2MHYA

Structure determination of the salamander courtship pheromone plethodontid modulating factor
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
57
structure length
57
Chain Sequence
LQCNTLDGGTEECIPGIYNVCVHYKSEDEEYKSCGIQEECEDAEGATVLCCPEDLCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Plethodontid modulating factor
publication title Structural insights into the evolution of a sexy protein: novel topology and restricted backbone flexibility in a hypervariable pheromone from the red-legged salamander, Plethodon shermani.
pubmed doi rcsb
source organism Plethodon shermani
total genus 5
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2013-12-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2mhyA00
4DO8A 1TXAA 2L03A 2BTXA 1TXBA 4XJJA 2CRTA 3U73U 2GOOB 1ES7B 3ERAA 2MJ0A 1UG4A 1QM7A 1YWHA 1IDLA 1S4YA 1CXNA 5DZ5A 1LXHA 3NDSA 3LAQU 1CB9A 1CDRA 3EBXA 1G6MA 1I02A 2UWRA 2QC1A 2MHYA 4FAOC 2MFAA 2H7ZB 1H0JA 1LSIA 2VLWA 2JQPA 2OFSA 1KXIA 4QTIU 1W6BA 2HLRA 2K3GA 2H62D 2ABXA 2LCRA 2H8UA 1QKDA 5IMYC 1HC9B 1LJZA 2CCXA 1IQ9A 1HAAA 1COEA 4UY2C 3QB4B 3U74U 1BXPA 4OM5A 2X8BB 4P7UA 4ZQYA 1KBSA 1IDIA 1JGKA 1KFHA 2ERAA 2LA1A 3KFDE 1KU6B 2JVEA 3HH7A 3NH7A 2H64B 2PJYC 1IDGA 1F94A 1PLOA 5DO6A 1L4WA 4EY8B 1IJCA 1FRAA 1NEAA 2GOOC 1CXOA 1CDTA 5IMTD 1CTXA 1ERGA 1FASA 1IK8A 1FSCA 1F8UB 3BT2U 1KBAA 1CCQA 2MUPA 4IYEA 2PJYB 1HC9A 1CREA 1VB0A 5EBXA 2QJBC 2L5SA 1CDSA 2UX2A 4OM4A 2H64C 1FFJA 3FEVA 1TFSA 1KC4A 2HLQA 1NTNA 1BTEA 1ONJA 3EVSC 4BIKB 4FAOE 1KL8A 1IDHA 1ABTA 1XT3A 1ERAA 2CTXA 3PLCA 2QJAC 1NXBA 1NORA 4HQPF 1HAJA 2J8BA 1KS6A 1IKCA 1DRSA 1M9ZA 1RGJA 4LFTA 2H7ZA 1MAHF 1REWC 4BDTB 1NYUA 2MJ4A 1HOYA 1KBTA 2N99A 3BT1U 3KFDI 1QKEA 1V6PA 2CDXA 2H62C 4RUDA 1NTXA 1KTZB 1LX5B 2CRSA 1RL5A 1LXGA 5DU1A 4AEAA 1ZADA 2NBTA 6EBXA 1FSSB 1JE9A 2QJ9C 1FF4A 1CRFA 1TGXA 1CODA 1CDQA 1CVOA 2I9BE 3VTSA 2MUOA 1JBDA 3NEQA 1B41B 1MR6A 2H5FA 1NYSA 2BHIA 2MJYA 1CHVS 2FD6U
chains in the Genus database with same CATH superfamily
