1M9ZA

Crystal structure of human tgf-beta type ii receptor ligand binding domain
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
105
structure length
105
Chain Sequence
ALCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPTCIMKEKKKPGETFFMCSCSSDECNDNIIFSEEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hormone/growth factor
molecule keywords TGF-BETA RECEPTOR TYPE II
publication title THE 1.1A CRYSTAL STRUCTURE OF HUMAN TGF-BETA TYPE II RECEPTOR LIGAND BINDING DOMAIN
pubmed doi rcsb
source organism Homo sapiens
total genus 24
structure length 105
sequence length 105
ec nomenclature ec 2.7.11.30: Receptor protein serine/threonine kinase.
pdb deposition date 2002-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08917 ecTbetaR2 Transforming growth factor beta receptor 2 ectodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1m9zA00
2QJ9C 1JE9A 2CTXA 1ERGA 1CB9A 2ERAA 2K3GA 1L4WA 1NORA 3EBXA 1CDQA 1KXIA 2PJYC 2MUOA 1IKCA 1ZADA 1CXNA 1NYUA 1IQ9A 1CHVS 2FD6U 1FASA 3BT1U 1IK8A 1YWHA 1KC4A 1CRFA 3KFDE 2CRTA 3NDSA 2MJ0A 5EBXA 1CODA 1BXPA 1ABTA 3U73U 3VTSA 1FF4A 2NBTA 2H64B 1JBDA 1TGXA 2L03A 2OFSA 2GOOC 3EVSC 2H62D 4AEAA 1KBSA 2MJYA 4DO8A 2CDXA 2CRSA 4RUDA 1S4YA 2QJAC 4OM5A 1FSSB 1NTNA 4UY2C 5IMTD 1IJCA 1LXHA 1HC9A 1KBTA 1W6BA 1DRSA 1CDSA 1BTEA 2LA1A 5DO6A 2MFAA 3QB4B 1VB0A 4P7UA 1RGJA 2X8BB 1G6MA 1KS6A 1QKEA 2HLQA 1NXBA 1F94A 1CDRA 1CVOA 1IDIA 1CDTA 1KU6B 5DZ5A 4EY8B 6EBXA 1HOYA 2HLRA 1IDHA 1LX5B 4ZQYA 2H8UA 4FAOE 1NTXA 1KTZB 2H64C 2MHYA 1CREA 2H7ZA 1ONJA 1QM7A 2JQPA 1CCQA 1RL5A 1V6PA 3BT2U 4BDTB 1MR6A 1TXBA 1UG4A 1FRAA 1MAHF 1PLOA 2H5FA 2MJ4A 2QC1A 1COEA 1QKDA 3U74U 1HC9B 1IDGA 2I9BE 2VLWA 4OM4A 1TFSA 1HAAA 2J8BA 1LJZA 4HQPF 1KL8A 5DU1A 2PJYB 2BHIA 2UWRA 1I02A 2UX2A 1KFHA 1B41B 1F8UB 1ES7B 4QTIU 3KFDI 5IMYC 4LFTA 4XJJA 2ABXA 3HH7A 1KBAA 3FEVA 3LAQU 4FAOC 1M9ZA 1CXOA 2H7ZB 1JGKA 1IDLA 2LCRA 3NEQA 1LXGA 2GOOB 2N99A 1FFJA 2QJBC 1ERAA 1NYSA 2BTXA 2L5SA 2MUPA 4IYEA 4BIKB 3ERAA 1HAJA 2JVEA 1XT3A 1NEAA 2H62C 2CCXA 1CTXA 3PLCA 1TXAA 1LSIA 1REWC 1H0JA 1FSCA 3NH7A
