2VLWA

Crystal structure of the muscarinic toxin mt7 diiodotyr51 derivative.
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
65
structure length
64
Chain Sequence
b'LTCVKSNSIWFPTSEDCPDGQNLCFKRWQYISPRMYDFTRGCAATCPKAERDVINCCGTDKCNK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Different Interactions between Mt7 Toxin and the Human Muscarinic M1 Receptor in its Free and N-Methylscopolamine-Occupied States.
pubmed doi rcsb
molecule keywords MUSCARINIC M1-TOXIN1
molecule tags Toxin
total genus 8
structure length 64
sequence length 65
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2vlwA00
2MHYA 2OFSA 5DU1A 1KFHA 1NYSA 1FFJA 1NXBA 1KS6A 1QKEA 5IMYC 1NTXA 2H64B 1NTNA 2MJYA 1IDLA 2H7ZA 1KBAA 2CTXA 2CRSA 3U74U 1JBDA 3VTSA 1KXIA 2HLRA 3NDSA 1CDSA 1CXOA 2NBTA 1ONJA 2VLWA 4OM4A 1NYUA 1HC9B 1CODA 3BT1U 2LCRA 2H62D 4ZQYA 1CB9A 4HQPF 2PJYB 4BDTB 1H0JA 1KTZB 3ERAA 1NEAA 3HH7A 2J8BA 4LFTA 2K3GA 1IK8A 1LJZA 2H64C 4DO8A 1IJCA 4IYEA 1KC4A 1PLOA 2BTXA 2GOOC 1JE9A 1KBTA 1W6BA 2I9BE 1S4YA 1I02A 3EVSC 1ABTA 1MR6A 1FRAA 2MFAA 1FSCA 2ERAA 1TXAA 1IQ9A 4UY2C 2MUOA 2QJAC 1RL5A 3KFDE 2H5FA 1BXPA 1CXNA 1KU6B 4FAOC 1B41B 5DO6A 1XT3A 3FEVA 5DZ5A 3EBXA 2L03A 2CDXA 1IDGA 1CDRA 1HOYA 4RUDA 3U73U 2H8UA 1IDHA 2H7ZB 1LXHA 1ERGA 1ZADA 2UWRA 1LXGA 1TGXA 4AEAA 1QM7A 2MJ4A 2JQPA 2CCXA 2H62C 4XJJA 3NEQA 6EBXA 1V6PA 1BTEA 5IMTD 1LX5B 2FD6U 2LA1A 3LAQU 4P7UA 1KL8A 1M9ZA 2PJYC 1QKDA 1HC9A 2BHIA 2QJBC 3QB4B 1CRFA 1VB0A 2MUPA 2UX2A 1FASA 2JVEA 1F8UB 2QC1A 1ERAA 1YWHA 1CVOA 4FAOE 2CRTA 1ES7B 2X8BB 1KBSA 1FSSB 1F94A 1IKCA 1COEA 1TFSA 2GOOB 1CREA 3KFDI 1LSIA 1CDTA 1CHVS 4OM5A 4QTIU 5EBXA 1JGKA 1DRSA 1HAAA 2L5SA 1REWC 1L4WA 2HLQA 1G6MA 1MAHF 2ABXA 2QJ9C 1RGJA 1TXBA 2MJ0A 3BT2U 4BIKB 1CDQA 1CTXA 1IDIA 1UG4A 2N99A 1CCQA 1FF4A 4EY8B 3PLCA 1HAJA 1NORA 3NH7A
chains in the Genus database with same CATH superfamily