4DO8A 1TXAA 2L03A 2BTXA 1TXBA 4XJJA 2CRTA 3U73U 2GOOB 1ES7B 3ERAA 2MJ0A 1UG4A 1QM7A 1YWHA 1IDLA 1S4YA 1CXNA 5DZ5A 1LXHA 3NDSA 3LAQU 1CB9A 1CDRA 3EBXA 1G6MA 1I02A 2UWRA 2QC1A 4KSNA 2MHYA 4FAOC 2MFAA 2H7ZB 1H0JA 1LSIA 2VLWA 2JQPA 2OFSA 1KXIA 4QTIU 1W6BA 2HLRA 2K3GA 2H62D 2ABXA 2LCRA 2H8UA 1QKDA 5IMYC 1HC9B 1LJZA 2CCXA 1IQ9A 1HAAA 1COEA 4UY2C 3QB4B 3U74U 1BXPA 4OM5A 2X8BB 4P7UA 4ZQYA 1KBSA 1IDIA 1JGKA 1KFHA 2ERAA 2LA1A 3KFDE 1KU6B 2JVEA 3HH7A 3NH7A 2H64B 2PJYC 1IDGA 1F94A 1PLOA 5DO6A 1L4WA 4EY8B 1IJCA 1FRAA 1NEAA 2GOOC 1CXOA 1CDTA 5IMTD 1CTXA 1ERGA 1FASA 1IK8A 1FSCA 1F8UB 3BT2U 1KBAA 1CCQA 2MUPA 4IYEA 2PJYB 1HC9A 1CREA 1VB0A 5EBXA 2QJBC 2L5SA 1CDSA 2UX2A 4OM4A 2H64C 1FFJA 3FEVA 1TFSA 1KC4A 2HLQA 1NTNA 1BTEA 1ONJA 3EVSC 4BIKB 4FAOE 1KL8A 1IDHA 1ABTA 1XT3A 1ERAA 2CTXA 3PLCA 2QJAC 1NXBA 1NORA 4HQPF 1HAJA 2J8BA 1KS6A 1IKCA 1DRSA 1M9ZA 1RGJA 4LFTA 2H7ZA 1MAHF 1REWC 4BDTB 1NYUA 2MJ4A 1HOYA 1KBTA 2N99A 3BT1U 3KFDI 1QKEA 1V6PA 2CDXA 2H62C 4RUDA 1NTXA 1KTZB 1LX5B 2CRSA 1RL5A 1LXGA 5DU1A 4AEAA 1ZADA 2NBTA 6EBXA 1FSSB 1JE9A 2QJ9C 1FF4A 1CRFA 1TGXA 1CODA 1CDQA 1CVOA 2I9BE 3VTSA 2MUOA 1JBDA 3NEQA 1B41B 1MR6A 2H5FA 1NYSA 2BHIA 2MJYA 1CHVS 2FD6U
chains in the Genus database with same CATH topology
4DO8A 1TXAA 2L03A 2BTXA 1TXBA 4XJJA 2CRTA 3U73U 2GOOB 1ES7B 3ERAA 2MJ0A 1UG4A 1QM7A 1YWHA 1IDLA 1S4YA 1CXNA 5DZ5A 1LXHA 3NDSA 3LAQU 1CB9A 1CDRA 3EBXA 1G6MA 1I02A 2UWRA 2QC1A 4KSNA 2MHYA 4FAOC 2MFAA 2H7ZB 1H0JA 1LSIA 2VLWA 2JQPA 2OFSA 1KXIA 4QTIU 1W6BA 2HLRA 2K3GA 2H62D 2ABXA 2LCRA 2H8UA 1QKDA 5IMYC 1HC9B 1LJZA 2CCXA 1IQ9A 1HAAA 1COEA 4UY2C 3QB4B 3U74U 1BXPA 4OM5A 2X8BB 4P7UA 4ZQYA 1KBSA 1IDIA 1JGKA 1KFHA 2ERAA 2LA1A 3KFDE 1KU6B 2JVEA 3HH7A 3NH7A 2H64B 2PJYC 1IDGA 1F94A 1PLOA 5DO6A 1L4WA 4EY8B 1IJCA 1FRAA 1NEAA 2GOOC 1CXOA 1CDTA 5IMTD 1CTXA 1ERGA 1FASA 1IK8A 1FSCA 1F8UB 3BT2U 1KBAA 1CCQA 2MUPA 4IYEA 2PJYB 1HC9A 1CREA 1VB0A 5EBXA 2QJBC 2L5SA 1CDSA 2UX2A 4OM4A 2H64C 1FFJA 3FEVA 1TFSA 1KC4A 2HLQA 1NTNA 1BTEA 1ONJA 3EVSC 4BIKB 