1HC9B

Alpha-bungarotoxin complexed with high affinity peptide
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
74
structure length
74
Chain Sequence
IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-BUNGAROTOXIN ISOFORM V31
publication title The Binding Site of Acetylcholine Receptor as Visualized in the X-Ray Structure of a Complex between Alpha-Bungarotoxin and a Mimotope Peptide.
pubmed doi rcsb
molecule tags Toxin/peptide
total genus 11
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2001-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1hc9B00
2H62C 2MJ0A 2JVEA 1IQ9A 3KFDI 1F94A 1IK8A 1NORA 2MJYA 5EBXA 1CDRA 1KBTA 1FRAA 1HOYA 1B41B 4DO8A 5DO6A 1CB9A 2H62D 4RUDA 1MAHF 1NYSA 1CDTA 1CVOA 3FEVA 2MUPA 2HLRA 1TXAA 2CRTA 2H5FA 3LAQU 2QJ9C 4BDTB 2H7ZA 1ZADA 2K3GA 1JGKA 2LCRA 1RGJA 2BHIA 1HC9B 2MFAA 4OM5A 2H64C 2FD6U 1ABTA 4OM4A 1CRFA 1MR6A 2QC1A 1KC4A 3NEQA 1DRSA 2CTXA 1KTZB 1QKDA 4AEAA 2QJAC 1KXIA 1ONJA 1FSSB 1HAJA 2MUOA 3EBXA 1ERAA 1CODA 2UWRA 4ZQYA 1IDLA 2L5SA 5DU1A 1CXOA 1S4YA 1JE9A 3ERAA 2LA1A 2OFSA 1CDSA 2N99A 2CDXA 1FSCA 1KS6A 4QTIU 1NXBA 1RL5A 1KU6B 2MJ4A 1I02A 1F8UB 1HC9A 4XJJA 3KFDE 1LXGA 3NDSA 2HLQA 4P7UA 1HAAA 1TXBA 2CCXA 2GOOC 3QB4B 3HH7A 2H64B 4LFTA 1TFSA 2QJBC 4EY8B 1CHVS 1CTXA 2PJYC 2X8BB 1VB0A 1IDIA 3NH7A 1L4WA 3U74U 1H0JA 4BIKB 1LSIA 1UG4A 1FASA 1XT3A 1KL8A 2I9BE 2UX2A 4HQPF 1JBDA 2NBTA 2PJYB 4UY2C 1W6BA 4FAOC 1FFJA 1IDGA 2ERAA 2H8UA 3EVSC 5IMTD 1PLOA 1QM7A 2ABXA 1KFHA 1KBSA 1V6PA 2VLWA 2L03A 1QKEA 2MHYA 1REWC 5IMYC 1IKCA 1ERGA 3PLCA 1CDQA 3U73U 1TGXA 4FAOE 1IDHA 2J8BA 1NTXA 1G6MA 1KBAA 1LJZA 1BTEA 2H7ZB 6EBXA 1COEA 2GOOB 1YWHA 1NYUA 1LXHA 1ES7B 3BT2U 1CCQA 1LX5B 5DZ5A 1NTNA 1NEAA 2JQPA 3VTSA 3BT1U 1FF4A 2BTXA 1CXNA 1M9ZA 1BXPA 1CREA 4IYEA 1IJCA 2CRSA
chains in the Genus database with same CATH superfamily
