1HC9B

Alpha-bungarotoxin complexed with high affinity peptide
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
74
structure length
74
Chain Sequence
IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin/peptide
molecule keywords ALPHA-BUNGAROTOXIN ISOFORM V31
publication title The Binding Site of Acetylcholine Receptor as Visualized in the X-Ray Structure of a Complex between Alpha-Bungarotoxin and a Mimotope Peptide.
pubmed doi rcsb
total genus 11
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2001-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1hc9B00
1LXGA 1CDRA 4OM4A 3EVSC 1NTXA 1IJCA 2K3GA 1CXOA 4DO8A 2MJ4A 2MUPA 1B41B 1W6BA 2PJYC 2H64C 2PJYB 1CDSA 2H64B 3ERAA 1HOYA 1CXNA 1KS6A 1IDGA 1HAAA 1M9ZA 1V6PA 2LCRA 1ABTA 1NEAA 2I9BE 2GOOC 2GOOB 1CTXA 1IK8A 1KBTA 4UY2C 1NYUA 1MAHF 1BTEA 1LX5B 1MR6A 1QM7A 3NEQA 1CVOA 4ZQYA 4BDTB 1JE9A 1ZADA 1KBAA 3U73U 1FRAA 2JVEA 3NH7A 1IQ9A 2UX2A 2H7ZA 5DO6A 5EBXA 1ERAA 1KL8A 3BT2U 1REWC 1CODA 1LXHA 4RUDA 2MHYA 4LFTA 1CB9A 4BIKB 1UG4A 1ERGA 1KXIA 3FEVA 2CRSA 2H5FA 4P7UA 1COEA 1IDHA 2CTXA 1TXBA 1IDIA 1HC9A 3EBXA 5IMYC 1BXPA 2FD6U 3KFDE 1FFJA 1PLOA 2QC1A 1CCQA 1H0JA 2JQPA 1FSSB 2H62D 3NDSA 1G6MA 1XT3A 1KBSA 1RGJA 5DU1A 2BHIA 2ERAA 3QB4B 4FAOC 1KC4A 1I02A 2BTXA 1IKCA 2J8BA 4IYEA 4HQPF 4AEAA 1NTNA 1QKEA 1YWHA 1ONJA 5IMTD 2H7ZB 1NORA 1L4WA 2X8BB 6EBXA 1KFHA 3U74U 4EY8B 1LSIA 2MUOA 1NYSA 1JGKA 1CRFA 1CDTA 3LAQU 1CREA 1CHVS 3BT1U 2L03A 1FASA 2CCXA 1TFSA 1ES7B 1TXAA 1F8UB 1CDQA 2LA1A 1KTZB 3KFDI 1HC9B 4QTIU 1KU6B 1QKDA 4OM5A 2MJ0A 2NBTA 3VTSA 1FSCA 1TGXA 3HH7A 2MFAA 4XJJA 1LJZA 2L5SA 2MJYA 1VB0A 5DZ5A 2ABXA 2N99A 1RL5A 2OFSA 1JBDA 1F94A 2CDXA 2VLWA 2QJBC 4FAOE 1DRSA 2HLQA 3PLCA 1NXBA 1HAJA 1IDLA 2H8UA 2QJ9C 2QJAC 2H62C 1FF4A 2UWRA 2CRTA 2HLRA 1S4YA
chains in the Genus database with same CATH superfamily