4FAOE 1KL8A 1IDHA 1ABTA 1XT3A 1ERAA 2CTXA 3PLCA 2QJAC 1NXBA 1NORA 4HQPF 1HAJA 2J8BA 1KS6A 1IKCA 1DRSA 1M9ZA 1RGJA 4LFTA 2H7ZA 1MAHF 1REWC 4BDTB 1NYUA 2MJ4A 1HOYA 1KBTA 2N99A 3BT1U 3KFDI 1QKEA 1V6PA 2CDXA 2H62C 4RUDA 1NTXA 1KTZB 1LX5B 2CRSA 1RL5A 1LXGA 5DU1A 4AEAA 1ZADA 2NBTA 6EBXA 1FSSB 1JE9A 2QJ9C 1FF4A 1CRFA 1TGXA 1CODA 1CDQA 1CVOA 2I9BE 3VTSA 2MUOA 1JBDA 3NEQA 1B41B 1MR6A 2H5FA 1NYSA 2BHIA 2MJYA 1CHVS 2FD6U
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DO8 A;  1TXA A;  2L03 A;  2BTX A;  1TXB A;  4XJJ A;  2CRT A;  3U73 U;  2GOO B;  1ES7 B;  3ERA A;  2MJ0 A;  1UG4 A;  1QM7 A;  1YWH A;  1IDL A;  1S4Y A;  1CXN A;  5DZ5 A;  1LXH A;  3NDS A;  3LAQ U;  1CB9 A;  1CDR A;  3EBX A;  1G6M A;  1I02 A;  2UWR A;  2QC1 A;  2MHY A;  4FAO C;  2MFA A;  2H7Z B;  1H0J A;  1LSI A;  2VLW A;  2JQP A;  2OFS A;  1KXI A;  4QTI U;  1W6B A;  2HLR A;  2K3G A;  2H62 D;  2ABX A;  2LCR A;  2H8U A;  1QKD A;  5IMY C;  1HC9 B;  1LJZ A;  2CCX A;  1IQ9 A;  1HAA A;  1COE A;  4UY2 C;  3QB4 B;  3U74 U;  1BXP A;  4OM5 A;  2X8B B;  4P7U A;  4ZQY A;  1KBS A;  1IDI A;  1JGK A;  1KFH A;  2ERA A;  2LA1 A;  3KFD E;  1KU6 B;  2JVE A;  3HH7 A;  3NH7 A;  2H64 B;  2PJY C;  1IDG A;  1F94 A;  1PLO A;  5DO6 A;  1L4W A;  4EY8 B;  1IJC A;  1FRA A;  1NEA A;  2GOO C;  1CXO A;  1CDT A;  5IMT D;  1CTX A;  1ERG A;  1FAS A;  1IK8 A;  1FSC A;  1F8U B;  3BT2 U;  1KBA A;  1CCQ A;  2MUP A;  4IYE A;  2PJY B;  1HC9 A;  1CRE A;  1VB0 A;  5EBX A;  2QJB C;  2L5S A;  1CDS A;  2UX2 A;  4OM4 A;  2H64 C;  1FFJ A;  3FEV A;  1TFS A;  1KC4 A;  2HLQ A;  1NTN A;  1BTE A;  1ONJ A;  3EVS C;  4BIK B;  4FAO E;  1KL8 A;  1IDH A;  1ABT A;  1XT3 A;  1ERA A;  2CTX A;  3PLC A;  2QJA C;  1NXB A;  1NOR A;  4HQP F;  1HAJ A;  2J8B A;  1KS6 A;  1IKC A;  1DRS A;  1M9Z A;  1RGJ A;  4LFT A;  2H7Z A;  1MAH F;  1REW C;  4BDT B;  1NYU A;  2MJ4 A;  1HOY A;  1KBT A;  2N99 A;  3BT1 U;  3KFD I;  1QKE A;  1V6P A;  2CDX A;  2H62 C;  4RUD A;  1NTX A;  1KTZ B;  1LX5 B;  2CRS A;  1RL5 A;  1LXG A;  5DU1 A;  4AEA A;  1ZAD A;  2NBT A;  6EBX A;  1FSS B;  1JE9 A;  2QJ9 C;  1FF4 A;  1CRF A;  1TGX A;  1COD A;  1CDQ A;  1CVO A;  2I9B E;  3VTS A;  2MUO A;  1JBD A;  3NEQ A;  1B41 B;  1MR6 A;  2H5F A;  1NYS A;  2BHI A;  2MJY A;  1CHV S;  2FD6 U; 
