2MHYA

Structure determination of the salamander courtship pheromone plethodontid modulating factor
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
57
structure length
57
Chain Sequence
LQCNTLDGGTEECIPGIYNVCVHYKSEDEEYKSCGIQEECEDAEGATVLCCPEDLCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plethodontid modulating factor
publication title Structural insights into the evolution of a sexy protein: novel topology and restricted backbone flexibility in a hypervariable pheromone from the red-legged salamander, Plethodon shermani.
pubmed doi rcsb
source organism Plethodon shermani
molecule tags Signaling protein
total genus 5
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2013-12-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2mhyA00
4RUDA 1IKCA 2GOOC 1V6PA 2H5FA 2H8UA 2X8BB 2ABXA 5EBXA 4DO8A 1NTXA 1PLOA 2QC1A 2BHIA 2N99A 1I02A 2MJ0A 1FRAA 1FSCA 1LJZA 1ZADA 2JQPA 2PJYB 1HOYA 1IQ9A 1JGKA 1CDSA 1RGJA 3NDSA 2MUOA 3KFDI 4OM5A 3BT1U 5DU1A 2J8BA 1LXGA 1YWHA 3NH7A 2H62D 2CCXA 2H7ZA 1HC9B 1IDIA 2MHYA 1HAJA 1LXHA 1NYSA 3VTSA 1HC9A 5IMYC 4XJJA 2NBTA 3EBXA 2UX2A 1IDLA 1CTXA 1JE9A 2H64B 1F94A 2CRTA 1CCQA 3U73U 2QJAC 3EVSC 1CB9A 2MJYA 2H64C 4AEAA 1CVOA 2ERAA 2LA1A 2QJ9C 3NEQA 1DRSA 1QKDA 3QB4B 3KFDE 4LFTA 2CDXA 1S4YA 1NYUA 2LCRA 1IJCA 1FSSB 1FF4A 1KBSA 1NTNA 2MUPA 1REWC 4OM4A 1H0JA 1TFSA 1CRFA 2H7ZB 3U74U 2UWRA 1TXBA 1HAAA 1UG4A 1TXAA 1VB0A 2JVEA 2L5SA 1RL5A 2L03A 2QJBC 2VLWA 4HQPF 5IMTD 4FAOC 1CDQA 3LAQU 1CXNA 5DO6A 6EBXA 1CODA 2BTXA 2FD6U 3ERAA 4BIKB 1F8UB 1KU6B 1G6MA 3HH7A 4ZQYA 1L4WA 3BT2U 2HLRA 1KS6A 2K3GA 4IYEA 1IDGA 1KL8A 1KTZB 2MFAA 1CDRA 1KBTA 4EY8B 1TGXA 1CHVS 1ERAA 2H62C 1IK8A 4UY2C 1FFJA 1IDHA 1B41B 1ERGA 1CXOA 1QKEA 2MJ4A 1KFHA 1ONJA 1CDTA 1KC4A 3FEVA 1XT3A 2HLQA 1BTEA 1CREA 1KXIA 5DZ5A 1NXBA 4FAOE 1ABTA 1W6BA 1ES7B 1NORA 1MR6A 2CRSA 2PJYC 1NEAA 1QM7A 4P7UA 1JBDA 2I9BE 1KBAA 1LSIA 2OFSA 4QTIU 1BXPA 1LX5B 1FASA 2CTXA 2GOOB 3PLCA 1M9ZA 1MAHF 4BDTB 1COEA
chains in the Genus database with same CATH superfamily
