1V6PA

Crystal structure of cobrotoxin
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
62
structure length
62
Chain Sequence
LECHNQQSSQTPTTTGCSGGETNCYKKRWRDHRGYRTERGCGCPSVKNGIEINCCTTDRCNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cobrotoxin
publication title The atomic resolution crystal structure of atratoxin determined by single wavelength anomalous diffraction phasing
pubmed doi rcsb
molecule tags Toxin
total genus 12
structure length 62
sequence length 62
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1v6pA00
2ERAA 1CVOA 3NEQA 2GOOC 2X8BB 1NTNA 4FAOE 1HAAA 2H62D 2CRTA 1UG4A 1CRFA 1CXNA 3KFDE 2QC1A 2BTXA 2HLRA 1CDRA 1FSCA 2H64C 2MHYA 5DZ5A 4AEAA 1NXBA 2N99A 2QJAC 1HAJA 3PLCA 1M9ZA 4UY2C 2BHIA 4RUDA 1TXBA 2CCXA 1L4WA 5EBXA 1NORA 1G6MA 4IYEA 1KXIA 2PJYC 1TFSA 1KS6A 1I02A 1KBTA 1BXPA 1FASA 1VB0A 2QJ9C 1KU6B 1FSSB 3NH7A 1CDQA 1ABTA 1LSIA 2VLWA 1XT3A 5DU1A 2CRSA 1MAHF 1KC4A 1CDTA 1B41B 3FEVA 2HLQA 4BIKB 1QM7A 3KFDI 1NYUA 1CREA 2OFSA 1LX5B 4LFTA 1RGJA 1COEA 2J8BA 1FF4A 2LA1A 1KBSA 1NYSA 1ERGA 1IDGA 2MJYA 4FAOC 1QKEA 4QTIU 1IJCA 1NTXA 2FD6U 1CODA 1BTEA 1RL5A 2GOOB 1IK8A 1LXGA 3BT2U 4DO8A 4EY8B 2MJ4A 4HQPF 1KFHA 2ABXA 6EBXA 2CTXA 4XJJA 2LCRA 2QJBC 1F8UB 1JBDA 3U74U 5DO6A 2H64B 3EVSC 1IDLA 1CHVS 3LAQU 1CTXA 2CDXA 2MJ0A 1TXAA 3EBXA 3NDSA 4P7UA 2I9BE 4OM5A 2H8UA 2MUPA 1DRSA 2PJYB 1CB9A 1ES7B 1F94A 1TGXA 2H7ZB 2JQPA 2UWRA 4OM4A 1IKCA 2H62C 1JGKA 2JVEA 1CDSA 1H0JA 1HC9B 1KBAA 1MR6A 1IDHA 1V6PA 2K3GA 1S4YA 1QKDA 1YWHA 2H7ZA 1CCQA 1ERAA 2L5SA 3QB4B 1REWC 1JE9A 2L03A 1HC9A 2UX2A 1KTZB 1IQ9A 1KL8A 1NEAA 1ONJA 3BT1U 3U73U 3VTSA 1ZADA 1IDIA 1LJZA 1HOYA 2NBTA 2MFAA 2H5FA 1FFJA 2MUOA 1LXHA 1FRAA 1PLOA 1W6BA 3ERAA 4BDTB 1CXOA 3HH7A 4ZQYA 5IMYC 5IMTD
chains in the Genus database with same CATH superfamily