chains in the Genus database with same CATH superfamily
2QJ9C 1JE9A 2CTXA 1ERGA 1CB9A 2ERAA 2K3GA 1L4WA 1NORA 3EBXA 1CDQA 1KXIA 2PJYC 2MUOA 1IKCA 1ZADA 1CXNA 1NYUA 1IQ9A 1CHVS 2FD6U 1FASA 3BT1U 1IK8A 1YWHA 1KC4A 1CRFA 3KFDE 2CRTA 3NDSA 2MJ0A 5EBXA 1CODA 1BXPA 1ABTA 3U73U 3VTSA 1FF4A 2NBTA 2H64B 1JBDA 1TGXA 2L03A 2OFSA 2GOOC 3EVSC 2H62D 4AEAA 1KBSA 2MJYA 4DO8A 2CDXA 2CRSA 4RUDA 1S4YA 2QJAC 4OM5A 1FSSB 1NTNA 4UY2C 5IMTD 1IJCA 1LXHA 1HC9A 1KBTA 1W6BA 1DRSA 4KSNA 1CDSA 1BTEA 2LA1A 5DO6A 2MFAA 3QB4B 1VB0A 4P7UA 1RGJA 2X8BB 1G6MA 1KS6A 1QKEA 2HLQA 1NXBA 1F94A 1CDRA 1CVOA 1IDIA 1CDTA 1KU6B 5DZ5A 4EY8B 6EBXA 1HOYA 2HLRA 1IDHA 1LX5B 4ZQYA 2H8UA 4FAOE 1NTXA 1KTZB 2H64C 2MHYA 1CREA 2H7ZA 1ONJA 1QM7A 2JQPA 1CCQA 1RL5A 1V6PA 3BT2U 4BDTB 1MR6A 1TXBA 1UG4A 1FRAA 1MAHF 1PLOA 2H5FA 2MJ4A 2QC1A 1COEA 1QKDA 3U74U 1HC9B 1IDGA 2I9BE 2VLWA 4OM4A 1TFSA 1HAAA 2J8BA 1LJZA 4HQPF 1KL8A 5DU1A 2PJYB 2BHIA 2UWRA 1I02A 2UX2A 1KFHA 1B41B 1F8UB 1ES7B 4QTIU 3KFDI 5IMYC 4LFTA 4XJJA 2ABXA 3HH7A 1KBAA 3FEVA 3LAQU 4FAOC 1M9ZA 1CXOA 2H7ZB 1JGKA 1IDLA 2LCRA 3NEQA 1LXGA 2GOOB 2N99A 1FFJA 2QJBC 1ERAA 1NYSA 2BTXA 2L5SA 2MUPA 4IYEA 4BIKB 3ERAA 1HAJA 2JVEA 1XT3A 1NEAA 2H62C 2CCXA 1CTXA 3PLCA 1TXAA 1LSIA 1REWC 1H0JA 1FSCA 3NH7A
chains in the Genus database with same CATH topology
2QJ9C 1JE9A 2CTXA 1ERGA 1CB9A 2ERAA 2K3GA 1L4WA 1NORA 3EBXA 1CDQA 1KXIA 2PJYC 2MUOA 1IKCA 1ZADA 1CXNA 1NYUA 1IQ9A 1CHVS 2FD6U 1FASA 3BT1U 1IK8A 1YWHA 1KC4A 1CRFA 3KFDE 2CRTA 3NDSA 2MJ0A 5EBXA 1CODA 1BXPA 1ABTA 3U73U 3VTSA 1FF4A 2NBTA 2H64B 1JBDA 1TGXA 2L03A 2OFSA 2GOOC 3EVSC 2H62D 4AEAA 1KBSA 2MJYA 4DO8A 2CDXA 2CRSA 4RUDA 1S4YA 2QJAC 4OM5A 1FSSB 1NTNA 4UY2C 5IMTD 1IJCA 1LXHA 1HC9A 1KBTA 1W6BA 1DRSA 4KSNA 1CDSA 1BTEA 2LA1A 5DO6A 2MFAA 3QB4B 1VB0A 4P7UA 1RGJA 2X8BB 1G6MA 1KS6A 1QKEA 2HLQA 1NXBA 1F94A 1CDRA 1CVOA 1IDIA 1CDTA 1KU6B 5DZ5A 4EY8B 6EBXA 1HOYA 2HLRA 1IDHA 1LX5B 4ZQYA 2H8UA 4FAOE 1NTXA 1KTZB 2H64C 2MHYA 1CREA 2H7ZA 1ONJA 1QM7A 2JQPA 