1NTNA

The crystal structure of neurotoxin-i from naja naja oxiana at 1.9 angstroms resolution
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
72
structure length
72
Chain Sequence
ITCYKTPIITSETCAPGQNLCYTKTWCDAWCGSRGKVIELGCAATCPTVESYQDIKCCSTDNCNPHPKQKRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of neurotoxin-1 from Naja naja oxiana venom at 1.9 A resolution.
pubmed doi rcsb
source organism Naja oxiana
molecule tags Postsynaptic neurotoxin
molecule keywords NEUROTOXIN I
total genus 11
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 1994-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1ntnA00
1F8UB 1IJCA 4RUDA 2I9BE 1HAAA 1ONJA 3KFDE 1B41B 4UY2C 1TGXA 3VTSA 1COEA 2J8BA 1KU6B 2H8UA 1CCQA 1HC9B 1KFHA 1RL5A 1H0JA 1NTNA 1REWC 4OM4A 3ERAA 1BTEA 3EVSC 1IK8A 2N99A 1V6PA 4ZQYA 1KBAA 1VB0A 4AEAA 4BIKB 1ABTA 1CDSA 1CDTA 1JGKA 2H7ZA 4DO8A 4EY8B 1QKEA 4FAOC 3HH7A 2CRSA 1YWHA 4IYEA 3PLCA 2MFAA 2H64B 2VLWA 6EBXA 1NEAA 1QM7A 1L4WA 1I02A 1NXBA 2NBTA 4HQPF 2CDXA 1IDIA 1FFJA 2L5SA 1ZADA 1MR6A 2JVEA 1CVOA 1CB9A 1TXAA 1KTZB 2X8BB 3U74U 3KFDI 2CCXA 1HC9A 2MJYA 1IKCA 1CREA 2MJ4A 3EBXA 5EBXA 3U73U 3NDSA 1NYSA 2H5FA 2HLRA 3BT1U 2CTXA 5DO6A 2GOOB 2QC1A 1IDLA 2PJYB 4BDTB 1DRSA 2FD6U 1LJZA 1UG4A 3NH7A 1CHVS 1KXIA 5DZ5A 1BXPA 2LA1A 2MHYA 1IDHA 2QJBC 4QTIU 1LSIA 2QJ9C 4P7UA 1CDQA 1ES7B 2JQPA 1NYUA 2BTXA 1KS6A 1FSSB 1FASA 5IMTD 1CRFA 2MJ0A 3NEQA 2PJYC 1JBDA 3QB4B 2MUOA 1KC4A 2HLQA 1TXBA 3FEVA 5DU1A 4FAOE 1FF4A 2H7ZB 1IQ9A 1NORA 1KBTA 1MAHF 2CRTA 1CDRA 1S4YA 1LXGA 1M9ZA 2MUPA 2QJAC 1LX5B 2L03A 1CXOA 2H62D 1W6BA 3BT2U 1XT3A 1ERGA 1CTXA 2H62C 4LFTA 1PLOA 2K3GA 1HOYA 1FSCA 1CXNA 1HAJA 2ERAA 2H64C 1NTXA 2OFSA 1G6MA 1RGJA 2ABXA 2GOOC 1CODA 1KBSA 5IMYC 2BHIA 2UX2A 1KL8A 1TFSA 1FRAA 4XJJA 3LAQU 1JE9A 1F94A 1LXHA 1QKDA 1ERAA 2LCRA 4OM5A 1IDGA 2UWRA
chains in the Genus database with same CATH superfamily
