1NTNA

The crystal structure of neurotoxin-i from naja naja oxiana at 1.9 angstroms resolution
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
72
structure length
72
Chain Sequence
ITCYKTPIITSETCAPGQNLCYTKTWCDAWCGSRGKVIELGCAATCPTVESYQDIKCCSTDNCNPHPKQKRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Postsynaptic neurotoxin
molecule keywords NEUROTOXIN I
publication title Three-dimensional structure of neurotoxin-1 from Naja naja oxiana venom at 1.9 A resolution.
pubmed doi rcsb
source organism Naja oxiana
total genus 11
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 1994-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1ntnA00
1RL5A 1BTEA 1IDLA 1ONJA 1CREA 2HLQA 1BXPA 1IDIA 1FRAA 1TXBA 1CODA 1NEAA 4DO8A 1S4YA 2X8BB 4QTIU 1CTXA 1ZADA 2QC1A 1NYSA 1MAHF 2ERAA 2L03A 1H0JA 3FEVA 3QB4B 5DZ5A 1COEA 2J8BA 1F94A 2FD6U 2GOOC 1UG4A 2CTXA 2MJ0A 5IMTD 2N99A 4BDTB 1FFJA 2I9BE 1G6MA 2QJBC 1CDTA 3EVSC 4P7UA 3BT1U 2LA1A 1NTXA 2QJ9C 4EY8B 2JQPA 4OM5A 1NTNA 4UY2C 1KL8A 1PLOA 4HQPF 1LX5B 4RUDA 1REWC 4IYEA 1HAJA 4FAOE 3ERAA 1CDRA 2HLRA 2QJAC 1LJZA 3PLCA 1KXIA 1QM7A 2MUPA 2MFAA 2MJYA 2OFSA 1IDHA 2UWRA 1NXBA 1ERAA 1JBDA 1ES7B 1FSSB 1FASA 2BHIA 1M9ZA 3U74U 1CDSA 5DU1A 1KU6B 1MR6A 1B41B 2ABXA 3KFDE 3VTSA 2JVEA 1TFSA 1FSCA 1KC4A 3NEQA 2CCXA 2H64C 2CRSA 1QKEA 2H8UA 1V6PA 1QKDA 2UX2A 1CCQA 1HOYA 1LXGA 4ZQYA 1ABTA 3BT2U 1F8UB 1I02A 1HC9A 1KFHA 2H7ZA 2PJYB 2L5SA 1IKCA 1RGJA 1IK8A 6EBXA 1CXOA 2CDXA 5IMYC 1JGKA 2CRTA 2MUOA 3NH7A 3HH7A 1HC9B 2MJ4A 2BTXA 2H7ZB 1IQ9A 1CRFA 1L4WA 2H5FA 3U73U 2LCRA 3LAQU 1CHVS 2VLWA 3KFDI 4BIKB 1JE9A 4OM4A 1CB9A 1KBAA 2H62C 1HAAA 2GOOB 2K3GA 1CXNA 4FAOC 1FF4A 1IJCA 5DO6A 4AEAA 5EBXA 3EBXA 1TXAA 4LFTA 1NORA 1DRSA 2H64B 2NBTA 1W6BA 1KBSA 1CDQA 1YWHA 1XT3A 1KTZB 1IDGA 1KBTA 1LXHA 1CVOA 1NYUA 2PJYC 1KS6A 1TGXA 2H62D 3NDSA 2MHYA 4XJJA 1VB0A 1LSIA 1ERGA
chains in the Genus database with same CATH superfamily