1CCQA 1RL5A 1V6PA 3BT2U 4BDTB 1MR6A 1TXBA 1UG4A 1FRAA 1MAHF 1PLOA 2H5FA 2MJ4A 2QC1A 1COEA 1QKDA 3U74U 1HC9B 1IDGA 2I9BE 2VLWA 4OM4A 1TFSA 1HAAA 2J8BA 1LJZA 4HQPF 1KL8A 5DU1A 2PJYB 2BHIA 2UWRA 1I02A 2UX2A 1KFHA 1B41B 1F8UB 1ES7B 4QTIU 3KFDI 5IMYC 4LFTA 4XJJA 2ABXA 3HH7A 1KBAA 3FEVA 3LAQU 4FAOC 1M9ZA 1CXOA 2H7ZB 1JGKA 1IDLA 2LCRA 3NEQA 1LXGA 2GOOB 2N99A 1FFJA 2QJBC 1ERAA 1NYSA 2BTXA 2L5SA 2MUPA 4IYEA 4BIKB 3ERAA 1HAJA 2JVEA 1XT3A 1NEAA 2H62C 2CCXA 1CTXA 3PLCA 1TXAA 1LSIA 1REWC 1H0JA 1FSCA 3NH7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QJ9 C;  1JE9 A;  2CTX A;  1ERG A;  1CB9 A;  2ERA A;  2K3G A;  1L4W A;  1NOR A;  3EBX A;  1CDQ A;  1KXI A;  2PJY C;  2MUO A;  1IKC A;  1ZAD A;  1CXN A;  1NYU A;  1IQ9 A;  1CHV S;  2FD6 U;  1FAS A;  3BT1 U;  1IK8 A;  1YWH A;  1KC4 A;  1CRF A;  3KFD E;  2CRT A;  3NDS A;  2MJ0 A;  5EBX A;  1COD A;  1BXP A;  1ABT A;  3U73 U;  3VTS A;  1FF4 A;  2NBT A;  2H64 B;  1JBD A;  1TGX A;  2L03 A;  2OFS A;  2GOO C;  3EVS C;  2H62 D;  4AEA A;  1KBS A;  2MJY A;  4DO8 A;  2CDX A;  2CRS A;  4RUD A;  1S4Y A;  2QJA C;  4OM5 A;  1FSS B;  1NTN A;  4UY2 C;  5IMT D;  1IJC A;  1LXH A;  1HC9 A;  1KBT A;  1W6B A;  1DRS A;  1CDS A;  1BTE A;  2LA1 A;  5DO6 A;  2MFA A;  3QB4 B;  1VB0 A;  4P7U A;  1RGJ A;  2X8B B;  1G6M A;  1KS6 A;  1QKE A;  2HLQ A;  1NXB A;  1F94 A;  1CDR A;  1CVO A;  1IDI A;  1CDT A;  1KU6 B;  5DZ5 A;  4EY8 B;  6EBX A;  1HOY A;  2HLR A;  1IDH A;  1LX5 B;  4ZQY A;  2H8U A;  4FAO E;  1NTX A;  1KTZ B;  2H64 C;  2MHY A;  1CRE A;  2H7Z A;  1ONJ A;  1QM7 A;  2JQP A;  1CCQ A;  1RL5 A;  1V6P A;  3BT2 U;  4BDT B;  1MR6 A;  1TXB A;  1UG4 A;  1FRA A;  1MAH F;  1PLO A;  2H5F A;  2MJ4 A;  2QC1 A;  1COE A;  1QKD A;  3U74 U;  1HC9 B;  1IDG A;  2I9B E;  2VLW A;  4OM4 A;  1TFS A;  1HAA A;  2J8B A;  1LJZ A;  4HQP F;  1KL8 A;  5DU1 A;  2PJY B;  2BHI A;  2UWR A;  1I02 A;  2UX2 A;  1KFH A;  1B41 B;  1F8U B;  1ES7 B;  4QTI U;  3KFD I;  5IMY C;  4LFT A;  4XJJ A;  2ABX A;  3HH7 A;  1KBA A;  3FEV A;  3LAQ U;  4FAO C;  