4RUDA 1IKCA 2GOOC 1V6PA 2H5FA 2H8UA 2X8BB 2ABXA 5EBXA 4DO8A 1NTXA 1PLOA 2QC1A 2BHIA 2N99A 1I02A 2MJ0A 1FRAA 1FSCA 1LJZA 1ZADA 2JQPA 2PJYB 1HOYA 1IQ9A 1JGKA 1CDSA 1RGJA 3NDSA 2MUOA 3KFDI 4OM5A 3BT1U 5DU1A 2J8BA 1LXGA 1YWHA 3NH7A 2H62D 2CCXA 2H7ZA 1HC9B 1IDIA 2MHYA 1HAJA 1LXHA 1NYSA 3VTSA 1HC9A 5IMYC 4XJJA 2NBTA 3EBXA 2UX2A 1IDLA 1CTXA 1JE9A 2H64B 1F94A 2CRTA 1CCQA 3U73U 2QJAC 3EVSC 1CB9A 2MJYA 2H64C 4AEAA 1CVOA 2ERAA 2LA1A 2QJ9C 3NEQA 1DRSA 1QKDA 3QB4B 3KFDE 4LFTA 2CDXA 1S4YA 1NYUA 2LCRA 1IJCA 1FSSB 1FF4A 1KBSA 1NTNA 2MUPA 1REWC 4OM4A 1H0JA 1TFSA 1CRFA 2H7ZB 3U74U 2UWRA 1TXBA 1HAAA 1UG4A 1TXAA 1VB0A 2JVEA 2L5SA 1RL5A 2L03A 2QJBC 2VLWA 4HQPF 5IMTD 4FAOC 1CDQA 3LAQU 1CXNA 5DO6A 6EBXA 1CODA 2BTXA 2FD6U 3ERAA 4BIKB 1F8UB 1KU6B 1G6MA 3HH7A 4ZQYA 1L4WA 3BT2U 2HLRA 1KS6A 4KSNA 2K3GA 4IYEA 1IDGA 1KL8A 1KTZB 2MFAA 1CDRA 1KBTA 4EY8B 1TGXA 1CHVS 1ERAA 2H62C 1IK8A 4UY2C 1FFJA 1IDHA 1B41B 1ERGA 1CXOA 1QKEA 2MJ4A 1KFHA 1ONJA 1CDTA 1KC4A 3FEVA 1XT3A 2HLQA 1BTEA 1CREA 1KXIA 5DZ5A 1NXBA 4FAOE 1ABTA 1W6BA 1ES7B 1NORA 1MR6A 2CRSA 2PJYC 1NEAA 1QM7A 4P7UA 1JBDA 2I9BE 1KBAA 1LSIA 2OFSA 4QTIU 1BXPA 1LX5B 1FASA 2CTXA 2GOOB 3PLCA 1M9ZA 1MAHF 4BDTB 1COEA
chains in the Genus database with same CATH topology
4RUDA 1IKCA 2GOOC 1V6PA 2H5FA 2H8UA 2X8BB 2ABXA 5EBXA 4DO8A 1NTXA 1PLOA 2QC1A 2BHIA 2N99A 1I02A 2MJ0A 1FRAA 1FSCA 1LJZA 1ZADA 2JQPA 2PJYB 1HOYA 1IQ9A 1JGKA 1CDSA 1RGJA 3NDSA 2MUOA 3KFDI 4OM5A 3BT1U 5DU1A 2J8BA 1LXGA 1YWHA 3NH7A 2H62D 2CCXA 2H7ZA 1HC9B 1IDIA 2MHYA 1HAJA 1LXHA 1NYSA 3VTSA 1HC9A 5IMYC 4XJJA 2NBTA 3EBXA 2UX2A 1IDLA 1CTXA 1JE9A 2H64B 1F94A 2CRTA 1CCQA 3U73U 2QJAC 3EVSC 1CB9A 2MJYA 2H64C 4AEAA 1CVOA 2ERAA 2LA1A 2QJ9C 3NEQA 1DRSA 1QKDA 3QB4B 3KFDE 4LFTA 2CDXA 1S4YA 1NYUA 2LCRA 1IJCA 1FSSB 1FF4A 1KBSA 1NTNA 2MUPA 1REWC 4OM4A 1H0JA 1TFSA 1CRFA 2H7ZB 3U74U 2UWRA 1TXBA 1HAAA 1UG4A 1TXAA 1VB0A 2JVEA 2L5SA 1RL5A 2L03A 2QJBC 2VLWA 4HQPF 5IMTD 4FAOC 1CDQA 3LAQU 1CXNA 5DO6A 6EBXA 1CODA 2BTXA 2FD6U 