1F8UB 1IJCA 4RUDA 2I9BE 1HAAA 1ONJA 3KFDE 1B41B 4UY2C 1TGXA 3VTSA 1COEA 2J8BA 1KU6B 2H8UA 1CCQA 1HC9B 1KFHA 1RL5A 1H0JA 1NTNA 1REWC 4OM4A 3ERAA 1BTEA 3EVSC 1IK8A 2N99A 1V6PA 4ZQYA 1KBAA 1VB0A 4AEAA 4BIKB 1ABTA 1CDSA 1CDTA 1JGKA 2H7ZA 4DO8A 4EY8B 1QKEA 4FAOC 3HH7A 2CRSA 1YWHA 4IYEA 3PLCA 2MFAA 2H64B 2VLWA 6EBXA 1NEAA 1QM7A 1L4WA 1I02A 1NXBA 2NBTA 4HQPF 2CDXA 1IDIA 1FFJA 2L5SA 1ZADA 1MR6A 2JVEA 1CVOA 1CB9A 1TXAA 1KTZB 2X8BB 3U74U 3KFDI 2CCXA 1HC9A 2MJYA 1IKCA 1CREA 2MJ4A 3EBXA 5EBXA 3U73U 3NDSA 1NYSA 2H5FA 2HLRA 3BT1U 2CTXA 5DO6A 2GOOB 2QC1A 1IDLA 2PJYB 4BDTB 1DRSA 2FD6U 1LJZA 1UG4A 3NH7A 1CHVS 1KXIA 5DZ5A 1BXPA 2LA1A 2MHYA 1IDHA 2QJBC 4QTIU 1LSIA 2QJ9C 4P7UA 1CDQA 1ES7B 2JQPA 1NYUA 2BTXA 1KS6A 1FSSB 1FASA 5IMTD 1CRFA 2MJ0A 3NEQA 2PJYC 1JBDA 3QB4B 2MUOA 1KC4A 2HLQA 1TXBA 3FEVA 5DU1A 4FAOE 1FF4A 2H7ZB 1IQ9A 1NORA 1KBTA 1MAHF 2CRTA 1CDRA 1S4YA 1LXGA 1M9ZA 2MUPA 2QJAC 1LX5B 2L03A 1CXOA 2H62D 1W6BA 3BT2U 1XT3A 1ERGA 1CTXA 2H62C 4LFTA 1PLOA 2K3GA 4KSNA 1HOYA 1FSCA 1CXNA 1HAJA 2ERAA 2H64C 1NTXA 2OFSA 1G6MA 1RGJA 2ABXA 2GOOC 1CODA 1KBSA 5IMYC 2BHIA 2UX2A 1KL8A 1TFSA 1FRAA 4XJJA 3LAQU 1JE9A 1F94A 1LXHA 1QKDA 1ERAA 2LCRA 4OM5A 1IDGA 2UWRA
chains in the Genus database with same CATH topology
1F8UB 1IJCA 4RUDA 2I9BE 1HAAA 1ONJA 3KFDE 1B41B 4UY2C 1TGXA 3VTSA 1COEA 2J8BA 1KU6B 2H8UA 1CCQA 1HC9B 1KFHA 1RL5A 1H0JA 1NTNA 1REWC 4OM4A 3ERAA 1BTEA 3EVSC 1IK8A 2N99A 1V6PA 4ZQYA 1KBAA 1VB0A 4AEAA 4BIKB 1ABTA 1CDSA 1CDTA 1JGKA 2H7ZA 4DO8A 4EY8B 1QKEA 4FAOC 3HH7A 2CRSA 1YWHA 4IYEA 3PLCA 2MFAA 2H64B 2VLWA 6EBXA 1NEAA 1QM7A 1L4WA 1I02A 1NXBA 2NBTA 4HQPF 2CDXA 1IDIA 1FFJA 2L5SA 1ZADA 1MR6A 2JVEA 1CVOA 1CB9A 1TXAA 1KTZB 2X8BB 3U74U 3KFDI 2CCXA 1HC9A 2MJYA 1IKCA 1CREA 2MJ4A 3EBXA 5EBXA 3U73U 3NDSA 1NYSA 2H5FA 2HLRA 3BT1U 2CTXA 5DO6A 2GOOB 2QC1A 1IDLA 2PJYB 4BDTB 1DRSA 2FD6U 1LJZA 1UG4A 3NH7A 1CHVS 1KXIA 5DZ5A 1BXPA 2LA1A 2MHYA 1IDHA 2QJBC 4QTIU 1LSIA 2QJ9C 4P7UA 1CDQA 1ES7B 2JQPA 1NYUA 2BTXA 1KS6A 1FSSB 1FASA 5IMTD 1CRFA 2MJ0A 3NEQA 2PJYC 1JBDA 3QB4B 2MUOA 1KC4A 2HLQA 1TXBA 3FEVA 5DU1A 