1M9Z A;  1CXO A;  2H7Z B;  1JGK A;  1IDL A;  2LCR A;  3NEQ A;  1LXG A;  2GOO B;  2N99 A;  1FFJ A;  2QJB C;  1ERA A;  1NYS A;  2BTX A;  2L5S A;  2MUP A;  4IYE A;  4BIK B;  3ERA A;  1HAJ A;  2JVE A;  1XT3 A;  1NEA A;  2H62 C;  2CCX A;  1CTX A;  3PLC A;  1TXA A;  1LSI A;  1REW C;  1H0J A;  1FSC A;  3NH7 A; 
#chains in the Genus database with same CATH topology
 2QJ9 C;  1JE9 A;  2CTX A;  1ERG A;  1CB9 A;  2ERA A;  2K3G A;  1L4W A;  1NOR A;  3EBX A;  1CDQ A;  1KXI A;  2PJY C;  2MUO A;  1IKC A;  1ZAD A;  1CXN A;  1NYU A;  1IQ9 A;  1CHV S;  2FD6 U;  1FAS A;  3BT1 U;  1IK8 A;  1YWH A;  1KC4 A;  1CRF A;  3KFD E;  2CRT A;  3NDS A;  2MJ0 A;  5EBX A;  1COD A;  1BXP A;  1ABT A;  3U73 U;  3VTS A;  1FF4 A;  2NBT A;  2H64 B;  1JBD A;  1TGX A;  2L03 A;  2OFS A;  2GOO C;  3EVS C;  2H62 D;  4AEA A;  1KBS A;  2MJY A;  4DO8 A;  2CDX A;  2CRS A;  4RUD A;  1S4Y A;  2QJA C;  4OM5 A;  1FSS B;  1NTN A;  4UY2 C;  5IMT D;  1IJC A;  1LXH A;  1HC9 A;  1KBT A;  1W6B A;  1DRS A;  4KSN A;  1CDS A;  1BTE A;  2LA1 A;  5DO6 A;  2MFA A;  3QB4 B;  1VB0 A;  4P7U A;  1RGJ A;  2X8B B;  1G6M A;  1KS6 A;  1QKE A;  2HLQ A;  1NXB A;  1F94 A;  1CDR A;  1CVO A;  1IDI A;  1CDT A;  1KU6 B;  5DZ5 A;  4EY8 B;  6EBX A;  1HOY A;  2HLR A;  1IDH A;  1LX5 B;  4ZQY A;  2H8U A;  4FAO E;  1NTX A;  1KTZ B;  2H64 C;  2MHY A;  1CRE A;  2H7Z A;  1ONJ A;  1QM7 A;  2JQP A;  1CCQ A;  1RL5 A;  1V6P A;  3BT2 U;  4BDT B;  1MR6 A;  1TXB A;  1UG4 A;  1FRA A;  1MAH F;  1PLO A;  2H5F A;  2MJ4 A;  2QC1 A;  1COE A;  1QKD A;  3U74 U;  1HC9 B;  1IDG A;  2I9B E;  2VLW A;  4OM4 A;  1TFS A;  1HAA A;  2J8B A;  1LJZ A;  4HQP F;  1KL8 A;  5DU1 A;  2PJY B;  2BHI A;  2UWR A;  1I02 A;  2UX2 A;  1KFH A;  1B41 B;  1F8U B;  1ES7 B;  4QTI U;  3KFD I;  5IMY C;  4LFT A;  4XJJ A;  2ABX A;  3HH7 A;  1KBA A;  3FEV A;  3LAQ U;  4FAO C;  1M9Z A;  1CXO A;  2H7Z B;  1JGK A;  1IDL A;  2LCR A;  3NEQ A;  1LXG A;  2GOO B;  2N99 A;  1FFJ A;  2QJB C;  1ERA A;  1NYS A;  2BTX A;  2L5S A;  2MUP A;  4IYE A;  4BIK B;  3ERA A;  1HAJ A;  2JVE A;  1XT3 A;  1NEA A;  2H62 C;  2CCX A;  1CTX A;  3PLC A;  1TXA A;  1LSI A;  1REW C;  1H0J A;  1FSC A;  3NH7 A; 