1LXGA 1CDRA 4OM4A 3EVSC 1NTXA 1IJCA 2K3GA 1CXOA 4DO8A 2MJ4A 2MUPA 1B41B 1W6BA 2PJYC 2H64C 2PJYB 1CDSA 2H64B 3ERAA 1HOYA 1CXNA 1KS6A 1IDGA 1HAAA 1M9ZA 1V6PA 2LCRA 1ABTA 1NEAA 2I9BE 2GOOC 2GOOB 1CTXA 1IK8A 1KBTA 4UY2C 1NYUA 1MAHF 1BTEA 1LX5B 1MR6A 1QM7A 3NEQA 1CVOA 4ZQYA 4BDTB 1JE9A 1ZADA 1KBAA 3U73U 1FRAA 2JVEA 3NH7A 1IQ9A 2UX2A 2H7ZA 5DO6A 5EBXA 1ERAA 1KL8A 3BT2U 1REWC 1CODA 1LXHA 4RUDA 2MHYA 4LFTA 1CB9A 4BIKB 1UG4A 1ERGA 1KXIA 3FEVA 2CRSA 2H5FA 4P7UA 1COEA 1IDHA 2CTXA 1TXBA 1IDIA 1HC9A 3EBXA 5IMYC 1BXPA 2FD6U 3KFDE 1FFJA 1PLOA 2QC1A 1CCQA 1H0JA 2JQPA 1FSSB 2H62D 3NDSA 1G6MA 1XT3A 1KBSA 1RGJA 5DU1A 2BHIA 2ERAA 3QB4B 4FAOC 1KC4A 1I02A 2BTXA 1IKCA 2J8BA 4IYEA 4HQPF 4AEAA 1NTNA 1QKEA 1YWHA 1ONJA 5IMTD 2H7ZB 1NORA 1L4WA 2X8BB 6EBXA 1KFHA 3U74U 4EY8B 1LSIA 2MUOA 1NYSA 1JGKA 1CRFA 1CDTA 3LAQU 1CREA 4KSNA 1CHVS 3BT1U 2L03A 1FASA 2CCXA 1TFSA 1ES7B 1TXAA 1F8UB 1CDQA 2LA1A 1KTZB 3KFDI 1HC9B 4QTIU 1KU6B 1QKDA 4OM5A 2MJ0A 2NBTA 3VTSA 1FSCA 1TGXA 3HH7A 2MFAA 4XJJA 1LJZA 2L5SA 2MJYA 1VB0A 5DZ5A 2ABXA 2N99A 1RL5A 2OFSA 1JBDA 1F94A 2CDXA 2VLWA 2QJBC 4FAOE 1DRSA 2HLQA 3PLCA 1NXBA 1HAJA 1IDLA 2H8UA 2QJ9C 2QJAC 2H62C 1FF4A 2UWRA 2CRTA 2HLRA 1S4YA
chains in the Genus database with same CATH topology
1LXGA 1CDRA 4OM4A 3EVSC 1NTXA 1IJCA 2K3GA 1CXOA 4DO8A 2MJ4A 2MUPA 1B41B 1W6BA 2PJYC 2H64C 2PJYB 1CDSA 2H64B 3ERAA 1HOYA 1CXNA 1KS6A 1IDGA 1HAAA 1M9ZA 1V6PA 2LCRA 1ABTA 1NEAA 2I9BE 2GOOC 2GOOB 1CTXA 1IK8A 1KBTA 4UY2C 1NYUA 1MAHF 1BTEA 1LX5B 1MR6A 1QM7A 3NEQA 1CVOA 4ZQYA 4BDTB 1JE9A 1ZADA 1KBAA 3U73U 1FRAA 2JVEA 3NH7A 1IQ9A 2UX2A 2H7ZA 5DO6A 5EBXA 1ERAA 1KL8A 3BT2U 1REWC 1CODA 1LXHA 4RUDA 2MHYA 4LFTA 1CB9A 4BIKB 1UG4A 1ERGA 1KXIA 3FEVA 2CRSA 2H5FA 4P7UA 1COEA 1IDHA 2CTXA 1TXBA 1IDIA 1HC9A 3EBXA 5IMYC 1BXPA 2FD6U 3KFDE 1FFJA 1PLOA 2QC1A 1CCQA 1H0JA 2JQPA 1FSSB 2H62D 3NDSA 1G6MA 1XT3A 1KBSA 1RGJA 5DU1A 2BHIA 2ERAA 3QB4B 4FAOC 1KC4A 1I02A 2BTXA 1IKCA 2J8BA 4IYEA 4HQPF 4AEAA 1NTNA 1QKEA 1YWHA 1ONJA 5IMTD 2H7ZB 1NORA 1L4WA 2X8BB 6EBXA 1KFHA 3U74U 4EY8B 1LSIA 2MUOA 1NYSA 1JGKA 1CRFA 1CDTA 3LAQU 1CREA 4KSNA 1CHVS 