1RL5A 1BTEA 1IDLA 1ONJA 1CREA 2HLQA 1BXPA 1IDIA 1FRAA 1TXBA 1CODA 1NEAA 4DO8A 1S4YA 2X8BB 4QTIU 1CTXA 1ZADA 2QC1A 1NYSA 1MAHF 2ERAA 2L03A 1H0JA 3FEVA 3QB4B 5DZ5A 1COEA 2J8BA 1F94A 2FD6U 2GOOC 1UG4A 2CTXA 2MJ0A 5IMTD 2N99A 4BDTB 1FFJA 2I9BE 1G6MA 2QJBC 1CDTA 3EVSC 4P7UA 3BT1U 2LA1A 1NTXA 2QJ9C 4KSNA 4EY8B 2JQPA 4OM5A 1NTNA 4UY2C 1KL8A 1PLOA 4HQPF 1LX5B 4RUDA 1REWC 4IYEA 1HAJA 4FAOE 3ERAA 1CDRA 2HLRA 2QJAC 1LJZA 3PLCA 1KXIA 1QM7A 2MUPA 2MFAA 2MJYA 2OFSA 1IDHA 2UWRA 1NXBA 1ERAA 1JBDA 1ES7B 1FSSB 1FASA 2BHIA 1M9ZA 3U74U 1CDSA 5DU1A 1KU6B 1MR6A 1B41B 2ABXA 3KFDE 3VTSA 2JVEA 1TFSA 1FSCA 1KC4A 3NEQA 2CCXA 2H64C 2CRSA 1QKEA 2H8UA 1V6PA 1QKDA 2UX2A 1CCQA 1HOYA 1LXGA 4ZQYA 1ABTA 3BT2U 1F8UB 1I02A 1HC9A 1KFHA 2H7ZA 2PJYB 2L5SA 1IKCA 1RGJA 1IK8A 6EBXA 1CXOA 2CDXA 5IMYC 1JGKA 2CRTA 2MUOA 3NH7A 3HH7A 1HC9B 2MJ4A 2BTXA 2H7ZB 1IQ9A 1CRFA 1L4WA 2H5FA 3U73U 2LCRA 3LAQU 1CHVS 2VLWA 3KFDI 4BIKB 1JE9A 4OM4A 1CB9A 1KBAA 2H62C 1HAAA 2GOOB 2K3GA 1CXNA 4FAOC 1FF4A 1IJCA 5DO6A 4AEAA 5EBXA 3EBXA 1TXAA 4LFTA 1NORA 1DRSA 2H64B 2NBTA 1W6BA 1KBSA 1CDQA 1YWHA 1XT3A 1KTZB 1IDGA 1KBTA 1LXHA 1CVOA 1NYUA 2PJYC 1KS6A 1TGXA 2H62D 3NDSA 2MHYA 4XJJA 1VB0A 1LSIA 1ERGA
chains in the Genus database with same CATH topology
1RL5A 1BTEA 1IDLA 1ONJA 1CREA 2HLQA 1BXPA 1IDIA 1FRAA 1TXBA 1CODA 1NEAA 4DO8A 1S4YA 2X8BB 4QTIU 1CTXA 1ZADA 2QC1A 1NYSA 1MAHF 2ERAA 2L03A 1H0JA 3FEVA 3QB4B 5DZ5A 1COEA 2J8BA 1F94A 2FD6U 2GOOC 1UG4A 2CTXA 2MJ0A 5IMTD 2N99A 4BDTB 1FFJA 2I9BE 1G6MA 2QJBC 1CDTA 3EVSC 4P7UA 3BT1U 2LA1A 1NTXA 2QJ9C 4KSNA 4EY8B 2JQPA 4OM5A 1NTNA 4UY2C 1KL8A 1PLOA 4HQPF 1LX5B 4RUDA 1REWC 4IYEA 1HAJA 4FAOE 3ERAA 1CDRA 2HLRA 2QJAC 1LJZA 3PLCA 1KXIA 1QM7A 2MUPA 2MFAA 2MJYA 2OFSA 1IDHA 2UWRA 1NXBA 1ERAA 1JBDA 1ES7B 1FSSB 1FASA 2BHIA 1M9ZA 3U74U 1CDSA 5DU1A 1KU6B 1MR6A 1B41B 2ABXA 3KFDE 3VTSA 2JVEA 1TFSA 1FSCA 1KC4A 3NEQA 2CCXA 2H64C 2CRSA 1QKEA 2H8UA 1V6PA 1QKDA 2UX2A 1CCQA 1HOYA 1LXGA 4ZQYA 1ABTA 3BT2U 1F8UB 1I02A 1HC9A 1KFHA 2H7ZA 2PJYB 2L5SA 1IKCA 1RGJA 1IK8A 6EBXA 1CXOA 2CDXA 5IMYC 1JGKA 