2VLWA

Crystal structure of the muscarinic toxin mt7 diiodotyr51 derivative.
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
65
structure length
64
Chain Sequence
LTCVKSNSIWFPTSEDCPDGQNLCFKRWQYISPRMYDFTRGCAATCPKAERDVINCCGTDKCNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MUSCARINIC M1-TOXIN1
publication title Different Interactions between Mt7 Toxin and the Human Muscarinic M1 Receptor in its Free and N-Methylscopolamine-Occupied States.
pubmed doi rcsb
molecule tags Toxin
total genus 8
structure length 64
sequence length 65
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2vlwA00
5DO6A 4AEAA 2MJ0A 1CB9A 2MHYA 2MUPA 2JVEA 1KBTA 1HC9B 1FFJA 1QKDA 1IDIA 1COEA 3VTSA 2K3GA 1ES7B 1MAHF 2H64B 2GOOB 2LCRA 3NDSA 5IMTD 1HAAA 3FEVA 1UG4A 1CXNA 2VLWA 4LFTA 1TFSA 3EVSC 4OM4A 1YWHA 1BTEA 1KTZB 3U73U 1L4WA 2ERAA 1REWC 3NH7A 1CRFA 2PJYC 1F94A 1CDRA 1RL5A 1CDTA 1S4YA 1ABTA 1QM7A 5IMYC 1FRAA 2NBTA 1W6BA 3HH7A 3EBXA 1KFHA 2CDXA 1VB0A 3KFDI 4XJJA 2L5SA 1LX5B 1QKEA 1KL8A 5DU1A 4ZQYA 1TXBA 3NEQA 1CDQA 2L03A 2MUOA 1ERGA 1TGXA 4EY8B 1HOYA 1CODA 1IDGA 1M9ZA 1ONJA 3QB4B 1JBDA 1JGKA 2HLQA 1IKCA 2MFAA 1KBAA 4RUDA 1I02A 2QJBC 1HAJA 2MJYA 1IDLA 1DRSA 2H62C 2PJYB 1KC4A 1F8UB 1B41B 5EBXA 1NYSA 1JE9A 3ERAA 2H62D 2I9BE 2QJ9C 2H7ZA 1PLOA 1NTXA 2H8UA 1TXAA 2MJ4A 5DZ5A 3U74U 1NXBA 2ABXA 3KFDE 2H64C 2GOOC 1ZADA 2UX2A 1G6MA 1RGJA 1KS6A 1FF4A 2H7ZB 4IYEA 1LSIA 4FAOC 1FSSB 1CVOA 1ERAA 1IDHA 1FASA 3BT2U 2QJAC 4OM5A 1CREA 1CDSA 1MR6A 4BDTB 2UWRA 1IJCA 1XT3A 1CHVS 2CTXA 1CTXA 1H0JA 2HLRA 2LA1A 1KXIA 2X8BB 4FAOE 4UY2C 2H5FA 2CRTA 4HQPF 1CCQA 3BT1U 2FD6U 1CXOA 4BIKB 1LXGA 1BXPA 2BHIA 1NORA 1NYUA 1NTNA 6EBXA 4DO8A 1V6PA 1KBSA 2J8BA 1IK8A 1FSCA 3PLCA 4P7UA 2CRSA 2OFSA 2QC1A 2BTXA 1IQ9A 1NEAA 1LXHA 2N99A 2JQPA 1HC9A 4QTIU 1LJZA 3LAQU 2CCXA 1KU6B
chains in the Genus database with same CATH superfamily