4FAOE 1FF4A 2H7ZB 1IQ9A 1NORA 1KBTA 1MAHF 2CRTA 1CDRA 1S4YA 1LXGA 1M9ZA 2MUPA 2QJAC 1LX5B 2L03A 1CXOA 2H62D 1W6BA 3BT2U 1XT3A 1ERGA 1CTXA 2H62C 4LFTA 1PLOA 2K3GA 4KSNA 1HOYA 1FSCA 1CXNA 1HAJA 2ERAA 2H64C 1NTXA 2OFSA 1G6MA 1RGJA 2ABXA 2GOOC 1CODA 1KBSA 5IMYC 2BHIA 2UX2A 1KL8A 1TFSA 1FRAA 4XJJA 3LAQU 1JE9A 1F94A 1LXHA 1QKDA 1ERAA 2LCRA 4OM5A 1IDGA 2UWRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F8U B;  1IJC A;  4RUD A;  2I9B E;  1HAA A;  1ONJ A;  3KFD E;  1B41 B;  4UY2 C;  1TGX A;  3VTS A;  1COE A;  2J8B A;  1KU6 B;  2H8U A;  1CCQ A;  1HC9 B;  1KFH A;  1RL5 A;  1H0J A;  1NTN A;  1REW C;  4OM4 A;  3ERA A;  1BTE A;  3EVS C;  1IK8 A;  2N99 A;  1V6P A;  4ZQY A;  1KBA A;  1VB0 A;  4AEA A;  4BIK B;  1ABT A;  1CDS A;  1CDT A;  1JGK A;  2H7Z A;  4DO8 A;  4EY8 B;  1QKE A;  4FAO C;  3HH7 A;  2CRS A;  1YWH A;  4IYE A;  3PLC A;  2MFA A;  2H64 B;  2VLW A;  6EBX A;  1NEA A;  1QM7 A;  1L4W A;  1I02 A;  1NXB A;  2NBT A;  4HQP F;  2CDX A;  1IDI A;  1FFJ A;  2L5S A;  1ZAD A;  1MR6 A;  2JVE A;  1CVO A;  1CB9 A;  1TXA A;  1KTZ B;  2X8B B;  3U74 U;  3KFD I;  2CCX A;  1HC9 A;  2MJY A;  1IKC A;  1CRE A;  2MJ4 A;  3EBX A;  5EBX A;  3U73 U;  3NDS A;  1NYS A;  2H5F A;  2HLR A;  3BT1 U;  2CTX A;  5DO6 A;  2GOO B;  2QC1 A;  1IDL A;  2PJY B;  4BDT B;  1DRS A;  2FD6 U;  1LJZ A;  1UG4 A;  3NH7 A;  1CHV S;  1KXI A;  5DZ5 A;  1BXP A;  2LA1 A;  2MHY A;  1IDH A;  2QJB C;  4QTI U;  1LSI A;  2QJ9 C;  4P7U A;  1CDQ A;  1ES7 B;  2JQP A;  1NYU A;  2BTX A;  1KS6 A;  1FSS B;  1FAS A;  5IMT D;  1CRF A;  2MJ0 A;  3NEQ A;  2PJY C;  1JBD A;  3QB4 B;  2MUO A;  1KC4 A;  2HLQ A;  1TXB A;  3FEV A;  5DU1 A;  4FAO E;  1FF4 A;  2H7Z B;  1IQ9 A;  1NOR A;  1KBT A;  1MAH F;  2CRT A;  1CDR A;  1S4Y A;  1LXG A;  1M9Z A;  2MUP A;  2QJA C;  1LX5 B;  2L03 A;  1CXO A;  2H62 D;  1W6B A;  3BT2 U;  1XT3 A;  1ERG A;  1CTX A;  2H62 C;  4LFT A;  1PLO A;  2K3G A;  1HOY A;  1FSC A;  1CXN A;  1HAJ A;  2ERA A;  2H64 C;  1NTX A;  2OFS A;  1G6M A;  1RGJ A;  2ABX A;  2GOO C;  1COD A;  1KBS A;  5IMY C;  2BHI A;  2UX2 A;  1KL8 A;  1TFS A;  1FRA A;  4XJJ A;  3LAQ U;  1JE9 A;  1F94 A;  1LXH A;  1QKD A;  1ERA A;  2LCR A;  4OM5 A;  1IDG A;  2UWR A; 
