1V6PA

Crystal structure of cobrotoxin
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
62
structure length
62
Chain Sequence
LECHNQQSSQTPTTTGCSGGETNCYKKRWRDHRGYRTERGCGCPSVKNGIEINCCTTDRCNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords Cobrotoxin
publication title The atomic resolution crystal structure of atratoxin determined by single wavelength anomalous diffraction phasing
pubmed doi rcsb
total genus 12
structure length 62
sequence length 62
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1v6pA00
3EBXA 1FRAA 1NYUA 2QJBC 2ABXA 3HH7A 2PJYC 3U73U 1IKCA 1ERGA 2ERAA 2GOOB 1CODA 4OM5A 1HAAA 1CHVS 1KU6B 2H7ZA 1RGJA 2CRTA 1LSIA 1KS6A 1FSSB 1TGXA 4DO8A 2MJ0A 3KFDE 4HQPF 1RL5A 4RUDA 2H8UA 5IMTD 3KFDI 2J8BA 1IQ9A 4P7UA 1VB0A 4BDTB 1LXGA 2HLQA 2CCXA 2I9BE 3U74U 1FF4A 1ES7B 2K3GA 2CDXA 1QKEA 3NH7A 1B41B 1S4YA 2H62C 6EBXA 2H62D 1TXBA 1FSCA 1KL8A 1PLOA 2LA1A 1V6PA 1LXHA 2MJYA 2BTXA 2NBTA 4OM4A 1JGKA 1HC9B 1FASA 2HLRA 1YWHA 3BT1U 3FEVA 3NDSA 1G6MA 1NTNA 2BHIA 1TXAA 2MJ4A 2X8BB 4UY2C 1NXBA 1NORA 1NEAA 1M9ZA 1KBSA 1XT3A 2H5FA 2JQPA 2L5SA 2LCRA 3ERAA 4LFTA 2OFSA 3VTSA 1I02A 2FD6U 1IDHA 2CRSA 1CCQA 1KFHA 2PJYB 3BT2U 1MAHF 4ZQYA 4FAOE 2L03A 4FAOC 2JVEA 2H64B 1F8UB 1COEA 2CTXA 1IDIA 2VLWA 1CDTA 2GOOC 2QC1A 4XJJA 1JE9A 1DRSA 1CDRA 1W6BA 1KTZB 1BXPA 4QTIU 1IJCA 1IK8A 1ONJA 1FFJA 1LJZA 4AEAA 1JBDA 2QJAC 1MR6A 1H0JA 1QKDA 1UG4A 2H7ZB 2MFAA 1ZADA 1ABTA 5EBXA 1CVOA 5DZ5A 1HC9A 1CXNA 2MHYA 2QJ9C 2UWRA 2UX2A 1IDGA 1CREA 1L4WA 4IYEA 4EY8B 1BTEA 1HOYA 1QM7A 1IDLA 2H64C 2MUPA 1LX5B 1CB9A 2MUOA 1KXIA 1KBTA 5IMYC 1KC4A 2N99A 3LAQU 3QB4B 4BIKB 1ERAA 1KBAA 1CRFA 5DO6A 1NYSA 5DU1A 1REWC 1CTXA 3NEQA 1CDSA 1CXOA 3EVSC 1HAJA 3PLCA 1TFSA 1NTXA 1F94A 1CDQA
chains in the Genus database with same CATH superfamily