2ERAA 1CVOA 3NEQA 2GOOC 2X8BB 1NTNA 4FAOE 1HAAA 2H62D 2CRTA 1UG4A 1CRFA 1CXNA 3KFDE 2QC1A 2BTXA 2HLRA 1CDRA 1FSCA 2H64C 2MHYA 5DZ5A 4AEAA 1NXBA 2N99A 2QJAC 1HAJA 3PLCA 1M9ZA 4UY2C 2BHIA 4RUDA 1TXBA 2CCXA 1L4WA 5EBXA 1NORA 1G6MA 4IYEA 1KXIA 2PJYC 1TFSA 1KS6A 1I02A 1KBTA 1BXPA 1FASA 1VB0A 2QJ9C 1KU6B 1FSSB 3NH7A 1CDQA 1ABTA 1LSIA 2VLWA 1XT3A 5DU1A 2CRSA 1MAHF 1KC4A 1CDTA 1B41B 3FEVA 2HLQA 4BIKB 1QM7A 3KFDI 1NYUA 1CREA 2OFSA 1LX5B 4LFTA 1RGJA 1COEA 2J8BA 1FF4A 2LA1A 1KBSA 1NYSA 1ERGA 1IDGA 2MJYA 4FAOC 1QKEA 4QTIU 1IJCA 1NTXA 2FD6U 1CODA 1BTEA 1RL5A 2GOOB 1IK8A 1LXGA 3BT2U 4DO8A 4EY8B 2MJ4A 4HQPF 1KFHA 2ABXA 6EBXA 2CTXA 4XJJA 2LCRA 2QJBC 1F8UB 1JBDA 3U74U 5DO6A 2H64B 3EVSC 1IDLA 1CHVS 3LAQU 1CTXA 2CDXA 2MJ0A 1TXAA 3EBXA 3NDSA 4P7UA 2I9BE 4OM5A 2H8UA 2MUPA 1DRSA 2PJYB 1CB9A 1ES7B 1F94A 1TGXA 2H7ZB 2JQPA 2UWRA 4OM4A 4KSNA 1IKCA 2H62C 1JGKA 2JVEA 1CDSA 1H0JA 1HC9B 1KBAA 1MR6A 1IDHA 1V6PA 2K3GA 1S4YA 1QKDA 1YWHA 2H7ZA 1CCQA 1ERAA 2L5SA 3QB4B 1REWC 1JE9A 2L03A 1HC9A 2UX2A 1KTZB 1IQ9A 1KL8A 1NEAA 1ONJA 3BT1U 3U73U 3VTSA 1ZADA 1IDIA 1LJZA 1HOYA 2NBTA 2MFAA 2H5FA 1FFJA 2MUOA 1LXHA 1FRAA 1PLOA 1W6BA 3ERAA 4BDTB 1CXOA 3HH7A 4ZQYA 5IMYC 5IMTD
chains in the Genus database with same CATH topology
2ERAA 1CVOA 3NEQA 2GOOC 2X8BB 1NTNA 4FAOE 1HAAA 2H62D 2CRTA 1UG4A 1CRFA 1CXNA 3KFDE 2QC1A 2BTXA 2HLRA 1CDRA 1FSCA 2H64C 2MHYA 5DZ5A 4AEAA 1NXBA 2N99A 2QJAC 1HAJA 3PLCA 1M9ZA 4UY2C 2BHIA 4RUDA 1TXBA 2CCXA 1L4WA 5EBXA 1NORA 1G6MA 4IYEA 1KXIA 2PJYC 1TFSA 1KS6A 1I02A 1KBTA 1BXPA 1FASA 1VB0A 2QJ9C 1KU6B 1FSSB 3NH7A 1CDQA 1ABTA 1LSIA 2VLWA 1XT3A 5DU1A 2CRSA 1MAHF 1KC4A 1CDTA 1B41B 3FEVA 2HLQA 4BIKB 1QM7A 3KFDI 1NYUA 1CREA 2OFSA 1LX5B 4LFTA 1RGJA 1COEA 2J8BA 1FF4A 2LA1A 1KBSA 1NYSA 1ERGA 1IDGA 2MJYA 4FAOC 1QKEA 4QTIU 1IJCA 1NTXA 2FD6U 1CODA 1BTEA 1RL5A 2GOOB 1IK8A 1LXGA 3BT2U 4DO8A 4EY8B 2MJ4A 4HQPF 1KFHA 2ABXA 6EBXA 2CTXA 4XJJA 2LCRA 2QJBC 1F8UB 1JBDA 3U74U 5DO6A 2H64B 3EVSC 1IDLA 1CHVS 3LAQU 1CTXA 2CDXA 2MJ0A 1TXAA 3EBXA 3NDSA 4P7UA 2I9BE 4OM5A 2H8UA 2MUPA 1DRSA 2PJYB 1CB9A 1ES7B 1F94A 1TGXA 2H7ZB 2JQPA 2UWRA 4OM4A 4KSNA 1IKCA 2H62C 