#chains in the Genus database with same CATH topology
 1F8U B;  1IJC A;  4RUD A;  2I9B E;  1HAA A;  1ONJ A;  3KFD E;  1B41 B;  4UY2 C;  1TGX A;  3VTS A;  1COE A;  2J8B A;  1KU6 B;  2H8U A;  1CCQ A;  1HC9 B;  1KFH A;  1RL5 A;  1H0J A;  1NTN A;  1REW C;  4OM4 A;  3ERA A;  1BTE A;  3EVS C;  1IK8 A;  2N99 A;  1V6P A;  4ZQY A;  1KBA A;  1VB0 A;  4AEA A;  4BIK B;  1ABT A;  1CDS A;  1CDT A;  1JGK A;  2H7Z A;  4DO8 A;  4EY8 B;  1QKE A;  4FAO C;  3HH7 A;  2CRS A;  1YWH A;  4IYE A;  3PLC A;  2MFA A;  2H64 B;  2VLW A;  6EBX A;  1NEA A;  1QM7 A;  1L4W A;  1I02 A;  1NXB A;  2NBT A;  4HQP F;  2CDX A;  1IDI A;  1FFJ A;  2L5S A;  1ZAD A;  1MR6 A;  2JVE A;  1CVO A;  1CB9 A;  1TXA A;  1KTZ B;  2X8B B;  3U74 U;  3KFD I;  2CCX A;  1HC9 A;  2MJY A;  1IKC A;  1CRE A;  2MJ4 A;  3EBX A;  5EBX A;  3U73 U;  3NDS A;  1NYS A;  2H5F A;  2HLR A;  3BT1 U;  2CTX A;  5DO6 A;  2GOO B;  2QC1 A;  1IDL A;  2PJY B;  4BDT B;  1DRS A;  2FD6 U;  1LJZ A;  1UG4 A;  3NH7 A;  1CHV S;  1KXI A;  5DZ5 A;  1BXP A;  2LA1 A;  2MHY A;  1IDH A;  2QJB C;  4QTI U;  1LSI A;  2QJ9 C;  4P7U A;  1CDQ A;  1ES7 B;  2JQP A;  1NYU A;  2BTX A;  1KS6 A;  1FSS B;  1FAS A;  5IMT D;  1CRF A;  2MJ0 A;  3NEQ A;  2PJY C;  1JBD A;  3QB4 B;  2MUO A;  1KC4 A;  2HLQ A;  1TXB A;  3FEV A;  5DU1 A;  4FAO E;  1FF4 A;  2H7Z B;  1IQ9 A;  1NOR A;  1KBT A;  1MAH F;  2CRT A;  1CDR A;  1S4Y A;  1LXG A;  1M9Z A;  2MUP A;  2QJA C;  1LX5 B;  2L03 A;  1CXO A;  2H62 D;  1W6B A;  3BT2 U;  1XT3 A;  1ERG A;  1CTX A;  2H62 C;  4LFT A;  1PLO A;  2K3G A;  4KSN A;  1HOY A;  1FSC A;  1CXN A;  1HAJ A;  2ERA A;  2H64 C;  1NTX A;  2OFS A;  1G6M A;  1RGJ A;  2ABX A;  2GOO C;  1COD A;  1KBS A;  5IMY C;  2BHI A;  2UX2 A;  1KL8 A;  1TFS A;  1FRA A;  4XJJ A;  3LAQ U;  1JE9 A;  1F94 A;  1LXH A;  1QKD A;  1ERA A;  2LCR A;  4OM5 A;  1IDG A;  2UWR A; 