3ERAA 4BIKB 1F8UB 1KU6B 1G6MA 3HH7A 4ZQYA 1L4WA 3BT2U 2HLRA 1KS6A 4KSNA 2K3GA 4IYEA 1IDGA 1KL8A 1KTZB 2MFAA 1CDRA 1KBTA 4EY8B 1TGXA 1CHVS 1ERAA 2H62C 1IK8A 4UY2C 1FFJA 1IDHA 1B41B 1ERGA 1CXOA 1QKEA 2MJ4A 1KFHA 1ONJA 1CDTA 1KC4A 3FEVA 1XT3A 2HLQA 1BTEA 1CREA 1KXIA 5DZ5A 1NXBA 4FAOE 1ABTA 1W6BA 1ES7B 1NORA 1MR6A 2CRSA 2PJYC 1NEAA 1QM7A 4P7UA 1JBDA 2I9BE 1KBAA 1LSIA 2OFSA 4QTIU 1BXPA 1LX5B 1FASA 2CTXA 2GOOB 3PLCA 1M9ZA 1MAHF 4BDTB 1COEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RUD A;  1IKC A;  2GOO C;  1V6P A;  2H5F A;  2H8U A;  2X8B B;  2ABX A;  5EBX A;  4DO8 A;  1NTX A;  1PLO A;  2QC1 A;  2BHI A;  2N99 A;  1I02 A;  2MJ0 A;  1FRA A;  1FSC A;  1LJZ A;  1ZAD A;  2JQP A;  2PJY B;  1HOY A;  1IQ9 A;  1JGK A;  1CDS A;  1RGJ A;  3NDS A;  2MUO A;  3KFD I;  4OM5 A;  3BT1 U;  5DU1 A;  2J8B A;  1LXG A;  1YWH A;  3NH7 A;  2H62 D;  2CCX A;  2H7Z A;  1HC9 B;  1IDI A;  2MHY A;  1HAJ A;  1LXH A;  1NYS A;  3VTS A;  1HC9 A;  5IMY C;  4XJJ A;  2NBT A;  3EBX A;  2UX2 A;  1IDL A;  1CTX A;  1JE9 A;  2H64 B;  1F94 A;  2CRT A;  1CCQ A;  3U73 U;  2QJA C;  3EVS C;  1CB9 A;  2MJY A;  2H64 C;  4AEA A;  1CVO A;  2ERA A;  2LA1 A;  2QJ9 C;  3NEQ A;  1DRS A;  1QKD A;  3QB4 B;  3KFD E;  4LFT A;  2CDX A;  1S4Y A;  1NYU A;  2LCR A;  1IJC A;  1FSS B;  1FF4 A;  1KBS A;  1NTN A;  2MUP A;  1REW C;  4OM4 A;  1H0J A;  1TFS A;  1CRF A;  2H7Z B;  3U74 U;  2UWR A;  1TXB A;  1HAA A;  1UG4 A;  1TXA A;  1VB0 A;  2JVE A;  2L5S A;  1RL5 A;  2L03 A;  2QJB C;  2VLW A;  4HQP F;  5IMT D;  4FAO C;  1CDQ A;  3LAQ U;  1CXN A;  5DO6 A;  6EBX A;  1COD A;  2BTX A;  2FD6 U;  3ERA A;  4BIK B;  1F8U B;  1KU6 B;  1G6M A;  3HH7 A;  4ZQY A;  1L4W A;  3BT2 U;  2HLR A;  1KS6 A;  2K3G A;  4IYE A;  1IDG A;  1KL8 A;  1KTZ B;  2MFA A;  1CDR A;  1KBT A;  4EY8 B;  1TGX A;  1CHV S;  1ERA A;  2H62 C;  1IK8 A;  4UY2 C;  1FFJ A;  1IDH A;  1B41 B;  1ERG A;  1CXO A;  1QKE A;  2MJ4 A;  1KFH A;  1ONJ A;  1CDT A;  1KC4 A;  3FEV A;  1XT3 A;  2HLQ A;  1BTE A;  1CRE A;  1KXI A;  5DZ5 A;  1NXB A;  4FAO E;  1ABT A;  1W6B A;  1ES7 B;  1NOR A;  1MR6 A;  2CRS A;  2PJY C;  1NEA A;  1QM7 A;  4P7U A;  1JBD A;  2I9B E;  1KBA A;  1LSI A;  2OFS A;  4QTI U;  1BXP A;  1LX5 B;  1FAS A;  2CTX A;  2GOO B;  3PLC A;  1M9Z A;  1MAH F;  4BDT B;  1COE A; 