#chains in the Genus database with same CATH topology
 4DO8 A;  1TXA A;  2L03 A;  2BTX A;  1TXB A;  4XJJ A;  2CRT A;  3U73 U;  2GOO B;  1ES7 B;  3ERA A;  2MJ0 A;  1UG4 A;  1QM7 A;  1YWH A;  1IDL A;  1S4Y A;  1CXN A;  5DZ5 A;  1LXH A;  3NDS A;  3LAQ U;  1CB9 A;  1CDR A;  3EBX A;  1G6M A;  1I02 A;  2UWR A;  2QC1 A;  4KSN A;  2MHY A;  4FAO C;  2MFA A;  2H7Z B;  1H0J A;  1LSI A;  2VLW A;  2JQP A;  2OFS A;  1KXI A;  4QTI U;  1W6B A;  2HLR A;  2K3G A;  2H62 D;  2ABX A;  2LCR A;  2H8U A;  1QKD A;  5IMY C;  1HC9 B;  1LJZ A;  2CCX A;  1IQ9 A;  1HAA A;  1COE A;  4UY2 C;  3QB4 B;  3U74 U;  1BXP A;  4OM5 A;  2X8B B;  4P7U A;  4ZQY A;  1KBS A;  1IDI A;  1JGK A;  1KFH A;  2ERA A;  2LA1 A;  3KFD E;  1KU6 B;  2JVE A;  3HH7 A;  3NH7 A;  2H64 B;  2PJY C;  1IDG A;  1F94 A;  1PLO A;  5DO6 A;  1L4W A;  4EY8 B;  1IJC A;  1FRA A;  1NEA A;  2GOO C;  1CXO A;  1CDT A;  5IMT D;  1CTX A;  1ERG A;  1FAS A;  1IK8 A;  1FSC A;  1F8U B;  3BT2 U;  1KBA A;  1CCQ A;  2MUP A;  4IYE A;  2PJY B;  1HC9 A;  1CRE A;  1VB0 A;  5EBX A;  2QJB C;  2L5S A;  1CDS A;  2UX2 A;  4OM4 A;  2H64 C;  1FFJ A;  3FEV A;  1TFS A;  1KC4 A;  2HLQ A;  1NTN A;  1BTE A;  1ONJ A;  3EVS C;  4BIK B;  4FAO E;  1KL8 A;  1IDH A;  1ABT A;  1XT3 A;  1ERA A;  2CTX A;  3PLC A;  2QJA C;  1NXB A;  1NOR A;  4HQP F;  1HAJ A;  2J8B A;  1KS6 A;  1IKC A;  1DRS A;  1M9Z A;  1RGJ A;  4LFT A;  2H7Z A;  1MAH F;  1REW C;  4BDT B;  1NYU A;  2MJ4 A;  1HOY A;  1KBT A;  2N99 A;  3BT1 U;  3KFD I;  1QKE A;  1V6P A;  2CDX A;  2H62 C;  4RUD A;  1NTX A;  1KTZ B;  1LX5 B;  2CRS A;  1RL5 A;  1LXG A;  5DU1 A;  4AEA A;  1ZAD A;  2NBT A;  6EBX A;  1FSS B;  1JE9 A;  2QJ9 C;  1FF4 A;  1CRF A;  1TGX A;  1COD A;  1CDQ A;  1CVO A;  2I9B E;  3VTS A;  2MUO A;  1JBD A;  3NEQ A;  1B41 B;  1MR6 A;  2H5F A;  1NYS A;  2BHI A;  2MJY A;  1CHV S;  2FD6 U; 