#chains in the Genus database with same CATH homology
 1F8U B;  1IJC A;  4RUD A;  2I9B E;  1HAA A;  1ONJ A;  3KFD E;  1B41 B;  4UY2 C;  1TGX A;  3VTS A;  1COE A;  2J8B A;  1KU6 B;  2H8U A;  1CCQ A;  1HC9 B;  1KFH A;  1RL5 A;  1H0J A;  1NTN A;  1REW C;  4OM4 A;  3ERA A;  1BTE A;  3EVS C;  1IK8 A;  2N99 A;  1V6P A;  4ZQY A;  1KBA A;  1VB0 A;  4AEA A;  4BIK B;  1ABT A;  1CDS A;  1CDT A;  1JGK A;  2H7Z A;  4DO8 A;  4EY8 B;  1QKE A;  4FAO C;  3HH7 A;  2CRS A;  1YWH A;  4IYE A;  3PLC A;  2MFA A;  2H64 B;  2VLW A;  6EBX A;  1NEA A;  1QM7 A;  1L4W A;  1I02 A;  1NXB A;  2NBT A;  4HQP F;  2CDX A;  1IDI A;  1FFJ A;  2L5S A;  1ZAD A;  1MR6 A;  2JVE A;  1CVO A;  1CB9 A;  1TXA A;  1KTZ B;  2X8B B;  3U74 U;  3KFD I;  2CCX A;  1HC9 A;  2MJY A;  1IKC A;  1CRE A;  2MJ4 A;  3EBX A;  5EBX A;  3U73 U;  3NDS A;  1NYS A;  2H5F A;  2HLR A;  3BT1 U;  2CTX A;  5DO6 A;  2GOO B;  2QC1 A;  1IDL A;  2PJY B;  4BDT B;  1DRS A;  2FD6 U;  1LJZ A;  1UG4 A;  3NH7 A;  1CHV S;  1KXI A;  5DZ5 A;  1BXP A;  2LA1 A;  2MHY A;  1IDH A;  2QJB C;  4QTI U;  1LSI A;  2QJ9 C;  4P7U A;  1CDQ A;  1ES7 B;  2JQP A;  1NYU A;  2BTX A;  1KS6 A;  1FSS B;  1FAS A;  5IMT D;  1CRF A;  2MJ0 A;  3NEQ A;  2PJY C;  1JBD A;  3QB4 B;  2MUO A;  1KC4 A;  2HLQ A;  1TXB A;  3FEV A;  5DU1 A;  4FAO E;  1FF4 A;  2H7Z B;  1IQ9 A;  1NOR A;  1KBT A;  1MAH F;  2CRT A;  1CDR A;  1S4Y A;  1LXG A;  1M9Z A;  2MUP A;  2QJA C;  1LX5 B;  2L03 A;  1CXO A;  2H62 D;  1W6B A;  3BT2 U;  1XT3 A;  1ERG A;  1CTX A;  2H62 C;  4LFT A;  1PLO A;  2K3G A;  4KSN A;  1HOY A;  1FSC A;  1CXN A;  1HAJ A;  2ERA A;  2H64 C;  1NTX A;  2OFS A;  1G6M A;  1RGJ A;  2ABX A;  2GOO C;  1COD A;  1KBS A;  5IMY C;  2BHI A;  2UX2 A;  1KL8 A;  1TFS A;  1FRA A;  4XJJ A;  3LAQ U;  1JE9 A;  1F94 A;  1LXH A;  1QKD A;  1ERA A;  2LCR A;  4OM5 A;  1IDG A;  2UWR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...