#chains in the Genus database with same CATH topology
 4RUD A;  1IKC A;  2GOO C;  1V6P A;  2H5F A;  2H8U A;  2X8B B;  2ABX A;  5EBX A;  4DO8 A;  1NTX A;  1PLO A;  2QC1 A;  2BHI A;  2N99 A;  1I02 A;  2MJ0 A;  1FRA A;  1FSC A;  1LJZ A;  1ZAD A;  2JQP A;  2PJY B;  1HOY A;  1IQ9 A;  1JGK A;  1CDS A;  1RGJ A;  3NDS A;  2MUO A;  3KFD I;  4OM5 A;  3BT1 U;  5DU1 A;  2J8B A;  1LXG A;  1YWH A;  3NH7 A;  2H62 D;  2CCX A;  2H7Z A;  1HC9 B;  1IDI A;  2MHY A;  1HAJ A;  1LXH A;  1NYS A;  3VTS A;  1HC9 A;  5IMY C;  4XJJ A;  2NBT A;  3EBX A;  2UX2 A;  1IDL A;  1CTX A;  1JE9 A;  2H64 B;  1F94 A;  2CRT A;  1CCQ A;  3U73 U;  2QJA C;  3EVS C;  1CB9 A;  2MJY A;  2H64 C;  4AEA A;  1CVO A;  2ERA A;  2LA1 A;  2QJ9 C;  3NEQ A;  1DRS A;  1QKD A;  3QB4 B;  3KFD E;  4LFT A;  2CDX A;  1S4Y A;  1NYU A;  2LCR A;  1IJC A;  1FSS B;  1FF4 A;  1KBS A;  1NTN A;  2MUP A;  1REW C;  4OM4 A;  1H0J A;  1TFS A;  1CRF A;  2H7Z B;  3U74 U;  2UWR A;  1TXB A;  1HAA A;  1UG4 A;  1TXA A;  1VB0 A;  2JVE A;  2L5S A;  1RL5 A;  2L03 A;  2QJB C;  2VLW A;  4HQP F;  5IMT D;  4FAO C;  1CDQ A;  3LAQ U;  1CXN A;  5DO6 A;  6EBX A;  1COD A;  2BTX A;  2FD6 U;  3ERA A;  4BIK B;  1F8U B;  1KU6 B;  1G6M A;  3HH7 A;  4ZQY A;  1L4W A;  3BT2 U;  2HLR A;  1KS6 A;  4KSN A;  2K3G A;  4IYE A;  1IDG A;  1KL8 A;  1KTZ B;  2MFA A;  1CDR A;  1KBT A;  4EY8 B;  1TGX A;  1CHV S;  1ERA A;  2H62 C;  1IK8 A;  4UY2 C;  1FFJ A;  1IDH A;  1B41 B;  1ERG A;  1CXO A;  1QKE A;  2MJ4 A;  1KFH A;  1ONJ A;  1CDT A;  1KC4 A;  3FEV A;  1XT3 A;  2HLQ A;  1BTE A;  1CRE A;  1KXI A;  5DZ5 A;  1NXB A;  4FAO E;  1ABT A;  1W6B A;  1ES7 B;  1NOR A;  1MR6 A;  2CRS A;  2PJY C;  1NEA A;  1QM7 A;  4P7U A;  1JBD A;  2I9B E;  1KBA A;  1LSI A;  2OFS A;  4QTI U;  1BXP A;  1LX5 B;  1FAS A;  2CTX A;  2GOO B;  3PLC A;  1M9Z A;  1MAH F;  4BDT B;  1COE A; 