5DO6A 4AEAA 2MJ0A 4KSNA 1CB9A 2MHYA 2MUPA 2JVEA 1KBTA 1HC9B 1FFJA 1QKDA 1IDIA 1COEA 3VTSA 2K3GA 1ES7B 1MAHF 2H64B 2GOOB 2LCRA 3NDSA 5IMTD 1HAAA 3FEVA 1UG4A 1CXNA 2VLWA 4LFTA 1TFSA 3EVSC 4OM4A 1YWHA 1BTEA 1KTZB 3U73U 1L4WA 2ERAA 1REWC 3NH7A 1CRFA 2PJYC 1F94A 1CDRA 1RL5A 1CDTA 1S4YA 1ABTA 1QM7A 5IMYC 1FRAA 2NBTA 1W6BA 3HH7A 3EBXA 1KFHA 2CDXA 1VB0A 3KFDI 4XJJA 2L5SA 1LX5B 1QKEA 1KL8A 5DU1A 4ZQYA 1TXBA 3NEQA 1CDQA 2L03A 2MUOA 1ERGA 1TGXA 4EY8B 1HOYA 1CODA 1IDGA 1M9ZA 1ONJA 3QB4B 1JBDA 1JGKA 2HLQA 1IKCA 2MFAA 1KBAA 4RUDA 1I02A 2QJBC 1HAJA 2MJYA 1IDLA 1DRSA 2H62C 2PJYB 1KC4A 1F8UB 1B41B 5EBXA 1NYSA 1JE9A 3ERAA 2H62D 2I9BE 2QJ9C 2H7ZA 1PLOA 1NTXA 2H8UA 1TXAA 2MJ4A 5DZ5A 3U74U 1NXBA 2ABXA 3KFDE 2H64C 2GOOC 1ZADA 2UX2A 1G6MA 1RGJA 1KS6A 1FF4A 2H7ZB 4IYEA 1LSIA 4FAOC 1FSSB 1CVOA 1ERAA 1IDHA 1FASA 3BT2U 2QJAC 4OM5A 1CREA 1CDSA 1MR6A 4BDTB 2UWRA 1IJCA 1XT3A 1CHVS 2CTXA 1CTXA 1H0JA 2HLRA 2LA1A 1KXIA 2X8BB 4FAOE 4UY2C 2H5FA 2CRTA 4HQPF 1CCQA 3BT1U 2FD6U 1CXOA 4BIKB 1LXGA 1BXPA 2BHIA 1NORA 1NYUA 1NTNA 6EBXA 4DO8A 1V6PA 1KBSA 2J8BA 1IK8A 1FSCA 3PLCA 4P7UA 2CRSA 2OFSA 2QC1A 2BTXA 1IQ9A 1NEAA 1LXHA 2N99A 2JQPA 1HC9A 4QTIU 1LJZA 3LAQU 2CCXA 1KU6B
chains in the Genus database with same CATH topology
5DO6A 4AEAA 2MJ0A 4KSNA 1CB9A 2MHYA 2MUPA 2JVEA 1KBTA 1HC9B 1FFJA 1QKDA 1IDIA 1COEA 3VTSA 2K3GA 1ES7B 1MAHF 2H64B 2GOOB 2LCRA 3NDSA 5IMTD 1HAAA 3FEVA 1UG4A 1CXNA 2VLWA 4LFTA 1TFSA 3EVSC 4OM4A 1YWHA 1BTEA 1KTZB 3U73U 1L4WA 2ERAA 1REWC 3NH7A 1CRFA 2PJYC 1F94A 1CDRA 1RL5A 1CDTA 1S4YA 1ABTA 1QM7A 5IMYC 1FRAA 2NBTA 1W6BA 3HH7A 3EBXA 1KFHA 2CDXA 1VB0A 3KFDI 4XJJA 2L5SA 1LX5B 1QKEA 1KL8A 5DU1A 4ZQYA 1TXBA 3NEQA 1CDQA 2L03A 2MUOA 1ERGA 1TGXA 4EY8B 1HOYA 1CODA 1IDGA 1M9ZA 1ONJA 3QB4B 1JBDA 1JGKA 2HLQA 1IKCA 2MFAA 1KBAA 4RUDA 1I02A 2QJBC 1HAJA 2MJYA 1IDLA 1DRSA 2H62C 2PJYB 1KC4A 1F8UB 1B41B 5EBXA 1NYSA 1JE9A 3ERAA 2H62D 2I9BE 2QJ9C 2H7ZA 1PLOA 1NTXA 2H8UA 1TXAA 2MJ4A 5DZ5A 3U74U 1NXBA 2ABXA 3KFDE 2H64C 2GOOC 1ZADA 2UX2A 1G6MA 1RGJA 1KS6A 1FF4A 2H7ZB 4IYEA 1LSIA 4FAOC 1FSSB 1CVOA 1ERAA 1IDHA 1FASA 3BT2U 