#chains in the Genus database with same CATH homology
 2QJ9 C;  1JE9 A;  2CTX A;  1ERG A;  1CB9 A;  2ERA A;  2K3G A;  1L4W A;  1NOR A;  3EBX A;  1CDQ A;  1KXI A;  2PJY C;  2MUO A;  1IKC A;  1ZAD A;  1CXN A;  1NYU A;  1IQ9 A;  1CHV S;  2FD6 U;  1FAS A;  3BT1 U;  1IK8 A;  1YWH A;  1KC4 A;  1CRF A;  3KFD E;  2CRT A;  3NDS A;  2MJ0 A;  5EBX A;  1COD A;  1BXP A;  1ABT A;  3U73 U;  3VTS A;  1FF4 A;  2NBT A;  2H64 B;  1JBD A;  1TGX A;  2L03 A;  2OFS A;  2GOO C;  3EVS C;  2H62 D;  4AEA A;  1KBS A;  2MJY A;  4DO8 A;  2CDX A;  2CRS A;  4RUD A;  1S4Y A;  2QJA C;  4OM5 A;  1FSS B;  1NTN A;  4UY2 C;  5IMT D;  1IJC A;  1LXH A;  1HC9 A;  1KBT A;  1W6B A;  1DRS A;  4KSN A;  1CDS A;  1BTE A;  2LA1 A;  5DO6 A;  2MFA A;  3QB4 B;  1VB0 A;  4P7U A;  1RGJ A;  2X8B B;  1G6M A;  1KS6 A;  1QKE A;  2HLQ A;  1NXB A;  1F94 A;  1CDR A;  1CVO A;  1IDI A;  1CDT A;  1KU6 B;  5DZ5 A;  4EY8 B;  6EBX A;  1HOY A;  2HLR A;  1IDH A;  1LX5 B;  4ZQY A;  2H8U A;  4FAO E;  1NTX A;  1KTZ B;  2H64 C;  2MHY A;  1CRE A;  2H7Z A;  1ONJ A;  1QM7 A;  2JQP A;  1CCQ A;  1RL5 A;  1V6P A;  3BT2 U;  4BDT B;  1MR6 A;  1TXB A;  1UG4 A;  1FRA A;  1MAH F;  1PLO A;  2H5F A;  2MJ4 A;  2QC1 A;  1COE A;  1QKD A;  3U74 U;  1HC9 B;  1IDG A;  2I9B E;  2VLW A;  4OM4 A;  1TFS A;  1HAA A;  2J8B A;  1LJZ A;  4HQP F;  1KL8 A;  5DU1 A;  2PJY B;  2BHI A;  2UWR A;  1I02 A;  2UX2 A;  1KFH A;  1B41 B;  1F8U B;  1ES7 B;  4QTI U;  3KFD I;  5IMY C;  4LFT A;  4XJJ A;  2ABX A;  3HH7 A;  1KBA A;  3FEV A;  3LAQ U;  4FAO C;  1M9Z A;  1CXO A;  2H7Z B;  1JGK A;  1IDL A;  2LCR A;  3NEQ A;  1LXG A;  2GOO B;  2N99 A;  1FFJ A;  2QJB C;  1ERA A;  1NYS A;  2BTX A;  2L5S A;  2MUP A;  4IYE A;  4BIK B;  3ERA A;  1HAJ A;  2JVE A;  1XT3 A;  1NEA A;  2H62 C;  2CCX A;  1CTX A;  3PLC A;  1TXA A;  1LSI A;  1REW C;  1H0J A;  1FSC A;  3NH7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...