2MHYA 2OFSA 5DU1A 1KFHA 1NYSA 1FFJA 1NXBA 1KS6A 1QKEA 5IMYC 1NTXA 2H64B 1NTNA 2MJYA 1IDLA 2H7ZA 1KBAA 2CTXA 2CRSA 3U74U 1JBDA 3VTSA 1KXIA 2HLRA 3NDSA 1CDSA 1CXOA 2NBTA 1ONJA 2VLWA 4OM4A 1NYUA 1HC9B 1CODA 3BT1U 2LCRA 2H62D 4ZQYA 1CB9A 4HQPF 2PJYB 4BDTB 1H0JA 1KTZB 3ERAA 1NEAA 3HH7A 2J8BA 4LFTA 2K3GA 1IK8A 1LJZA 2H64C 4DO8A 1IJCA 4IYEA 1KC4A 1PLOA 2BTXA 2GOOC 1JE9A 1KBTA 1W6BA 2I9BE 1S4YA 1I02A 4KSNA 3EVSC 1ABTA 1MR6A 1FRAA 2MFAA 1FSCA 2ERAA 1TXAA 1IQ9A 4UY2C 2MUOA 2QJAC 1RL5A 3KFDE 2H5FA 1BXPA 1CXNA 1KU6B 4FAOC 1B41B 5DO6A 1XT3A 3FEVA 5DZ5A 3EBXA 2L03A 2CDXA 1IDGA 1CDRA 1HOYA 4RUDA 3U73U 2H8UA 1IDHA 2H7ZB 1LXHA 1ERGA 1ZADA 2UWRA 1LXGA 1TGXA 4AEAA 1QM7A 2MJ4A 2JQPA 2CCXA 2H62C 4XJJA 3NEQA 6EBXA 1V6PA 1BTEA 5IMTD 1LX5B 2FD6U 2LA1A 3LAQU 4P7UA 1KL8A 1M9ZA 2PJYC 1QKDA 1HC9A 2BHIA 2QJBC 3QB4B 1CRFA 1VB0A 2MUPA 2UX2A 1FASA 2JVEA 1F8UB 2QC1A 1ERAA 1YWHA 1CVOA 4FAOE 2CRTA 1ES7B 2X8BB 1KBSA 1FSSB 1F94A 1IKCA 1COEA 1TFSA 2GOOB 1CREA 3KFDI 1LSIA 1CDTA 1CHVS 4OM5A 4QTIU 5EBXA 1JGKA 1DRSA 1HAAA 2L5SA 1REWC 1L4WA 2HLQA 1G6MA 1MAHF 2ABXA 2QJ9C 1RGJA 1TXBA 2MJ0A 3BT2U 4BIKB 1CDQA 1CTXA 1IDIA 1UG4A 2N99A 1CCQA 1FF4A 4EY8B 3PLCA 1HAJA 1NORA 3NH7A
chains in the Genus database with same CATH topology
2MHYA 2OFSA 5DU1A 1KFHA 1NYSA 1FFJA 1NXBA 1KS6A 1QKEA 5IMYC 1NTXA 2H64B 1NTNA 2MJYA 1IDLA 2H7ZA 1KBAA 2CTXA 2CRSA 3U74U 1JBDA 3VTSA 1KXIA 2HLRA 3NDSA 1CDSA 1CXOA 2NBTA 1ONJA 2VLWA 4OM4A 1NYUA 1HC9B 1CODA 3BT1U 2LCRA 2H62D 4ZQYA 1CB9A 4HQPF 2PJYB 4BDTB 1H0JA 1KTZB 3ERAA 1NEAA 3HH7A 2J8BA 4LFTA 2K3GA 1IK8A 1LJZA 2H64C 4DO8A 1IJCA 4IYEA 1KC4A 1PLOA 2BTXA 2GOOC 1JE9A 1KBTA 1W6BA 2I9BE 1S4YA 1I02A 4KSNA 3EVSC 1ABTA 1MR6A 1FRAA 2MFAA 1FSCA 2ERAA 1TXAA 1IQ9A 4UY2C 2MUOA 2QJAC 1RL5A 3KFDE 2H5FA 1BXPA 1CXNA 1KU6B 4FAOC 1B41B 5DO6A 1XT3A 3FEVA 5DZ5A 3EBXA 2L03A 2CDXA 1IDGA 1CDRA 1HOYA 4RUDA 3U73U 2H8UA 1IDHA 2H7ZB 1LXHA 1ERGA 1ZADA 2UWRA 1LXGA 1TGXA 4AEAA 1QM7A 2MJ4A 2JQPA 2CCXA 2H62C 4XJJA 3NEQA 6EBXA 1V6PA 1BTEA 5IMTD 1LX5B 2FD6U 2LA1A 3LAQU 4P7UA 1KL8A 1M9ZA 2PJYC 1QKDA 1HC9A 2BHIA 2QJBC 3QB4B 