2CRTA 2MUOA 3NH7A 3HH7A 1HC9B 2MJ4A 2BTXA 2H7ZB 1IQ9A 1CRFA 1L4WA 2H5FA 3U73U 2LCRA 3LAQU 1CHVS 2VLWA 3KFDI 4BIKB 1JE9A 4OM4A 1CB9A 1KBAA 2H62C 1HAAA 2GOOB 2K3GA 1CXNA 4FAOC 1FF4A 1IJCA 5DO6A 4AEAA 5EBXA 3EBXA 1TXAA 4LFTA 1NORA 1DRSA 2H64B 2NBTA 1W6BA 1KBSA 1CDQA 1YWHA 1XT3A 1KTZB 1IDGA 1KBTA 1LXHA 1CVOA 1NYUA 2PJYC 1KS6A 1TGXA 2H62D 3NDSA 2MHYA 4XJJA 1VB0A 1LSIA 1ERGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RL5 A;  1BTE A;  1IDL A;  1ONJ A;  1CRE A;  2HLQ A;  1BXP A;  1IDI A;  1FRA A;  1TXB A;  1COD A;  1NEA A;  4DO8 A;  1S4Y A;  2X8B B;  4QTI U;  1CTX A;  1ZAD A;  2QC1 A;  1NYS A;  1MAH F;  2ERA A;  2L03 A;  1H0J A;  3FEV A;  3QB4 B;  5DZ5 A;  1COE A;  2J8B A;  1F94 A;  2FD6 U;  2GOO C;  1UG4 A;  2CTX A;  2MJ0 A;  5IMT D;  2N99 A;  4BDT B;  1FFJ A;  2I9B E;  1G6M A;  2QJB C;  1CDT A;  3EVS C;  4P7U A;  3BT1 U;  2LA1 A;  1NTX A;  2QJ9 C;  4EY8 B;  2JQP A;  4OM5 A;  1NTN A;  4UY2 C;  1KL8 A;  1PLO A;  4HQP F;  1LX5 B;  4RUD A;  1REW C;  4IYE A;  1HAJ A;  4FAO E;  3ERA A;  1CDR A;  2HLR A;  2QJA C;  1LJZ A;  3PLC A;  1KXI A;  1QM7 A;  2MUP A;  2MFA A;  2MJY A;  2OFS A;  1IDH A;  2UWR A;  1NXB A;  1ERA A;  1JBD A;  1ES7 B;  1FSS B;  1FAS A;  2BHI A;  1M9Z A;  3U74 U;  1CDS A;  5DU1 A;  1KU6 B;  1MR6 A;  1B41 B;  2ABX A;  3KFD E;  3VTS A;  2JVE A;  1TFS A;  1FSC A;  1KC4 A;  3NEQ A;  2CCX A;  2H64 C;  2CRS A;  1QKE A;  2H8U A;  1V6P A;  1QKD A;  2UX2 A;  1CCQ A;  1HOY A;  1LXG A;  4ZQY A;  1ABT A;  3BT2 U;  1F8U B;  1I02 A;  1HC9 A;  1KFH A;  2H7Z A;  2PJY B;  2L5S A;  1IKC A;  1RGJ A;  1IK8 A;  6EBX A;  1CXO A;  2CDX A;  5IMY C;  1JGK A;  2CRT A;  2MUO A;  3NH7 A;  3HH7 A;  1HC9 B;  2MJ4 A;  2BTX A;  2H7Z B;  1IQ9 A;  1CRF A;  1L4W A;  2H5F A;  3U73 U;  2LCR A;  3LAQ U;  1CHV S;  2VLW A;  3KFD I;  4BIK B;  1JE9 A;  4OM4 A;  1CB9 A;  1KBA A;  2H62 C;  1HAA A;  2GOO B;  2K3G A;  1CXN A;  4FAO C;  1FF4 A;  1IJC A;  5DO6 A;  4AEA A;  5EBX A;  3EBX A;  1TXA A;  4LFT A;  1NOR A;  1DRS A;  2H64 B;  2NBT A;  1W6B A;  1KBS A;  1CDQ A;  1YWH A;  1XT3 A;  1KTZ B;  1IDG A;  1KBT A;  1LXH A;  1CVO A;  1NYU A;  2PJY C;  1KS6 A;  1TGX A;  2H62 D;  3NDS A;  2MHY A;  4XJJ A;  1VB0 A;  1LSI A;  1ERG A; 