2H62C 2MJ0A 2JVEA 1IQ9A 3KFDI 1F94A 1IK8A 1NORA 2MJYA 5EBXA 1CDRA 1KBTA 1FRAA 1HOYA 1B41B 4DO8A 5DO6A 1CB9A 2H62D 4RUDA 1MAHF 1NYSA 1CDTA 1CVOA 3FEVA 2MUPA 2HLRA 1TXAA 2CRTA 2H5FA 3LAQU 2QJ9C 4BDTB 2H7ZA 1ZADA 2K3GA 1JGKA 2LCRA 1RGJA 2BHIA 1HC9B 2MFAA 4OM5A 2H64C 2FD6U 1ABTA 4OM4A 1CRFA 1MR6A 2QC1A 1KC4A 3NEQA 1DRSA 2CTXA 1KTZB 1QKDA 4AEAA 2QJAC 1KXIA 1ONJA 1FSSB 1HAJA 2MUOA 3EBXA 1ERAA 1CODA 2UWRA 4ZQYA 1IDLA 4KSNA 2L5SA 5DU1A 1CXOA 1S4YA 1JE9A 3ERAA 2LA1A 2OFSA 1CDSA 2N99A 2CDXA 1FSCA 1KS6A 4QTIU 1NXBA 1RL5A 1KU6B 2MJ4A 1I02A 1F8UB 1HC9A 4XJJA 3KFDE 1LXGA 3NDSA 2HLQA 4P7UA 1HAAA 1TXBA 2CCXA 2GOOC 3QB4B 3HH7A 2H64B 4LFTA 1TFSA 2QJBC 4EY8B 1CHVS 1CTXA 2PJYC 2X8BB 1VB0A 1IDIA 3NH7A 1L4WA 3U74U 1H0JA 4BIKB 1LSIA 1UG4A 1FASA 1XT3A 1KL8A 2I9BE 2UX2A 4HQPF 1JBDA 2NBTA 2PJYB 4UY2C 1W6BA 4FAOC 1FFJA 1IDGA 2ERAA 2H8UA 3EVSC 5IMTD 1PLOA 1QM7A 2ABXA 1KFHA 1KBSA 1V6PA 2VLWA 2L03A 1QKEA 2MHYA 1REWC 5IMYC 1IKCA 1ERGA 3PLCA 1CDQA 3U73U 1TGXA 4FAOE 1IDHA 2J8BA 1NTXA 1G6MA 1KBAA 1LJZA 1BTEA 2H7ZB 6EBXA 1COEA 2GOOB 1YWHA 1NYUA 1LXHA 1ES7B 3BT2U 1CCQA 1LX5B 5DZ5A 1NTNA 1NEAA 2JQPA 3VTSA 3BT1U 1FF4A 2BTXA 1CXNA 1M9ZA 1BXPA 1CREA 4IYEA 1IJCA 2CRSA
chains in the Genus database with same CATH topology
2H62C 2MJ0A 2JVEA 1IQ9A 3KFDI 1F94A 1IK8A 1NORA 2MJYA 5EBXA 1CDRA 1KBTA 1FRAA 1HOYA 1B41B 4DO8A 5DO6A 1CB9A 2H62D 4RUDA 1MAHF 1NYSA 1CDTA 1CVOA 3FEVA 2MUPA 2HLRA 1TXAA 2CRTA 2H5FA 3LAQU 2QJ9C 4BDTB 2H7ZA 1ZADA 2K3GA 1JGKA 2LCRA 1RGJA 2BHIA 1HC9B 2MFAA 4OM5A 2H64C 2FD6U 1ABTA 4OM4A 1CRFA 1MR6A 2QC1A 1KC4A 3NEQA 1DRSA 2CTXA 1KTZB 1QKDA 4AEAA 2QJAC 1KXIA 1ONJA 1FSSB 1HAJA 2MUOA 3EBXA 1ERAA 1CODA 2UWRA 4ZQYA 1IDLA 4KSNA 2L5SA 5DU1A 1CXOA 1S4YA 1JE9A 3ERAA 2LA1A 2OFSA 1CDSA 2N99A 2CDXA 1FSCA 1KS6A 4QTIU 1NXBA 1RL5A 1KU6B 2MJ4A 1I02A 1F8UB 1HC9A 4XJJA 3KFDE 1LXGA 3NDSA 2HLQA 4P7UA 1HAAA 1TXBA 2CCXA 2GOOC 3QB4B 3HH7A 2H64B 4LFTA 1TFSA 2QJBC 4EY8B 1CHVS 1CTXA 2PJYC 2X8BB 1VB0A 1IDIA 3NH7A 1L4WA 3U74U 1H0JA 4BIKB 1LSIA 1UG4A 1FASA 1XT3A 1KL8A 2I9BE 2UX2A 4HQPF 1JBDA 2NBTA 2PJYB 4UY2C 1W6BA 4FAOC 1FFJA 1IDGA 2ERAA 2H8UA 