1JGKA 2JVEA 1CDSA 1H0JA 1HC9B 1KBAA 1MR6A 1IDHA 1V6PA 2K3GA 1S4YA 1QKDA 1YWHA 2H7ZA 1CCQA 1ERAA 2L5SA 3QB4B 1REWC 1JE9A 2L03A 1HC9A 2UX2A 1KTZB 1IQ9A 1KL8A 1NEAA 1ONJA 3BT1U 3U73U 3VTSA 1ZADA 1IDIA 1LJZA 1HOYA 2NBTA 2MFAA 2H5FA 1FFJA 2MUOA 1LXHA 1FRAA 1PLOA 1W6BA 3ERAA 4BDTB 1CXOA 3HH7A 4ZQYA 5IMYC 5IMTD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ERA A;  1CVO A;  3NEQ A;  2GOO C;  2X8B B;  1NTN A;  4FAO E;  1HAA A;  2H62 D;  2CRT A;  1UG4 A;  1CRF A;  1CXN A;  3KFD E;  2QC1 A;  2BTX A;  2HLR A;  1CDR A;  1FSC A;  2H64 C;  2MHY A;  5DZ5 A;  4AEA A;  1NXB A;  2N99 A;  2QJA C;  1HAJ A;  3PLC A;  1M9Z A;  4UY2 C;  2BHI A;  4RUD A;  1TXB A;  2CCX A;  1L4W A;  5EBX A;  1NOR A;  1G6M A;  4IYE A;  1KXI A;  2PJY C;  1TFS A;  1KS6 A;  1I02 A;  1KBT A;  1BXP A;  1FAS A;  1VB0 A;  2QJ9 C;  1KU6 B;  1FSS B;  3NH7 A;  1CDQ A;  1ABT A;  1LSI A;  2VLW A;  1XT3 A;  5DU1 A;  2CRS A;  1MAH F;  1KC4 A;  1CDT A;  1B41 B;  3FEV A;  2HLQ A;  4BIK B;  1QM7 A;  3KFD I;  1NYU A;  1CRE A;  2OFS A;  1LX5 B;  4LFT A;  1RGJ A;  1COE A;  2J8B A;  1FF4 A;  2LA1 A;  1KBS A;  1NYS A;  1ERG A;  1IDG A;  2MJY A;  4FAO C;  1QKE A;  4QTI U;  1IJC A;  1NTX A;  2FD6 U;  1COD A;  1BTE A;  1RL5 A;  2GOO B;  1IK8 A;  1LXG A;  3BT2 U;  4DO8 A;  4EY8 B;  2MJ4 A;  4HQP F;  1KFH A;  2ABX A;  6EBX A;  2CTX A;  4XJJ A;  2LCR A;  2QJB C;  1F8U B;  1JBD A;  3U74 U;  5DO6 A;  2H64 B;  3EVS C;  1IDL A;  1CHV S;  3LAQ U;  1CTX A;  2CDX A;  2MJ0 A;  1TXA A;  3EBX A;  3NDS A;  4P7U A;  2I9B E;  4OM5 A;  2H8U A;  2MUP A;  1DRS A;  2PJY B;  1CB9 A;  1ES7 B;  1F94 A;  1TGX A;  2H7Z B;  2JQP A;  2UWR A;  4OM4 A;  1IKC A;  2H62 C;  1JGK A;  2JVE A;  1CDS A;  1H0J A;  1HC9 B;  1KBA A;  1MR6 A;  1IDH A;  1V6P A;  2K3G A;  1S4Y A;  1QKD A;  1YWH A;  2H7Z A;  1CCQ A;  1ERA A;  2L5S A;  3QB4 B;  1REW C;  1JE9 A;  2L03 A;  1HC9 A;  2UX2 A;  1KTZ B;  1IQ9 A;  1KL8 A;  1NEA A;  1ONJ A;  3BT1 U;  3U73 U;  3VTS A;  1ZAD A;  1IDI A;  1LJZ A;  1HOY A;  2NBT A;  2MFA A;  2H5F A;  1FFJ A;  2MUO A;  1LXH A;  1FRA A;  1PLO A;  1W6B A;  3ERA A;  4BDT B;  1CXO A;  3HH7 A;  4ZQY A;  5IMY C;  5IMT D; 