3EBXA 1FRAA 1NYUA 2QJBC 2ABXA 3HH7A 2PJYC 3U73U 1IKCA 1ERGA 2ERAA 2GOOB 1CODA 4OM5A 1HAAA 1CHVS 1KU6B 2H7ZA 1RGJA 2CRTA 1LSIA 1KS6A 1FSSB 1TGXA 4DO8A 2MJ0A 3KFDE 4HQPF 1RL5A 4RUDA 2H8UA 5IMTD 3KFDI 2J8BA 1IQ9A 4P7UA 1VB0A 4BDTB 1LXGA 2HLQA 2CCXA 2I9BE 3U74U 1FF4A 1ES7B 2K3GA 2CDXA 1QKEA 3NH7A 1B41B 1S4YA 2H62C 6EBXA 2H62D 1TXBA 1FSCA 1KL8A 1PLOA 2LA1A 1V6PA 1LXHA 2MJYA 2BTXA 2NBTA 4OM4A 1JGKA 1HC9B 1FASA 2HLRA 1YWHA 3BT1U 3FEVA 3NDSA 1G6MA 1NTNA 2BHIA 1TXAA 2MJ4A 2X8BB 4UY2C 1NXBA 1NORA 1NEAA 1M9ZA 1KBSA 1XT3A 2H5FA 2JQPA 2L5SA 2LCRA 3ERAA 4LFTA 2OFSA 3VTSA 1I02A 2FD6U 1IDHA 2CRSA 1CCQA 1KFHA 2PJYB 3BT2U 1MAHF 4ZQYA 4FAOE 2L03A 4FAOC 2JVEA 2H64B 1F8UB 1COEA 2CTXA 1IDIA 2VLWA 1CDTA 2GOOC 2QC1A 4XJJA 1JE9A 1DRSA 1CDRA 1W6BA 1KTZB 1BXPA 4QTIU 1IJCA 1IK8A 1ONJA 1FFJA 1LJZA 4AEAA 1JBDA 2QJAC 1MR6A 1H0JA 1QKDA 1UG4A 2H7ZB 2MFAA 1ZADA 1ABTA 5EBXA 1CVOA 5DZ5A 1HC9A 1CXNA 2MHYA 2QJ9C 2UWRA 2UX2A 1IDGA 1CREA 1L4WA 4IYEA 4EY8B 1BTEA 1HOYA 1QM7A 1IDLA 2H64C 2MUPA 1LX5B 1CB9A 2MUOA 1KXIA 1KBTA 5IMYC 1KC4A 2N99A 3LAQU 3QB4B 4BIKB 1ERAA 1KBAA 1CRFA 5DO6A 1NYSA 5DU1A 1REWC 1CTXA 3NEQA 1CDSA 1CXOA 3EVSC 1HAJA 3PLCA 4KSNA 1TFSA 1NTXA 1F94A 1CDQA
chains in the Genus database with same CATH topology
3EBXA 1FRAA 1NYUA 2QJBC 2ABXA 3HH7A 2PJYC 3U73U 1IKCA 1ERGA 2ERAA 2GOOB 1CODA 4OM5A 1HAAA 1CHVS 1KU6B 2H7ZA 1RGJA 2CRTA 1LSIA 1KS6A 1FSSB 1TGXA 4DO8A 2MJ0A 3KFDE 4HQPF 1RL5A 4RUDA 2H8UA 5IMTD 3KFDI 2J8BA 1IQ9A 4P7UA 1VB0A 4BDTB 1LXGA 2HLQA 2CCXA 2I9BE 3U74U 1FF4A 1ES7B 2K3GA 2CDXA 1QKEA 3NH7A 1B41B 1S4YA 2H62C 6EBXA 2H62D 1TXBA 1FSCA 1KL8A 1PLOA 2LA1A 1V6PA 1LXHA 2MJYA 2BTXA 2NBTA 4OM4A 1JGKA 1HC9B 1FASA 2HLRA 1YWHA 3BT1U 3FEVA 3NDSA 1G6MA 1NTNA 2BHIA 1TXAA 2MJ4A 2X8BB 4UY2C 1NXBA 1NORA 1NEAA 1M9ZA 1KBSA 1XT3A 2H5FA 2JQPA 2L5SA 2LCRA 3ERAA 4LFTA 2OFSA 3VTSA 1I02A 2FD6U 1IDHA 2CRSA 1CCQA 1KFHA 2PJYB 3BT2U 1MAHF 4ZQYA 4FAOE 2L03A 4FAOC 2JVEA 2H64B 1F8UB 1COEA 2CTXA 1IDIA 2VLWA 1CDTA 2GOOC 2QC1A 4XJJA 1JE9A 1DRSA 1CDRA 1W6BA 1KTZB 1BXPA 4QTIU 1IJCA 1IK8A 1ONJA 1FFJA 1LJZA 4AEAA 1JBDA 2QJAC 1MR6A 1H0JA 1QKDA 1UG4A 2H7ZB 2MFAA 1ZADA 1ABTA 5EBXA 