1CRFA 1VB0A 2MUPA 2UX2A 1FASA 2JVEA 1F8UB 2QC1A 1ERAA 1YWHA 1CVOA 4FAOE 2CRTA 1ES7B 2X8BB 1KBSA 1FSSB 1F94A 1IKCA 1COEA 1TFSA 2GOOB 1CREA 3KFDI 1LSIA 1CDTA 1CHVS 4OM5A 4QTIU 5EBXA 1JGKA 1DRSA 1HAAA 2L5SA 1REWC 1L4WA 2HLQA 1G6MA 1MAHF 2ABXA 2QJ9C 1RGJA 1TXBA 2MJ0A 3BT2U 4BIKB 1CDQA 1CTXA 1IDIA 1UG4A 2N99A 1CCQA 1FF4A 4EY8B 3PLCA 1HAJA 1NORA 3NH7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MHY A;  2OFS A;  5DU1 A;  1KFH A;  1NYS A;  1FFJ A;  1NXB A;  1KS6 A;  1QKE A;  5IMY C;  1NTX A;  2H64 B;  1NTN A;  2MJY A;  1IDL A;  2H7Z A;  1KBA A;  2CTX A;  2CRS A;  3U74 U;  1JBD A;  3VTS A;  1KXI A;  2HLR A;  3NDS A;  1CDS A;  1CXO A;  2NBT A;  1ONJ A;  2VLW A;  4OM4 A;  1NYU A;  1HC9 B;  1COD A;  3BT1 U;  2LCR A;  2H62 D;  4ZQY A;  1CB9 A;  4HQP F;  2PJY B;  4BDT B;  1H0J A;  1KTZ B;  3ERA A;  1NEA A;  3HH7 A;  2J8B A;  4LFT A;  2K3G A;  1IK8 A;  1LJZ A;  2H64 C;  4DO8 A;  1IJC A;  4IYE A;  1KC4 A;  1PLO A;  2BTX A;  2GOO C;  1JE9 A;  1KBT A;  1W6B A;  2I9B E;  1S4Y A;  1I02 A;  3EVS C;  1ABT A;  1MR6 A;  1FRA A;  2MFA A;  1FSC A;  2ERA A;  1TXA A;  1IQ9 A;  4UY2 C;  2MUO A;  2QJA C;  1RL5 A;  3KFD E;  2H5F A;  1BXP A;  1CXN A;  1KU6 B;  4FAO C;  1B41 B;  5DO6 A;  1XT3 A;  3FEV A;  5DZ5 A;  3EBX A;  2L03 A;  2CDX A;  1IDG A;  1CDR A;  1HOY A;  4RUD A;  3U73 U;  2H8U A;  1IDH A;  2H7Z B;  1LXH A;  1ERG A;  1ZAD A;  2UWR A;  1LXG A;  1TGX A;  4AEA A;  1QM7 A;  2MJ4 A;  2JQP A;  2CCX A;  2H62 C;  4XJJ A;  3NEQ A;  6EBX A;  1V6P A;  1BTE A;  5IMT D;  1LX5 B;  2FD6 U;  2LA1 A;  3LAQ U;  4P7U A;  1KL8 A;  1M9Z A;  2PJY C;  1QKD A;  1HC9 A;  2BHI A;  2QJB C;  3QB4 B;  1CRF A;  1VB0 A;  2MUP A;  2UX2 A;  1FAS A;  2JVE A;  1F8U B;  2QC1 A;  1ERA A;  1YWH A;  1CVO A;  4FAO E;  2CRT A;  1ES7 B;  2X8B B;  1KBS A;  1FSS B;  1F94 A;  1IKC A;  1COE A;  1TFS A;  2GOO B;  1CRE A;  3KFD I;  1LSI A;  1CDT A;  1CHV S;  4OM5 A;  4QTI U;  5EBX A;  1JGK A;  1DRS A;  1HAA A;  2L5S A;  1REW C;  1L4W A;  2HLQ A;  1G6M A;  1MAH F;  2ABX A;  2QJ9 C;  1RGJ A;  1TXB A;  2MJ0 A;  3BT2 U;  4BIK B;  1CDQ A;  1CTX A;  1IDI A;  1UG4 A;  2N99 A;  1CCQ A;  1FF4 A;  4EY8 B;  3PLC A;  1HAJ A;  1NOR A;  3NH7 A; 