3BT1U 2L03A 1FASA 2CCXA 1TFSA 1ES7B 1TXAA 1F8UB 1CDQA 2LA1A 1KTZB 3KFDI 1HC9B 4QTIU 1KU6B 1QKDA 4OM5A 2MJ0A 2NBTA 3VTSA 1FSCA 1TGXA 3HH7A 2MFAA 4XJJA 1LJZA 2L5SA 2MJYA 1VB0A 5DZ5A 2ABXA 2N99A 1RL5A 2OFSA 1JBDA 1F94A 2CDXA 2VLWA 2QJBC 4FAOE 1DRSA 2HLQA 3PLCA 1NXBA 1HAJA 1IDLA 2H8UA 2QJ9C 2QJAC 2H62C 1FF4A 2UWRA 2CRTA 2HLRA 1S4YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LXG A;  1CDR A;  4OM4 A;  3EVS C;  1NTX A;  1IJC A;  2K3G A;  1CXO A;  4DO8 A;  2MJ4 A;  2MUP A;  1B41 B;  1W6B A;  2PJY C;  2H64 C;  2PJY B;  1CDS A;  2H64 B;  3ERA A;  1HOY A;  1CXN A;  1KS6 A;  1IDG A;  1HAA A;  1M9Z A;  1V6P A;  2LCR A;  1ABT A;  1NEA A;  2I9B E;  2GOO C;  2GOO B;  1CTX A;  1IK8 A;  1KBT A;  4UY2 C;  1NYU A;  1MAH F;  1BTE A;  1LX5 B;  1MR6 A;  1QM7 A;  3NEQ A;  1CVO A;  4ZQY A;  4BDT B;  1JE9 A;  1ZAD A;  1KBA A;  3U73 U;  1FRA A;  2JVE A;  3NH7 A;  1IQ9 A;  2UX2 A;  2H7Z A;  5DO6 A;  5EBX A;  1ERA A;  1KL8 A;  3BT2 U;  1REW C;  1COD A;  1LXH A;  4RUD A;  2MHY A;  4LFT A;  1CB9 A;  4BIK B;  1UG4 A;  1ERG A;  1KXI A;  3FEV A;  2CRS A;  2H5F A;  4P7U A;  1COE A;  1IDH A;  2CTX A;  1TXB A;  1IDI A;  1HC9 A;  3EBX A;  5IMY C;  1BXP A;  2FD6 U;  3KFD E;  1FFJ A;  1PLO A;  2QC1 A;  1CCQ A;  1H0J A;  2JQP A;  1FSS B;  2H62 D;  3NDS A;  1G6M A;  1XT3 A;  1KBS A;  1RGJ A;  5DU1 A;  2BHI A;  2ERA A;  3QB4 B;  4FAO C;  1KC4 A;  1I02 A;  2BTX A;  1IKC A;  2J8B A;  4IYE A;  4HQP F;  4AEA A;  1NTN A;  1QKE A;  1YWH A;  1ONJ A;  5IMT D;  2H7Z B;  1NOR A;  1L4W A;  2X8B B;  6EBX A;  1KFH A;  3U74 U;  4EY8 B;  1LSI A;  2MUO A;  1NYS A;  1JGK A;  1CRF A;  1CDT A;  3LAQ U;  1CRE A;  1CHV S;  3BT1 U;  2L03 A;  1FAS A;  2CCX A;  1TFS A;  1ES7 B;  1TXA A;  1F8U B;  1CDQ A;  2LA1 A;  1KTZ B;  3KFD I;  1HC9 B;  4QTI U;  1KU6 B;  1QKD A;  4OM5 A;  2MJ0 A;  2NBT A;  3VTS A;  1FSC A;  1TGX A;  3HH7 A;  2MFA A;  4XJJ A;  1LJZ A;  2L5S A;  2MJY A;  1VB0 A;  5DZ5 A;  2ABX A;  2N99 A;  1RL5 A;  2OFS A;  1JBD A;  1F94 A;  2CDX A;  2VLW A;  2QJB C;  4FAO E;  1DRS A;  2HLQ A;  3PLC A;  1NXB A;  1HAJ A;  1IDL A;  2H8U A;  2QJ9 C;  2QJA C;  2H62 C;  1FF4 A;  2UWR A;  2CRT A;  2HLR A;  1S4Y A; 