2QJAC 4OM5A 1CREA 1CDSA 1MR6A 4BDTB 2UWRA 1IJCA 1XT3A 1CHVS 2CTXA 1CTXA 1H0JA 2HLRA 2LA1A 1KXIA 2X8BB 4FAOE 4UY2C 2H5FA 2CRTA 4HQPF 1CCQA 3BT1U 2FD6U 1CXOA 4BIKB 1LXGA 1BXPA 2BHIA 1NORA 1NYUA 1NTNA 6EBXA 4DO8A 1V6PA 1KBSA 2J8BA 1IK8A 1FSCA 3PLCA 4P7UA 2CRSA 2OFSA 2QC1A 2BTXA 1IQ9A 1NEAA 1LXHA 2N99A 2JQPA 1HC9A 4QTIU 1LJZA 3LAQU 2CCXA 1KU6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DO6 A;  4AEA A;  2MJ0 A;  1CB9 A;  2MHY A;  2MUP A;  2JVE A;  1KBT A;  1HC9 B;  1FFJ A;  1QKD A;  1IDI A;  1COE A;  3VTS A;  2K3G A;  1ES7 B;  1MAH F;  2H64 B;  2GOO B;  2LCR A;  3NDS A;  5IMT D;  1HAA A;  3FEV A;  1UG4 A;  1CXN A;  2VLW A;  4LFT A;  1TFS A;  3EVS C;  4OM4 A;  1YWH A;  1BTE A;  1KTZ B;  3U73 U;  1L4W A;  2ERA A;  1REW C;  3NH7 A;  1CRF A;  2PJY C;  1F94 A;  1CDR A;  1RL5 A;  1CDT A;  1S4Y A;  1ABT A;  1QM7 A;  5IMY C;  1FRA A;  2NBT A;  1W6B A;  3HH7 A;  3EBX A;  1KFH A;  2CDX A;  1VB0 A;  3KFD I;  4XJJ A;  2L5S A;  1LX5 B;  1QKE A;  1KL8 A;  5DU1 A;  4ZQY A;  1TXB A;  3NEQ A;  1CDQ A;  2L03 A;  2MUO A;  1ERG A;  1TGX A;  4EY8 B;  1HOY A;  1COD A;  1IDG A;  1M9Z A;  1ONJ A;  3QB4 B;  1JBD A;  1JGK A;  2HLQ A;  1IKC A;  2MFA A;  1KBA A;  4RUD A;  1I02 A;  2QJB C;  1HAJ A;  2MJY A;  1IDL A;  1DRS A;  2H62 C;  2PJY B;  1KC4 A;  1F8U B;  1B41 B;  5EBX A;  1NYS A;  1JE9 A;  3ERA A;  2H62 D;  2I9B E;  2QJ9 C;  2H7Z A;  1PLO A;  1NTX A;  2H8U A;  1TXA A;  2MJ4 A;  5DZ5 A;  3U74 U;  1NXB A;  2ABX A;  3KFD E;  2H64 C;  2GOO C;  1ZAD A;  2UX2 A;  1G6M A;  1RGJ A;  1KS6 A;  1FF4 A;  2H7Z B;  4IYE A;  1LSI A;  4FAO C;  1FSS B;  1CVO A;  1ERA A;  1IDH A;  1FAS A;  3BT2 U;  2QJA C;  4OM5 A;  1CRE A;  1CDS A;  1MR6 A;  4BDT B;  2UWR A;  1IJC A;  1XT3 A;  1CHV S;  2CTX A;  1CTX A;  1H0J A;  2HLR A;  2LA1 A;  1KXI A;  2X8B B;  4FAO E;  4UY2 C;  2H5F A;  2CRT A;  4HQP F;  1CCQ A;  3BT1 U;  2FD6 U;  1CXO A;  4BIK B;  1LXG A;  1BXP A;  2BHI A;  1NOR A;  1NYU A;  1NTN A;  6EBX A;  4DO8 A;  1V6P A;  1KBS A;  2J8B A;  1IK8 A;  1FSC A;  3PLC A;  4P7U A;  2CRS A;  2OFS A;  2QC1 A;  2BTX A;  1IQ9 A;  1NEA A;  1LXH A;  2N99 A;  2JQP A;  1HC9 A;  4QTI U;  1LJZ A;  3LAQ U;  2CCX A;  1KU6 B; 