#chains in the Genus database with same CATH topology
 2MHY A;  2OFS A;  5DU1 A;  1KFH A;  1NYS A;  1FFJ A;  1NXB A;  1KS6 A;  1QKE A;  5IMY C;  1NTX A;  2H64 B;  1NTN A;  2MJY A;  1IDL A;  2H7Z A;  1KBA A;  2CTX A;  2CRS A;  3U74 U;  1JBD A;  3VTS A;  1KXI A;  2HLR A;  3NDS A;  1CDS A;  1CXO A;  2NBT A;  1ONJ A;  2VLW A;  4OM4 A;  1NYU A;  1HC9 B;  1COD A;  3BT1 U;  2LCR A;  2H62 D;  4ZQY A;  1CB9 A;  4HQP F;  2PJY B;  4BDT B;  1H0J A;  1KTZ B;  3ERA A;  1NEA A;  3HH7 A;  2J8B A;  4LFT A;  2K3G A;  1IK8 A;  1LJZ A;  2H64 C;  4DO8 A;  1IJC A;  4IYE A;  1KC4 A;  1PLO A;  2BTX A;  2GOO C;  1JE9 A;  1KBT A;  1W6B A;  2I9B E;  1S4Y A;  1I02 A;  4KSN A;  3EVS C;  1ABT A;  1MR6 A;  1FRA A;  2MFA A;  1FSC A;  2ERA A;  1TXA A;  1IQ9 A;  4UY2 C;  2MUO A;  2QJA C;  1RL5 A;  3KFD E;  2H5F A;  1BXP A;  1CXN A;  1KU6 B;  4FAO C;  1B41 B;  5DO6 A;  1XT3 A;  3FEV A;  5DZ5 A;  3EBX A;  2L03 A;  2CDX A;  1IDG A;  1CDR A;  1HOY A;  4RUD A;  3U73 U;  2H8U A;  1IDH A;  2H7Z B;  1LXH A;  1ERG A;  1ZAD A;  2UWR A;  1LXG A;  1TGX A;  4AEA A;  1QM7 A;  2MJ4 A;  2JQP A;  2CCX A;  2H62 C;  4XJJ A;  3NEQ A;  6EBX A;  1V6P A;  1BTE A;  5IMT D;  1LX5 B;  2FD6 U;  2LA1 A;  3LAQ U;  4P7U A;  1KL8 A;  1M9Z A;  2PJY C;  1QKD A;  1HC9 A;  2BHI A;  2QJB C;  3QB4 B;  1CRF A;  1VB0 A;  2MUP A;  2UX2 A;  1FAS A;  2JVE A;  1F8U B;  2QC1 A;  1ERA A;  1YWH A;  1CVO A;  4FAO E;  2CRT A;  1ES7 B;  2X8B B;  1KBS A;  1FSS B;  1F94 A;  1IKC A;  1COE A;  1TFS A;  2GOO B;  1CRE A;  3KFD I;  1LSI A;  1CDT A;  1CHV S;  4OM5 A;  4QTI U;  5EBX A;  1JGK A;  1DRS A;  1HAA A;  2L5S A;  1REW C;  1L4W A;  2HLQ A;  1G6M A;  1MAH F;  2ABX A;  2QJ9 C;  1RGJ A;  1TXB A;  2MJ0 A;  3BT2 U;  4BIK B;  1CDQ A;  1CTX A;  1IDI A;  1UG4 A;  2N99 A;  1CCQ A;  1FF4 A;  4EY8 B;  3PLC A;  1HAJ A;  1NOR A;  3NH7 A; 