#chains in the Genus database with same CATH topology
 1LXG A;  1CDR A;  4OM4 A;  3EVS C;  1NTX A;  1IJC A;  2K3G A;  1CXO A;  4DO8 A;  2MJ4 A;  2MUP A;  1B41 B;  1W6B A;  2PJY C;  2H64 C;  2PJY B;  1CDS A;  2H64 B;  3ERA A;  1HOY A;  1CXN A;  1KS6 A;  1IDG A;  1HAA A;  1M9Z A;  1V6P A;  2LCR A;  1ABT A;  1NEA A;  2I9B E;  2GOO C;  2GOO B;  1CTX A;  1IK8 A;  1KBT A;  4UY2 C;  1NYU A;  1MAH F;  1BTE A;  1LX5 B;  1MR6 A;  1QM7 A;  3NEQ A;  1CVO A;  4ZQY A;  4BDT B;  1JE9 A;  1ZAD A;  1KBA A;  3U73 U;  1FRA A;  2JVE A;  3NH7 A;  1IQ9 A;  2UX2 A;  2H7Z A;  5DO6 A;  5EBX A;  1ERA A;  1KL8 A;  3BT2 U;  1REW C;  1COD A;  1LXH A;  4RUD A;  2MHY A;  4LFT A;  1CB9 A;  4BIK B;  1UG4 A;  1ERG A;  1KXI A;  3FEV A;  2CRS A;  2H5F A;  4P7U A;  1COE A;  1IDH A;  2CTX A;  1TXB A;  1IDI A;  1HC9 A;  3EBX A;  5IMY C;  1BXP A;  2FD6 U;  3KFD E;  1FFJ A;  1PLO A;  2QC1 A;  1CCQ A;  1H0J A;  2JQP A;  1FSS B;  2H62 D;  3NDS A;  1G6M A;  1XT3 A;  1KBS A;  1RGJ A;  5DU1 A;  2BHI A;  2ERA A;  3QB4 B;  4FAO C;  1KC4 A;  1I02 A;  2BTX A;  1IKC A;  2J8B A;  4IYE A;  4HQP F;  4AEA A;  1NTN A;  1QKE A;  1YWH A;  1ONJ A;  5IMT D;  2H7Z B;  1NOR A;  1L4W A;  2X8B B;  6EBX A;  1KFH A;  3U74 U;  4EY8 B;  1LSI A;  2MUO A;  1NYS A;  1JGK A;  1CRF A;  1CDT A;  3LAQ U;  1CRE A;  4KSN A;  1CHV S;  3BT1 U;  2L03 A;  1FAS A;  2CCX A;  1TFS A;  1ES7 B;  1TXA A;  1F8U B;  1CDQ A;  2LA1 A;  1KTZ B;  3KFD I;  1HC9 B;  4QTI U;  1KU6 B;  1QKD A;  4OM5 A;  2MJ0 A;  2NBT A;  3VTS A;  1FSC A;  1TGX A;  3HH7 A;  2MFA A;  4XJJ A;  1LJZ A;  2L5S A;  2MJY A;  1VB0 A;  5DZ5 A;  2ABX A;  2N99 A;  1RL5 A;  2OFS A;  1JBD A;  1F94 A;  2CDX A;  2VLW A;  2QJB C;  4FAO E;  1DRS A;  2HLQ A;  3PLC A;  1NXB A;  1HAJ A;  1IDL A;  2H8U A;  2QJ9 C;  2QJA C;  2H62 C;  1FF4 A;  2UWR A;  2CRT A;  2HLR A;  1S4Y A; 