3EVSC 5IMTD 1PLOA 1QM7A 2ABXA 1KFHA 1KBSA 1V6PA 2VLWA 2L03A 1QKEA 2MHYA 1REWC 5IMYC 1IKCA 1ERGA 3PLCA 1CDQA 3U73U 1TGXA 4FAOE 1IDHA 2J8BA 1NTXA 1G6MA 1KBAA 1LJZA 1BTEA 2H7ZB 6EBXA 1COEA 2GOOB 1YWHA 1NYUA 1LXHA 1ES7B 3BT2U 1CCQA 1LX5B 5DZ5A 1NTNA 1NEAA 2JQPA 3VTSA 3BT1U 1FF4A 2BTXA 1CXNA 1M9ZA 1BXPA 1CREA 4IYEA 1IJCA 2CRSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H62 C;  2MJ0 A;  2JVE A;  1IQ9 A;  3KFD I;  1F94 A;  1IK8 A;  1NOR A;  2MJY A;  5EBX A;  1CDR A;  1KBT A;  1FRA A;  1HOY A;  1B41 B;  4DO8 A;  5DO6 A;  1CB9 A;  2H62 D;  4RUD A;  1MAH F;  1NYS A;  1CDT A;  1CVO A;  3FEV A;  2MUP A;  2HLR A;  1TXA A;  2CRT A;  2H5F A;  3LAQ U;  2QJ9 C;  4BDT B;  2H7Z A;  1ZAD A;  2K3G A;  1JGK A;  2LCR A;  1RGJ A;  2BHI A;  1HC9 B;  2MFA A;  4OM5 A;  2H64 C;  2FD6 U;  1ABT A;  4OM4 A;  1CRF A;  1MR6 A;  2QC1 A;  1KC4 A;  3NEQ A;  1DRS A;  2CTX A;  1KTZ B;  1QKD A;  4AEA A;  2QJA C;  1KXI A;  1ONJ A;  1FSS B;  1HAJ A;  2MUO A;  3EBX A;  1ERA A;  1COD A;  2UWR A;  4ZQY A;  1IDL A;  2L5S A;  5DU1 A;  1CXO A;  1S4Y A;  1JE9 A;  3ERA A;  2LA1 A;  2OFS A;  1CDS A;  2N99 A;  2CDX A;  1FSC A;  1KS6 A;  4QTI U;  1NXB A;  1RL5 A;  1KU6 B;  2MJ4 A;  1I02 A;  1F8U B;  1HC9 A;  4XJJ A;  3KFD E;  1LXG A;  3NDS A;  2HLQ A;  4P7U A;  1HAA A;  1TXB A;  2CCX A;  2GOO C;  3QB4 B;  3HH7 A;  2H64 B;  4LFT A;  1TFS A;  2QJB C;  4EY8 B;  1CHV S;  1CTX A;  2PJY C;  2X8B B;  1VB0 A;  1IDI A;  3NH7 A;  1L4W A;  3U74 U;  1H0J A;  4BIK B;  1LSI A;  1UG4 A;  1FAS A;  1XT3 A;  1KL8 A;  2I9B E;  2UX2 A;  4HQP F;  1JBD A;  2NBT A;  2PJY B;  4UY2 C;  1W6B A;  4FAO C;  1FFJ A;  1IDG A;  2ERA A;  2H8U A;  3EVS C;  5IMT D;  1PLO A;  1QM7 A;  2ABX A;  1KFH A;  1KBS A;  1V6P A;  2VLW A;  2L03 A;  1QKE A;  2MHY A;  1REW C;  5IMY C;  1IKC A;  1ERG A;  3PLC A;  1CDQ A;  3U73 U;  1TGX A;  4FAO E;  1IDH A;  2J8B A;  1NTX A;  1G6M A;  1KBA A;  1LJZ A;  1BTE A;  2H7Z B;  6EBX A;  1COE A;  2GOO B;  1YWH A;  1NYU A;  1LXH A;  1ES7 B;  3BT2 U;  1CCQ A;  1LX5 B;  5DZ5 A;  1NTN A;  1NEA A;  2JQP A;  3VTS A;  3BT1 U;  1FF4 A;  2BTX A;  1CXN A;  1M9Z A;  1BXP A;  1CRE A;  4IYE A;  1IJC A;  2CRS A; 