#chains in the Genus database with same CATH homology
 2MHY A;  2OFS A;  5DU1 A;  1KFH A;  1NYS A;  1FFJ A;  1NXB A;  1KS6 A;  1QKE A;  5IMY C;  1NTX A;  2H64 B;  1NTN A;  2MJY A;  1IDL A;  2H7Z A;  1KBA A;  2CTX A;  2CRS A;  3U74 U;  1JBD A;  3VTS A;  1KXI A;  2HLR A;  3NDS A;  1CDS A;  1CXO A;  2NBT A;  1ONJ A;  2VLW A;  4OM4 A;  1NYU A;  1HC9 B;  1COD A;  3BT1 U;  2LCR A;  2H62 D;  4ZQY A;  1CB9 A;  4HQP F;  2PJY B;  4BDT B;  1H0J A;  1KTZ B;  3ERA A;  1NEA A;  3HH7 A;  2J8B A;  4LFT A;  2K3G A;  1IK8 A;  1LJZ A;  2H64 C;  4DO8 A;  1IJC A;  4IYE A;  1KC4 A;  1PLO A;  2BTX A;  2GOO C;  1JE9 A;  1KBT A;  1W6B A;  2I9B E;  1S4Y A;  1I02 A;  4KSN A;  3EVS C;  1ABT A;  1MR6 A;  1FRA A;  2MFA A;  1FSC A;  2ERA A;  1TXA A;  1IQ9 A;  4UY2 C;  2MUO A;  2QJA C;  1RL5 A;  3KFD E;  2H5F A;  1BXP A;  1CXN A;  1KU6 B;  4FAO C;  1B41 B;  5DO6 A;  1XT3 A;  3FEV A;  5DZ5 A;  3EBX A;  2L03 A;  2CDX A;  1IDG A;  1CDR A;  1HOY A;  4RUD A;  3U73 U;  2H8U A;  1IDH A;  2H7Z B;  1LXH A;  1ERG A;  1ZAD A;  2UWR A;  1LXG A;  1TGX A;  4AEA A;  1QM7 A;  2MJ4 A;  2JQP A;  2CCX A;  2H62 C;  4XJJ A;  3NEQ A;  6EBX A;  1V6P A;  1BTE A;  5IMT D;  1LX5 B;  2FD6 U;  2LA1 A;  3LAQ U;  4P7U A;  1KL8 A;  1M9Z A;  2PJY C;  1QKD A;  1HC9 A;  2BHI A;  2QJB C;  3QB4 B;  1CRF A;  1VB0 A;  2MUP A;  2UX2 A;  1FAS A;  2JVE A;  1F8U B;  2QC1 A;  1ERA A;  1YWH A;  1CVO A;  4FAO E;  2CRT A;  1ES7 B;  2X8B B;  1KBS A;  1FSS B;  1F94 A;  1IKC A;  1COE A;  1TFS A;  2GOO B;  1CRE A;  3KFD I;  1LSI A;  1CDT A;  1CHV S;  4OM5 A;  4QTI U;  5EBX A;  1JGK A;  1DRS A;  1HAA A;  2L5S A;  1REW C;  1L4W A;  2HLQ A;  1G6M A;  1MAH F;  2ABX A;  2QJ9 C;  1RGJ A;  1TXB A;  2MJ0 A;  3BT2 U;  4BIK B;  1CDQ A;  1CTX A;  1IDI A;  1UG4 A;  2N99 A;  1CCQ A;  1FF4 A;  4EY8 B;  3PLC A;  1HAJ A;  1NOR A;  3NH7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...