#chains in the Genus database with same CATH topology
 5DO6 A;  4AEA A;  2MJ0 A;  4KSN A;  1CB9 A;  2MHY A;  2MUP A;  2JVE A;  1KBT A;  1HC9 B;  1FFJ A;  1QKD A;  1IDI A;  1COE A;  3VTS A;  2K3G A;  1ES7 B;  1MAH F;  2H64 B;  2GOO B;  2LCR A;  3NDS A;  5IMT D;  1HAA A;  3FEV A;  1UG4 A;  1CXN A;  2VLW A;  4LFT A;  1TFS A;  3EVS C;  4OM4 A;  1YWH A;  1BTE A;  1KTZ B;  3U73 U;  1L4W A;  2ERA A;  1REW C;  3NH7 A;  1CRF A;  2PJY C;  1F94 A;  1CDR A;  1RL5 A;  1CDT A;  1S4Y A;  1ABT A;  1QM7 A;  5IMY C;  1FRA A;  2NBT A;  1W6B A;  3HH7 A;  3EBX A;  1KFH A;  2CDX A;  1VB0 A;  3KFD I;  4XJJ A;  2L5S A;  1LX5 B;  1QKE A;  1KL8 A;  5DU1 A;  4ZQY A;  1TXB A;  3NEQ A;  1CDQ A;  2L03 A;  2MUO A;  1ERG A;  1TGX A;  4EY8 B;  1HOY A;  1COD A;  1IDG A;  1M9Z A;  1ONJ A;  3QB4 B;  1JBD A;  1JGK A;  2HLQ A;  1IKC A;  2MFA A;  1KBA A;  4RUD A;  1I02 A;  2QJB C;  1HAJ A;  2MJY A;  1IDL A;  1DRS A;  2H62 C;  2PJY B;  1KC4 A;  1F8U B;  1B41 B;  5EBX A;  1NYS A;  1JE9 A;  3ERA A;  2H62 D;  2I9B E;  2QJ9 C;  2H7Z A;  1PLO A;  1NTX A;  2H8U A;  1TXA A;  2MJ4 A;  5DZ5 A;  3U74 U;  1NXB A;  2ABX A;  3KFD E;  2H64 C;  2GOO C;  1ZAD A;  2UX2 A;  1G6M A;  1RGJ A;  1KS6 A;  1FF4 A;  2H7Z B;  4IYE A;  1LSI A;  4FAO C;  1FSS B;  1CVO A;  1ERA A;  1IDH A;  1FAS A;  3BT2 U;  2QJA C;  4OM5 A;  1CRE A;  1CDS A;  1MR6 A;  4BDT B;  2UWR A;  1IJC A;  1XT3 A;  1CHV S;  2CTX A;  1CTX A;  1H0J A;  2HLR A;  2LA1 A;  1KXI A;  2X8B B;  4FAO E;  4UY2 C;  2H5F A;  2CRT A;  4HQP F;  1CCQ A;  3BT1 U;  2FD6 U;  1CXO A;  4BIK B;  1LXG A;  1BXP A;  2BHI A;  1NOR A;  1NYU A;  1NTN A;  6EBX A;  4DO8 A;  1V6P A;  1KBS A;  2J8B A;  1IK8 A;  1FSC A;  3PLC A;  4P7U A;  2CRS A;  2OFS A;  2QC1 A;  2BTX A;  1IQ9 A;  1NEA A;  1LXH A;  2N99 A;  2JQP A;  1HC9 A;  4QTI U;  1LJZ A;  3LAQ U;  2CCX A;  1KU6 B; 