1CVOA 5DZ5A 1HC9A 1CXNA 2MHYA 2QJ9C 2UWRA 2UX2A 1IDGA 1CREA 1L4WA 4IYEA 4EY8B 1BTEA 1HOYA 1QM7A 1IDLA 2H64C 2MUPA 1LX5B 1CB9A 2MUOA 1KXIA 1KBTA 5IMYC 1KC4A 2N99A 3LAQU 3QB4B 4BIKB 1ERAA 1KBAA 1CRFA 5DO6A 1NYSA 5DU1A 1REWC 1CTXA 3NEQA 1CDSA 1CXOA 3EVSC 1HAJA 3PLCA 4KSNA 1TFSA 1NTXA 1F94A 1CDQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EBX A;  1FRA A;  1NYU A;  2QJB C;  2ABX A;  3HH7 A;  2PJY C;  3U73 U;  1IKC A;  1ERG A;  2ERA A;  2GOO B;  1COD A;  4OM5 A;  1HAA A;  1CHV S;  1KU6 B;  2H7Z A;  1RGJ A;  2CRT A;  1LSI A;  1KS6 A;  1FSS B;  1TGX A;  4DO8 A;  2MJ0 A;  3KFD E;  4HQP F;  1RL5 A;  4RUD A;  2H8U A;  5IMT D;  3KFD I;  2J8B A;  1IQ9 A;  4P7U A;  1VB0 A;  4BDT B;  1LXG A;  2HLQ A;  2CCX A;  2I9B E;  3U74 U;  1FF4 A;  1ES7 B;  2K3G A;  2CDX A;  1QKE A;  3NH7 A;  1B41 B;  1S4Y A;  2H62 C;  6EBX A;  2H62 D;  1TXB A;  1FSC A;  1KL8 A;  1PLO A;  2LA1 A;  1V6P A;  1LXH A;  2MJY A;  2BTX A;  2NBT A;  4OM4 A;  1JGK A;  1HC9 B;  1FAS A;  2HLR A;  1YWH A;  3BT1 U;  3FEV A;  3NDS A;  1G6M A;  1NTN A;  2BHI A;  1TXA A;  2MJ4 A;  2X8B B;  4UY2 C;  1NXB A;  1NOR A;  1NEA A;  1M9Z A;  1KBS A;  1XT3 A;  2H5F A;  2JQP A;  2L5S A;  2LCR A;  3ERA A;  4LFT A;  2OFS A;  3VTS A;  1I02 A;  2FD6 U;  1IDH A;  2CRS A;  1CCQ A;  1KFH A;  2PJY B;  3BT2 U;  1MAH F;  4ZQY A;  4FAO E;  2L03 A;  4FAO C;  2JVE A;  2H64 B;  1F8U B;  1COE A;  2CTX A;  1IDI A;  2VLW A;  1CDT A;  2GOO C;  2QC1 A;  4XJJ A;  1JE9 A;  1DRS A;  1CDR A;  1W6B A;  1KTZ B;  1BXP A;  4QTI U;  1IJC A;  1IK8 A;  1ONJ A;  1FFJ A;  1LJZ A;  4AEA A;  1JBD A;  2QJA C;  1MR6 A;  1H0J A;  1QKD A;  1UG4 A;  2H7Z B;  2MFA A;  1ZAD A;  1ABT A;  5EBX A;  1CVO A;  5DZ5 A;  1HC9 A;  1CXN A;  2MHY A;  2QJ9 C;  2UWR A;  2UX2 A;  1IDG A;  1CRE A;  1L4W A;  4IYE A;  4EY8 B;  1BTE A;  1HOY A;  1QM7 A;  1IDL A;  2H64 C;  2MUP A;  1LX5 B;  1CB9 A;  2MUO A;  1KXI A;  1KBT A;  5IMY C;  1KC4 A;  2N99 A;  3LAQ U;  3QB4 B;  4BIK B;  1ERA A;  1KBA A;  1CRF A;  5DO6 A;  1NYS A;  5DU1 A;  1REW C;  1CTX A;  3NEQ A;  1CDS A;  1CXO A;  3EVS C;  1HAJ A;  3PLC A;  1TFS A;  1NTX A;  1F94 A;  1CDQ A; 