#chains in the Genus database with same CATH homology
 4DO8 A;  1TXA A;  2L03 A;  2BTX A;  1TXB A;  4XJJ A;  2CRT A;  3U73 U;  2GOO B;  1ES7 B;  3ERA A;  2MJ0 A;  1UG4 A;  1QM7 A;  1YWH A;  1IDL A;  1S4Y A;  1CXN A;  5DZ5 A;  1LXH A;  3NDS A;  3LAQ U;  1CB9 A;  1CDR A;  3EBX A;  1G6M A;  1I02 A;  2UWR A;  2QC1 A;  4KSN A;  2MHY A;  4FAO C;  2MFA A;  2H7Z B;  1H0J A;  1LSI A;  2VLW A;  2JQP A;  2OFS A;  1KXI A;  4QTI U;  1W6B A;  2HLR A;  2K3G A;  2H62 D;  2ABX A;  2LCR A;  2H8U A;  1QKD A;  5IMY C;  1HC9 B;  1LJZ A;  2CCX A;  1IQ9 A;  1HAA A;  1COE A;  4UY2 C;  3QB4 B;  3U74 U;  1BXP A;  4OM5 A;  2X8B B;  4P7U A;  4ZQY A;  1KBS A;  1IDI A;  1JGK A;  1KFH A;  2ERA A;  2LA1 A;  3KFD E;  1KU6 B;  2JVE A;  3HH7 A;  3NH7 A;  2H64 B;  2PJY C;  1IDG A;  1F94 A;  1PLO A;  5DO6 A;  1L4W A;  4EY8 B;  1IJC A;  1FRA A;  1NEA A;  2GOO C;  1CXO A;  1CDT A;  5IMT D;  1CTX A;  1ERG A;  1FAS A;  1IK8 A;  1FSC A;  1F8U B;  3BT2 U;  1KBA A;  1CCQ A;  2MUP A;  4IYE A;  2PJY B;  1HC9 A;  1CRE A;  1VB0 A;  5EBX A;  2QJB C;  2L5S A;  1CDS A;  2UX2 A;  4OM4 A;  2H64 C;  1FFJ A;  3FEV A;  1TFS A;  1KC4 A;  2HLQ A;  1NTN A;  1BTE A;  1ONJ A;  3EVS C;  4BIK B;  4FAO E;  1KL8 A;  1IDH A;  1ABT A;  1XT3 A;  1ERA A;  2CTX A;  3PLC A;  2QJA C;  1NXB A;  1NOR A;  4HQP F;  1HAJ A;  2J8B A;  1KS6 A;  1IKC A;  1DRS A;  1M9Z A;  1RGJ A;  4LFT A;  2H7Z A;  1MAH F;  1REW C;  4BDT B;  1NYU A;  2MJ4 A;  1HOY A;  1KBT A;  2N99 A;  3BT1 U;  3KFD I;  1QKE A;  1V6P A;  2CDX A;  2H62 C;  4RUD A;  1NTX A;  1KTZ B;  1LX5 B;  2CRS A;  1RL5 A;  1LXG A;  5DU1 A;  4AEA A;  1ZAD A;  2NBT A;  6EBX A;  1FSS B;  1JE9 A;  2QJ9 C;  1FF4 A;  1CRF A;  1TGX A;  1COD A;  1CDQ A;  1CVO A;  2I9B E;  3VTS A;  2MUO A;  1JBD A;  3NEQ A;  1B41 B;  1MR6 A;  2H5F A;  1NYS A;  2BHI A;  2MJY A;  1CHV S;  2FD6 U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...