VB0 A;  3FEV A;  1UG4 A;  1CXN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...