#chains in the Genus database with same CATH homology
 1LXG A;  1CDR A;  4OM4 A;  3EVS C;  1NTX A;  1IJC A;  2K3G A;  1CXO A;  4DO8 A;  2MJ4 A;  2MUP A;  1B41 B;  1W6B A;  2PJY C;  2H64 C;  2PJY B;  1CDS A;  2H64 B;  3ERA A;  1HOY A;  1CXN A;  1KS6 A;  1IDG A;  1HAA A;  1M9Z A;  1V6P A;  2LCR A;  1ABT A;  1NEA A;  2I9B E;  2GOO C;  2GOO B;  1CTX A;  1IK8 A;  1KBT A;  4UY2 C;  1NYU A;  1MAH F;  1BTE A;  1LX5 B;  1MR6 A;  1QM7 A;  3NEQ A;  1CVO A;  4ZQY A;  4BDT B;  1JE9 A;  1ZAD A;  1KBA A;  3U73 U;  1FRA A;  2JVE A;  3NH7 A;  1IQ9 A;  2UX2 A;  2H7Z A;  5DO6 A;  5EBX A;  1ERA A;  1KL8 A;  3BT2 U;  1REW C;  1COD A;  1LXH A;  4RUD A;  2MHY A;  4LFT A;  1CB9 A;  4BIK B;  1UG4 A;  1ERG A;  1KXI A;  3FEV A;  2CRS A;  2H5F A;  4P7U A;  1COE A;  1IDH A;  2CTX A;  1TXB A;  1IDI A;  1HC9 A;  3EBX A;  5IMY C;  1BXP A;  2FD6 U;  3KFD E;  1FFJ A;  1PLO A;  2QC1 A;  1CCQ A;  1H0J A;  2JQP A;  1FSS B;  2H62 D;  3NDS A;  1G6M A;  1XT3 A;  1KBS A;  1RGJ A;  5DU1 A;  2BHI A;  2ERA A;  3QB4 B;  4FAO C;  1KC4 A;  1I02 A;  2BTX A;  1IKC A;  2J8B A;  4IYE A;  4HQP F;  4AEA A;  1NTN A;  1QKE A;  1YWH A;  1ONJ A;  5IMT D;  2H7Z B;  1NOR A;  1L4W A;  2X8B B;  6EBX A;  1KFH A;  3U74 U;  4EY8 B;  1LSI A;  2MUO A;  1NYS A;  1JGK A;  1CRF A;  1CDT A;  3LAQ U;  1CRE A;  4KSN A;  1CHV S;  3BT1 U;  2L03 A;  1FAS A;  2CCX A;  1TFS A;  1ES7 B;  1TXA A;  1F8U B;  1CDQ A;  2LA1 A;  1KTZ B;  3KFD I;  1HC9 B;  4QTI U;  1KU6 B;  1QKD A;  4OM5 A;  2MJ0 A;  2NBT A;  3VTS A;  1FSC A;  1TGX A;  3HH7 A;  2MFA A;  4XJJ A;  1LJZ A;  2L5S A;  2MJY A;  1VB0 A;  5DZ5 A;  2ABX A;  2N99 A;  1RL5 A;  2OFS A;  1JBD A;  1F94 A;  2CDX A;  2VLW A;  2QJB C;  4FAO E;  1DRS A;  2HLQ A;  3PLC A;  1NXB A;  1HAJ A;  1IDL A;  2H8U A;  2QJ9 C;  2QJA C;  2H62 C;  1FF4 A;  2UWR A;  2CRT A;  2HLR A;  1S4Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...