#chains in the Genus database with same CATH topology
 2ERA A;  1CVO A;  3NEQ A;  2GOO C;  2X8B B;  1NTN A;  4FAO E;  1HAA A;  2H62 D;  2CRT A;  1UG4 A;  1CRF A;  1CXN A;  3KFD E;  2QC1 A;  2BTX A;  2HLR A;  1CDR A;  1FSC A;  2H64 C;  2MHY A;  5DZ5 A;  4AEA A;  1NXB A;  2N99 A;  2QJA C;  1HAJ A;  3PLC A;  1M9Z A;  4UY2 C;  2BHI A;  4RUD A;  1TXB A;  2CCX A;  1L4W A;  5EBX A;  1NOR A;  1G6M A;  4IYE A;  1KXI A;  2PJY C;  1TFS A;  1KS6 A;  1I02 A;  1KBT A;  1BXP A;  1FAS A;  1VB0 A;  2QJ9 C;  1KU6 B;  1FSS B;  3NH7 A;  1CDQ A;  1ABT A;  1LSI A;  2VLW A;  1XT3 A;  5DU1 A;  2CRS A;  1MAH F;  1KC4 A;  1CDT A;  1B41 B;  3FEV A;  2HLQ A;  4BIK B;  1QM7 A;  3KFD I;  1NYU A;  1CRE A;  2OFS A;  1LX5 B;  4LFT A;  1RGJ A;  1COE A;  2J8B A;  1FF4 A;  2LA1 A;  1KBS A;  1NYS A;  1ERG A;  1IDG A;  2MJY A;  4FAO C;  1QKE A;  4QTI U;  1IJC A;  1NTX A;  2FD6 U;  1COD A;  1BTE A;  1RL5 A;  2GOO B;  1IK8 A;  1LXG A;  3BT2 U;  4DO8 A;  4EY8 B;  2MJ4 A;  4HQP F;  1KFH A;  2ABX A;  6EBX A;  2CTX A;  4XJJ A;  2LCR A;  2QJB C;  1F8U B;  1JBD A;  3U74 U;  5DO6 A;  2H64 B;  3EVS C;  1IDL A;  1CHV S;  3LAQ U;  1CTX A;  2CDX A;  2MJ0 A;  1TXA A;  3EBX A;  3NDS A;  4P7U A;  2I9B E;  4OM5 A;  2H8U A;  2MUP A;  1DRS A;  2PJY B;  1CB9 A;  1ES7 B;  1F94 A;  1TGX A;  2H7Z B;  2JQP A;  2UWR A;  4OM4 A;  4KSN A;  1IKC A;  2H62 C;  1JGK A;  2JVE A;  1CDS A;  1H0J A;  1HC9 B;  1KBA A;  1MR6 A;  1IDH A;  1V6P A;  2K3G A;  1S4Y A;  1QKD A;  1YWH A;  2H7Z A;  1CCQ A;  1ERA A;  2L5S A;  3QB4 B;  1REW C;  1JE9 A;  2L03 A;  1HC9 A;  2UX2 A;  1KTZ B;  1IQ9 A;  1KL8 A;  1NEA A;  1ONJ A;  3BT1 U;  3U73 U;  3VTS A;  1ZAD A;  1IDI A;  1LJZ A;  1HOY A;  2NBT A;  2MFA A;  2H5F A;  1FFJ A;  2MUO A;  1LXH A;  1FRA A;  1PLO A;  1W6B A;  3ERA A;  4BDT B;  1CXO A;  3HH7 A;  4ZQY A;  5IMY C;  5IMT D; 