#chains in the Genus database with same CATH homology
 5DO6 A;  4AEA A;  2MJ0 A;  4KSN A;  1CB9 A;  2MHY A;  2MUP A;  2JVE A;  1KBT A;  1HC9 B;  1FFJ A;  1QKD A;  1IDI A;  1COE A;  3VTS A;  2K3G A;  1ES7 B;  1MAH F;  2H64 B;  2GOO B;  2LCR A;  3NDS A;  5IMT D;  1HAA A;  3FEV A;  1UG4 A;  1CXN A;  2VLW A;  4LFT A;  1TFS A;  3EVS C;  4OM4 A;  1YWH A;  1BTE A;  1KTZ B;  3U73 U;  1L4W A;  2ERA A;  1REW C;  3NH7 A;  1CRF A;  2PJY C;  1F94 A;  1CDR A;  1RL5 A;  1CDT A;  1S4Y A;  1ABT A;  1QM7 A;  5IMY C;  1FRA A;  2NBT A;  1W6B A;  3HH7 A;  3EBX A;  1KFH A;  2CDX A;  1VB0 A;  3KFD I;  4XJJ A;  2L5S A;  1LX5 B;  1QKE A;  1KL8 A;  5DU1 A;  4ZQY A;  1TXB A;  3NEQ A;  1CDQ A;  2L03 A;  2MUO A;  1ERG A;  1TGX A;  4EY8 B;  1HOY A;  1COD A;  1IDG A;  1M9Z A;  1ONJ A;  3QB4 B;  1JBD A;  1JGK A;  2HLQ A;  1IKC A;  2MFA A;  1KBA A;  4RUD A;  1I02 A;  2QJB C;  1HAJ A;  2MJY A;  1IDL A;  1DRS A;  2H62 C;  2PJY B;  1KC4 A;  1F8U B;  1B41 B;  5EBX A;  1NYS A;  1JE9 A;  3ERA A;  2H62 D;  2I9B E;  2QJ9 C;  2H7Z A;  1PLO A;  1NTX A;  2H8U A;  1TXA A;  2MJ4 A;  5DZ5 A;  3U74 U;  1NXB A;  2ABX A;  3KFD E;  2H64 C;  2GOO C;  1ZAD A;  2UX2 A;  1G6M A;  1RGJ A;  1KS6 A;  1FF4 A;  2H7Z B;  4IYE A;  1LSI A;  4FAO C;  1FSS B;  1CVO A;  1ERA A;  1IDH A;  1FAS A;  3BT2 U;  2QJA C;  4OM5 A;  1CRE A;  1CDS A;  1MR6 A;  4BDT B;  2UWR A;  1IJC A;  1XT3 A;  1CHV S;  2CTX A;  1CTX A;  1H0J A;  2HLR A;  2LA1 A;  1KXI A;  2X8B B;  4FAO E;  4UY2 C;  2H5F A;  2CRT A;  4HQP F;  1CCQ A;  3BT1 U;  2FD6 U;  1CXO A;  4BIK B;  1LXG A;  1BXP A;  2BHI A;  1NOR A;  1NYU A;  1NTN A;  6EBX A;  4DO8 A;  1V6P A;  1KBS A;  2J8B A;  1IK8 A;  1FSC A;  3PLC A;  4P7U A;  2CRS A;  2OFS A;  2QC1 A;  2BTX A;  1IQ9 A;  1NEA A;  1LXH A;  2N99 A;  2JQP A;  1HC9 A;  4QTI U;  1LJZ A;  3LAQ U;  2CCX A;  1KU6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...