#chains in the Genus database with same CATH topology
 3EBX A;  1FRA A;  1NYU A;  2QJB C;  2ABX A;  3HH7 A;  2PJY C;  3U73 U;  1IKC A;  1ERG A;  2ERA A;  2GOO B;  1COD A;  4OM5 A;  1HAA A;  1CHV S;  1KU6 B;  2H7Z A;  1RGJ A;  2CRT A;  1LSI A;  1KS6 A;  1FSS B;  1TGX A;  4DO8 A;  2MJ0 A;  3KFD E;  4HQP F;  1RL5 A;  4RUD A;  2H8U A;  5IMT D;  3KFD I;  2J8B A;  1IQ9 A;  4P7U A;  1VB0 A;  4BDT B;  1LXG A;  2HLQ A;  2CCX A;  2I9B E;  3U74 U;  1FF4 A;  1ES7 B;  2K3G A;  2CDX A;  1QKE A;  3NH7 A;  1B41 B;  1S4Y A;  2H62 C;  6EBX A;  2H62 D;  1TXB A;  1FSC A;  1KL8 A;  1PLO A;  2LA1 A;  1V6P A;  1LXH A;  2MJY A;  2BTX A;  2NBT A;  4OM4 A;  1JGK A;  1HC9 B;  1FAS A;  2HLR A;  1YWH A;  3BT1 U;  3FEV A;  3NDS A;  1G6M A;  1NTN A;  2BHI A;  1TXA A;  2MJ4 A;  2X8B B;  4UY2 C;  1NXB A;  1NOR A;  1NEA A;  1M9Z A;  1KBS A;  1XT3 A;  2H5F A;  2JQP A;  2L5S A;  2LCR A;  3ERA A;  4LFT A;  2OFS A;  3VTS A;  1I02 A;  2FD6 U;  1IDH A;  2CRS A;  1CCQ A;  1KFH A;  2PJY B;  3BT2 U;  1MAH F;  4ZQY A;  4FAO E;  2L03 A;  4FAO C;  2JVE A;  2H64 B;  1F8U B;  1COE A;  2CTX A;  1IDI A;  2VLW A;  1CDT A;  2GOO C;  2QC1 A;  4XJJ A;  1JE9 A;  1DRS A;  1CDR A;  1W6B A;  1KTZ B;  1BXP A;  4QTI U;  1IJC A;  1IK8 A;  1ONJ A;  1FFJ A;  1LJZ A;  4AEA A;  1JBD A;  2QJA C;  1MR6 A;  1H0J A;  1QKD A;  1UG4 A;  2H7Z B;  2MFA A;  1ZAD A;  1ABT A;  5EBX A;  1CVO A;  5DZ5 A;  1HC9 A;  1CXN A;  2MHY A;  2QJ9 C;  2UWR A;  2UX2 A;  1IDG A;  1CRE A;  1L4W A;  4IYE A;  4EY8 B;  1BTE A;  1HOY A;  1QM7 A;  1IDL A;  2H64 C;  2MUP A;  1LX5 B;  1CB9 A;  2MUO A;  1KXI A;  1KBT A;  5IMY C;  1KC4 A;  2N99 A;  3LAQ U;  3QB4 B;  4BIK B;  1ERA A;  1KBA A;  1CRF A;  5DO6 A;  1NYS A;  5DU1 A;  1REW C;  1CTX A;  3NEQ A;  1CDS A;  1CXO A;  3EVS C;  1HAJ A;  3PLC A;  4KSN A;  1TFS A;  1NTX A;  1F94 A;  1CDQ A; 