#chains in the Genus database with same CATH topology
 1RL5 A;  1BTE A;  1IDL A;  1ONJ A;  1CRE A;  2HLQ A;  1BXP A;  1IDI A;  1FRA A;  1TXB A;  1COD A;  1NEA A;  4DO8 A;  1S4Y A;  2X8B B;  4QTI U;  1CTX A;  1ZAD A;  2QC1 A;  1NYS A;  1MAH F;  2ERA A;  2L03 A;  1H0J A;  3FEV A;  3QB4 B;  5DZ5 A;  1COE A;  2J8B A;  1F94 A;  2FD6 U;  2GOO C;  1UG4 A;  2CTX A;  2MJ0 A;  5IMT D;  2N99 A;  4BDT B;  1FFJ A;  2I9B E;  1G6M A;  2QJB C;  1CDT A;  3EVS C;  4P7U A;  3BT1 U;  2LA1 A;  1NTX A;  2QJ9 C;  4KSN A;  4EY8 B;  2JQP A;  4OM5 A;  1NTN A;  4UY2 C;  1KL8 A;  1PLO A;  4HQP F;  1LX5 B;  4RUD A;  1REW C;  4IYE A;  1HAJ A;  4FAO E;  3ERA A;  1CDR A;  2HLR A;  2QJA C;  1LJZ A;  3PLC A;  1KXI A;  1QM7 A;  2MUP A;  2MFA A;  2MJY A;  2OFS A;  1IDH A;  2UWR A;  1NXB A;  1ERA A;  1JBD A;  1ES7 B;  1FSS B;  1FAS A;  2BHI A;  1M9Z A;  3U74 U;  1CDS A;  5DU1 A;  1KU6 B;  1MR6 A;  1B41 B;  2ABX A;  3KFD E;  3VTS A;  2JVE A;  1TFS A;  1FSC A;  1KC4 A;  3NEQ A;  2CCX A;  2H64 C;  2CRS A;  1QKE A;  2H8U A;  1V6P A;  1QKD A;  2UX2 A;  1CCQ A;  1HOY A;  1LXG A;  4ZQY A;  1ABT A;  3BT2 U;  1F8U B;  1I02 A;  1HC9 A;  1KFH A;  2H7Z A;  2PJY B;  2L5S A;  1IKC A;  1RGJ A;  1IK8 A;  6EBX A;  1CXO A;  2CDX A;  5IMY C;  1JGK A;  2CRT A;  2MUO A;  3NH7 A;  3HH7 A;  1HC9 B;  2MJ4 A;  2BTX A;  2H7Z B;  1IQ9 A;  1CRF A;  1L4W A;  2H5F A;  3U73 U;  2LCR A;  3LAQ U;  1CHV S;  2VLW A;  3KFD I;  4BIK B;  1JE9 A;  4OM4 A;  1CB9 A;  1KBA A;  2H62 C;  1HAA A;  2GOO B;  2K3G A;  1CXN A;  4FAO C;  1FF4 A;  1IJC A;  5DO6 A;  4AEA A;  5EBX A;  3EBX A;  1TXA A;  4LFT A;  1NOR A;  1DRS A;  2H64 B;  2NBT A;  1W6B A;  1KBS A;  1CDQ A;  1YWH A;  1XT3 A;  1KTZ B;  1IDG A;  1KBT A;  1LXH A;  1CVO A;  1NYU A;  2PJY C;  1KS6 A;  1TGX A;  2H62 D;  3NDS A;  2MHY A;  4XJJ A;  1VB0 A;  1LSI A;  1ERG A; 