#chains in the Genus database with same CATH homology
 2ERA A;  1CVO A;  3NEQ A;  2GOO C;  2X8B B;  1NTN A;  4FAO E;  1HAA A;  2H62 D;  2CRT A;  1UG4 A;  1CRF A;  1CXN A;  3KFD E;  2QC1 A;  2BTX A;  2HLR A;  1CDR A;  1FSC A;  2H64 C;  2MHY A;  5DZ5 A;  4AEA A;  1NXB A;  2N99 A;  2QJA C;  1HAJ A;  3PLC A;  1M9Z A;  4UY2 C;  2BHI A;  4RUD A;  1TXB A;  2CCX A;  1L4W A;  5EBX A;  1NOR A;  1G6M A;  4IYE A;  1KXI A;  2PJY C;  1TFS A;  1KS6 A;  1I02 A;  1KBT A;  1BXP A;  1FAS A;  1VB0 A;  2QJ9 C;  1KU6 B;  1FSS B;  3NH7 A;  1CDQ A;  1ABT A;  1LSI A;  2VLW A;  1XT3 A;  5DU1 A;  2CRS A;  1MAH F;  1KC4 A;  1CDT A;  1B41 B;  3FEV A;  2HLQ A;  4BIK B;  1QM7 A;  3KFD I;  1NYU A;  1CRE A;  2OFS A;  1LX5 B;  4LFT A;  1RGJ A;  1COE A;  2J8B A;  1FF4 A;  2LA1 A;  1KBS A;  1NYS A;  1ERG A;  1IDG A;  2MJY A;  4FAO C;  1QKE A;  4QTI U;  1IJC A;  1NTX A;  2FD6 U;  1COD A;  1BTE A;  1RL5 A;  2GOO B;  1IK8 A;  1LXG A;  3BT2 U;  4DO8 A;  4EY8 B;  2MJ4 A;  4HQP F;  1KFH A;  2ABX A;  6EBX A;  2CTX A;  4XJJ A;  2LCR A;  2QJB C;  1F8U B;  1JBD A;  3U74 U;  5DO6 A;  2H64 B;  3EVS C;  1IDL A;  1CHV S;  3LAQ U;  1CTX A;  2CDX A;  2MJ0 A;  1TXA A;  3EBX A;  3NDS A;  4P7U A;  2I9B E;  4OM5 A;  2H8U A;  2MUP A;  1DRS A;  2PJY B;  1CB9 A;  1ES7 B;  1F94 A;  1TGX A;  2H7Z B;  2JQP A;  2UWR A;  4OM4 A;  4KSN A;  1IKC A;  2H62 C;  1JGK A;  2JVE A;  1CDS A;  1H0J A;  1HC9 B;  1KBA A;  1MR6 A;  1IDH A;  1V6P A;  2K3G A;  1S4Y A;  1QKD A;  1YWH A;  2H7Z A;  1CCQ A;  1ERA A;  2L5S A;  3QB4 B;  1REW C;  1JE9 A;  2L03 A;  1HC9 A;  2UX2 A;  1KTZ B;  1IQ9 A;  1KL8 A;  1NEA A;  1ONJ A;  3BT1 U;  3U73 U;  3VTS A;  1ZAD A;  1IDI A;  1LJZ A;  1HOY A;  2NBT A;  2MFA A;  2H5F A;  1FFJ A;  2MUO A;  1LXH A;  1FRA A;  1PLO A;  1W6B A;  3ERA A;  4BDT B;  1CXO A;  3HH7 A;  4ZQY A;  5IMY C;  5IMT D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...