#chains in the Genus database with same CATH topology
 2H62 C;  2MJ0 A;  2JVE A;  1IQ9 A;  3KFD I;  1F94 A;  1IK8 A;  1NOR A;  2MJY A;  5EBX A;  1CDR A;  1KBT A;  1FRA A;  1HOY A;  1B41 B;  4DO8 A;  5DO6 A;  1CB9 A;  2H62 D;  4RUD A;  1MAH F;  1NYS A;  1CDT A;  1CVO A;  3FEV A;  2MUP A;  2HLR A;  1TXA A;  2CRT A;  2H5F A;  3LAQ U;  2QJ9 C;  4BDT B;  2H7Z A;  1ZAD A;  2K3G A;  1JGK A;  2LCR A;  1RGJ A;  2BHI A;  1HC9 B;  2MFA A;  4OM5 A;  2H64 C;  2FD6 U;  1ABT A;  4OM4 A;  1CRF A;  1MR6 A;  2QC1 A;  1KC4 A;  3NEQ A;  1DRS A;  2CTX A;  1KTZ B;  1QKD A;  4AEA A;  2QJA C;  1KXI A;  1ONJ A;  1FSS B;  1HAJ A;  2MUO A;  3EBX A;  1ERA A;  1COD A;  2UWR A;  4ZQY A;  1IDL A;  4KSN A;  2L5S A;  5DU1 A;  1CXO A;  1S4Y A;  1JE9 A;  3ERA A;  2LA1 A;  2OFS A;  1CDS A;  2N99 A;  2CDX A;  1FSC A;  1KS6 A;  4QTI U;  1NXB A;  1RL5 A;  1KU6 B;  2MJ4 A;  1I02 A;  1F8U B;  1HC9 A;  4XJJ A;  3KFD E;  1LXG A;  3NDS A;  2HLQ A;  4P7U A;  1HAA A;  1TXB A;  2CCX A;  2GOO C;  3QB4 B;  3HH7 A;  2H64 B;  4LFT A;  1TFS A;  2QJB C;  4EY8 B;  1CHV S;  1CTX A;  2PJY C;  2X8B B;  1VB0 A;  1IDI A;  3NH7 A;  1L4W A;  3U74 U;  1H0J A;  4BIK B;  1LSI A;  1UG4 A;  1FAS A;  1XT3 A;  1KL8 A;  2I9B E;  2UX2 A;  4HQP F;  1JBD A;  2NBT A;  2PJY B;  4UY2 C;  1W6B A;  4FAO C;  1FFJ A;  1IDG A;  2ERA A;  2H8U A;  3EVS C;  5IMT D;  1PLO A;  1QM7 A;  2ABX A;  1KFH A;  1KBS A;  1V6P A;  2VLW A;  2L03 A;  1QKE A;  2MHY A;  1REW C;  5IMY C;  1IKC A;  1ERG A;  3PLC A;  1CDQ A;  3U73 U;  1TGX A;  4FAO E;  1IDH A;  2J8B A;  1NTX A;  1G6M A;  1KBA A;  1LJZ A;  1BTE A;  2H7Z B;  6EBX A;  1COE A;  2GOO B;  1YWH A;  1NYU A;  1LXH A;  1ES7 B;  3BT2 U;  1CCQ A;  1LX5 B;  5DZ5 A;  1NTN A;  1NEA A;  2JQP A;  3VTS A;  3BT1 U;  1FF4 A;  2BTX A;  1CXN A;  1M9Z A;  1BXP A;  1CRE A;  4IYE A;  1IJC A;  2CRS A; 