#chains in the Genus database with same CATH homology
 4RUD A;  1IKC A;  2GOO C;  1V6P A;  2H5F A;  2H8U A;  2X8B B;  2ABX A;  5EBX A;  4DO8 A;  1NTX A;  1PLO A;  2QC1 A;  2BHI A;  2N99 A;  1I02 A;  2MJ0 A;  1FRA A;  1FSC A;  1LJZ A;  1ZAD A;  2JQP A;  2PJY B;  1HOY A;  1IQ9 A;  1JGK A;  1CDS A;  1RGJ A;  3NDS A;  2MUO A;  3KFD I;  4OM5 A;  3BT1 U;  5DU1 A;  2J8B A;  1LXG A;  1YWH A;  3NH7 A;  2H62 D;  2CCX A;  2H7Z A;  1HC9 B;  1IDI A;  2MHY A;  1HAJ A;  1LXH A;  1NYS A;  3VTS A;  1HC9 A;  5IMY C;  4XJJ A;  2NBT A;  3EBX A;  2UX2 A;  1IDL A;  1CTX A;  1JE9 A;  2H64 B;  1F94 A;  2CRT A;  1CCQ A;  3U73 U;  2QJA C;  3EVS C;  1CB9 A;  2MJY A;  2H64 C;  4AEA A;  1CVO A;  2ERA A;  2LA1 A;  2QJ9 C;  3NEQ A;  1DRS A;  1QKD A;  3QB4 B;  3KFD E;  4LFT A;  2CDX A;  1S4Y A;  1NYU A;  2LCR A;  1IJC A;  1FSS B;  1FF4 A;  1KBS A;  1NTN A;  2MUP A;  1REW C;  4OM4 A;  1H0J A;  1TFS A;  1CRF A;  2H7Z B;  3U74 U;  2UWR A;  1TXB A;  1HAA A;  1UG4 A;  1TXA A;  1VB0 A;  2JVE A;  2L5S A;  1RL5 A;  2L03 A;  2QJB C;  2VLW A;  4HQP F;  5IMT D;  4FAO C;  1CDQ A;  3LAQ U;  1CXN A;  5DO6 A;  6EBX A;  1COD A;  2BTX A;  2FD6 U;  3ERA A;  4BIK B;  1F8U B;  1KU6 B;  1G6M A;  3HH7 A;  4ZQY A;  1L4W A;  3BT2 U;  2HLR A;  1KS6 A;  4KSN A;  2K3G A;  4IYE A;  1IDG A;  1KL8 A;  1KTZ B;  2MFA A;  1CDR A;  1KBT A;  4EY8 B;  1TGX A;  1CHV S;  1ERA A;  2H62 C;  1IK8 A;  4UY2 C;  1FFJ A;  1IDH A;  1B41 B;  1ERG A;  1CXO A;  1QKE A;  2MJ4 A;  1KFH A;  1ONJ A;  1CDT A;  1KC4 A;  3FEV A;  1XT3 A;  2HLQ A;  1BTE A;  1CRE A;  1KXI A;  5DZ5 A;  1NXB A;  4FAO E;  1ABT A;  1W6B A;  1ES7 B;  1NOR A;  1MR6 A;  2CRS A;  2PJY C;  1NEA A;  1QM7 A;  4P7U A;  1JBD A;  2I9B E;  1KBA A;  1LSI A;  2OFS A;  4QTI U;  1BXP A;  1LX5 B;  1FAS A;  2CTX A;  2GOO B;  3PLC A;  1M9Z A;  1MAH F;  4BDT B;  1COE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...