#chains in the Genus database with same CATH homology
 1RL5 A;  1BTE A;  1IDL A;  1ONJ A;  1CRE A;  2HLQ A;  1BXP A;  1IDI A;  1FRA A;  1TXB A;  1COD A;  1NEA A;  4DO8 A;  1S4Y A;  2X8B B;  4QTI U;  1CTX A;  1ZAD A;  2QC1 A;  1NYS A;  1MAH F;  2ERA A;  2L03 A;  1H0J A;  3FEV A;  3QB4 B;  5DZ5 A;  1COE A;  2J8B A;  1F94 A;  2FD6 U;  2GOO C;  1UG4 A;  2CTX A;  2MJ0 A;  5IMT D;  2N99 A;  4BDT B;  1FFJ A;  2I9B E;  1G6M A;  2QJB C;  1CDT A;  3EVS C;  4P7U A;  3BT1 U;  2LA1 A;  1NTX A;  2QJ9 C;  4KSN A;  4EY8 B;  2JQP A;  4OM5 A;  1NTN A;  4UY2 C;  1KL8 A;  1PLO A;  4HQP F;  1LX5 B;  4RUD A;  1REW C;  4IYE A;  1HAJ A;  4FAO E;  3ERA A;  1CDR A;  2HLR A;  2QJA C;  1LJZ A;  3PLC A;  1KXI A;  1QM7 A;  2MUP A;  2MFA A;  2MJY A;  2OFS A;  1IDH A;  2UWR A;  1NXB A;  1ERA A;  1JBD A;  1ES7 B;  1FSS B;  1FAS A;  2BHI A;  1M9Z A;  3U74 U;  1CDS A;  5DU1 A;  1KU6 B;  1MR6 A;  1B41 B;  2ABX A;  3KFD E;  3VTS A;  2JVE A;  1TFS A;  1FSC A;  1KC4 A;  3NEQ A;  2CCX A;  2H64 C;  2CRS A;  1QKE A;  2H8U A;  1V6P A;  1QKD A;  2UX2 A;  1CCQ A;  1HOY A;  1LXG A;  4ZQY A;  1ABT A;  3BT2 U;  1F8U B;  1I02 A;  1HC9 A;  1KFH A;  2H7Z A;  2PJY B;  2L5S A;  1IKC A;  1RGJ A;  1IK8 A;  6EBX A;  1CXO A;  2CDX A;  5IMY C;  1JGK A;  2CRT A;  2MUO A;  3NH7 A;  3HH7 A;  1HC9 B;  2MJ4 A;  2BTX A;  2H7Z B;  1IQ9 A;  1CRF A;  1L4W A;  2H5F A;  3U73 U;  2LCR A;  3LAQ U;  1CHV S;  2VLW A;  3KFD I;  4BIK B;  1JE9 A;  4OM4 A;  1CB9 A;  1KBA A;  2H62 C;  1HAA A;  2GOO B;  2K3G A;  1CXN A;  4FAO C;  1FF4 A;  1IJC A;  5DO6 A;  4AEA A;  5EBX A;  3EBX A;  1TXA A;  4LFT A;  1NOR A;  1DRS A;  2H64 B;  2NBT A;  1W6B A;  1KBS A;  1CDQ A;  1YWH A;  1XT3 A;  1KTZ B;  1IDG A;  1KBT A;  1LXH A;  1CVO A;  1NYU A;  2PJY C;  1KS6 A;  1TGX A;  2H62 D;  3NDS A;  2MHY A;  4XJJ A;  1VB0 A;  1LSI A;  1ERG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...