#chains in the Genus database with same CATH homology
 2H62 C;  2MJ0 A;  2JVE A;  1IQ9 A;  3KFD I;  1F94 A;  1IK8 A;  1NOR A;  2MJY A;  5EBX A;  1CDR A;  1KBT A;  1FRA A;  1HOY A;  1B41 B;  4DO8 A;  5DO6 A;  1CB9 A;  2H62 D;  4RUD A;  1MAH F;  1NYS A;  1CDT A;  1CVO A;  3FEV A;  2MUP A;  2HLR A;  1TXA A;  2CRT A;  2H5F A;  3LAQ U;  2QJ9 C;  4BDT B;  2H7Z A;  1ZAD A;  2K3G A;  1JGK A;  2LCR A;  1RGJ A;  2BHI A;  1HC9 B;  2MFA A;  4OM5 A;  2H64 C;  2FD6 U;  1ABT A;  4OM4 A;  1CRF A;  1MR6 A;  2QC1 A;  1KC4 A;  3NEQ A;  1DRS A;  2CTX A;  1KTZ B;  1QKD A;  4AEA A;  2QJA C;  1KXI A;  1ONJ A;  1FSS B;  1HAJ A;  2MUO A;  3EBX A;  1ERA A;  1COD A;  2UWR A;  4ZQY A;  1IDL A;  4KSN A;  2L5S A;  5DU1 A;  1CXO A;  1S4Y A;  1JE9 A;  3ERA A;  2LA1 A;  2OFS A;  1CDS A;  2N99 A;  2CDX A;  1FSC A;  1KS6 A;  4QTI U;  1NXB A;  1RL5 A;  1KU6 B;  2MJ4 A;  1I02 A;  1F8U B;  1HC9 A;  4XJJ A;  3KFD E;  1LXG A;  3NDS A;  2HLQ A;  4P7U A;  1HAA A;  1TXB A;  2CCX A;  2GOO C;  3QB4 B;  3HH7 A;  2H64 B;  4LFT A;  1TFS A;  2QJB C;  4EY8 B;  1CHV S;  1CTX A;  2PJY C;  2X8B B;  1VB0 A;  1IDI A;  3NH7 A;  1L4W A;  3U74 U;  1H0J A;  4BIK B;  1LSI A;  1UG4 A;  1FAS A;  1XT3 A;  1KL8 A;  2I9B E;  2UX2 A;  4HQP F;  1JBD A;  2NBT A;  2PJY B;  4UY2 C;  1W6B A;  4FAO C;  1FFJ A;  1IDG A;  2ERA A;  2H8U A;  3EVS C;  5IMT D;  1PLO A;  1QM7 A;  2ABX A;  1KFH A;  1KBS A;  1V6P A;  2VLW A;  2L03 A;  1QKE A;  2MHY A;  1REW C;  5IMY C;  1IKC A;  1ERG A;  3PLC A;  1CDQ A;  3U73 U;  1TGX A;  4FAO E;  1IDH A;  2J8B A;  1NTX A;  1G6M A;  1KBA A;  1LJZ A;  1BTE A;  2H7Z B;  6EBX A;  1COE A;  2GOO B;  1YWH A;  1NYU A;  1LXH A;  1ES7 B;  3BT2 U;  1CCQ A;  1LX5 B;  5DZ5 A;  1NTN A;  1NEA A;  2JQP A;  3VTS A;  3BT1 U;  1FF4 A;  2BTX A;  1CXN A;  1M9Z A;  1BXP A;  1CRE A;  4IYE A;  1IJC A;  2CRS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...