#chains in the Genus database with same CATH homology
 3EBX A;  1FRA A;  1NYU A;  2QJB C;  2ABX A;  3HH7 A;  2PJY C;  3U73 U;  1IKC A;  1ERG A;  2ERA A;  2GOO B;  1COD A;  4OM5 A;  1HAA A;  1CHV S;  1KU6 B;  2H7Z A;  1RGJ A;  2CRT A;  1LSI A;  1KS6 A;  1FSS B;  1TGX A;  4DO8 A;  2MJ0 A;  3KFD E;  4HQP F;  1RL5 A;  4RUD A;  2H8U A;  5IMT D;  3KFD I;  2J8B A;  1IQ9 A;  4P7U A;  1VB0 A;  4BDT B;  1LXG A;  2HLQ A;  2CCX A;  2I9B E;  3U74 U;  1FF4 A;  1ES7 B;  2K3G A;  2CDX A;  1QKE A;  3NH7 A;  1B41 B;  1S4Y A;  2H62 C;  6EBX A;  2H62 D;  1TXB A;  1FSC A;  1KL8 A;  1PLO A;  2LA1 A;  1V6P A;  1LXH A;  2MJY A;  2BTX A;  2NBT A;  4OM4 A;  1JGK A;  1HC9 B;  1FAS A;  2HLR A;  1YWH A;  3BT1 U;  3FEV A;  3NDS A;  1G6M A;  1NTN A;  2BHI A;  1TXA A;  2MJ4 A;  2X8B B;  4UY2 C;  1NXB A;  1NOR A;  1NEA A;  1M9Z A;  1KBS A;  1XT3 A;  2H5F A;  2JQP A;  2L5S A;  2LCR A;  3ERA A;  4LFT A;  2OFS A;  3VTS A;  1I02 A;  2FD6 U;  1IDH A;  2CRS A;  1CCQ A;  1KFH A;  2PJY B;  3BT2 U;  1MAH F;  4ZQY A;  4FAO E;  2L03 A;  4FAO C;  2JVE A;  2H64 B;  1F8U B;  1COE A;  2CTX A;  1IDI A;  2VLW A;  1CDT A;  2GOO C;  2QC1 A;  4XJJ A;  1JE9 A;  1DRS A;  1CDR A;  1W6B A;  1KTZ B;  1BXP A;  4QTI U;  1IJC A;  1IK8 A;  1ONJ A;  1FFJ A;  1LJZ A;  4AEA A;  1JBD A;  2QJA C;  1MR6 A;  1H0J A;  1QKD A;  1UG4 A;  2H7Z B;  2MFA A;  1ZAD A;  1ABT A;  5EBX A;  1CVO A;  5DZ5 A;  1HC9 A;  1CXN A;  2MHY A;  2QJ9 C;  2UWR A;  2UX2 A;  1IDG A;  1CRE A;  1L4W A;  4IYE A;  4EY8 B;  1BTE A;  1HOY A;  1QM7 A;  1IDL A;  2H64 C;  2MUP A;  1LX5 B;  1CB9 A;  2MUO A;  1KXI A;  1KBT A;  5IMY C;  1KC4 A;  2N99 A;  3LAQ U;  3QB4 B;  4BIK B;  1ERA A;  1KBA A;  1CRF A;  5DO6 A;  1NYS A;  5DU1 A;  1REW C;  1CTX A;  3NEQ A;  1CDS A;  1CXO A;  3EVS C;  1HAJ A;  3PLC A;  4KSN A;  1TFS A;  1NTX A;  1F94 A;  1CDQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...