2MHYA

Structure determination of the salamander courtship pheromone plethodontid modulating factor
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
57
structure length
57
Chain Sequence
LQCNTLDGGTEECIPGIYNVCVHYKSEDEEYKSCGIQEECEDAEGATVLCCPEDLCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into the evolution of a sexy protein: novel topology and restricted backbone flexibility in a hypervariable pheromone from the red-legged salamander, Plethodon shermani.
pubmed doi rcsb
source organism Plethodon shermani
molecule tags Signaling protein
molecule keywords Plethodontid modulating factor
total genus 5
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2013-12-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2mhyA00
1PLOA 1VB0A 1NTXA 2MJ0A 2MUOA 3NDSA 4XJJA 1IKCA 1FFJA 1KS6A 2X8BB 1ES7B 4HQPF 5DZ5A 1KBSA 1NXBA 2H5FA 5IMYC 1QM7A 2H62D 1NTNA 1ERAA 4EY8B 1H0JA 4BIKB 1IJCA 1UG4A 1CB9A 1F94A 3FEVA 2QJ9C 1ABTA 4AEAA 1TGXA 3KFDI 5DO6A 1MR6A 1RGJA 2CRTA 2H8UA 1KTZB 1FF4A 4UY2C 1I02A 3LAQU 1W6BA 2QC1A 1HOYA 1CDRA 1BXPA 2NBTA 1KXIA 3BT1U 3EBXA 1L4WA 1TXAA 2MFAA 1IK8A 5EBXA 2PJYB 2PJYC 1LXGA 2CTXA 2JQPA 2H62C 2I9BE 2HLQA 1DRSA 3HH7A 1ZADA 4QTIU 1IDGA 1HAJA 2BTXA 1RL5A 1BTEA 1FRAA 1CTXA 1HAAA 1XT3A 1CCQA 1JE9A 1KFHA 1JBDA 3BT2U 3VTSA 1LJZA 1ONJA 3ERAA 1M9ZA 2JVEA 2MHYA 2MUPA 1QKEA 1YWHA 1CDTA 1IDHA 1KL8A 6EBXA 3EVSC 2H64C 2H64B 2CCXA 1CODA 1KBTA 1IDIA 1CDQA 1TXBA 1V6PA 2UX2A 3PLCA 2LA1A 2GOOC 2H7ZB 1G6MA 4OM5A 1REWC 2ABXA 2MJ4A 1NYUA 1CRFA 1FASA 4ZQYA 1KU6B 1NORA 2LCRA 1JGKA 1KBAA 1CHVS 1ERGA 1CXNA 1TFSA 3NH7A 4RUDA 1NYSA 4DO8A 5IMTD 4P7UA 4LFTA 1CVOA 2GOOB 2L03A 4OM4A 1LX5B 4FAOE 2UWRA 4FAOC 2VLWA 2N99A 1MAHF 1HC9A 1F8UB 1CXOA 1IDLA 2OFSA 3U74U 3NEQA 2L5SA 1LXHA 1CDSA 1S4YA 2QJAC 1IQ9A 2H7ZA 1FSCA 2QJBC 2CDXA 2HLRA 1LSIA 2K3GA 2ERAA 2CRSA 3U73U 4BDTB 5DU1A 2FD6U 2MJYA 1CREA 3KFDE 1HC9B 1QKDA 3QB4B 1NEAA 1B41B 1KC4A 2J8BA 1COEA 4IYEA 2BHIA 1FSSB
chains in the Genus database with same CATH superfamily
1PLOA 1VB0A 1NTXA 2MJ0A 2MUOA 3NDSA 4XJJA 1IKCA 1FFJA 1KS6A 2X8BB 1ES7B 4HQPF 5DZ5A 1KBSA 1NXBA 2H5FA 5IMYC 1QM7A 2H62D 1NTNA 1ERAA 4EY8B 1H0JA 4BIKB 1IJCA 1UG4A 1CB9A 1F94A 3FEVA 2QJ9C 1ABTA 4AEAA 1TGXA 3KFDI 5DO6A 1MR6A 1RGJA 2CRTA 2H8UA 1KTZB 1FF4A 4UY2C 4KSNA 1I02A 3LAQU 1W6BA 2QC1A 1HOYA 1CDRA 1BXPA 2NBTA 1KXIA 3BT1U 3EBXA 1L4WA 1TXAA 2MFAA 1IK8A 5EBXA 2PJYB 2PJYC 1LXGA 2CTXA 2JQPA 2H62C 2I9BE 2HLQA 1DRSA 3HH7A 1ZADA 4QTIU 1IDGA 1HAJA 2BTXA 1RL5A 1BTEA 1FRAA 1CTXA 1HAAA 1XT3A 1CCQA 1JE9A 1KFHA 1JBDA 3BT2U 3VTSA 1LJZA 1ONJA 3ERAA 1M9ZA 2JVEA 2MHYA 2MUPA 1QKEA 1YWHA 1CDTA 1IDHA 1KL8A 6EBXA 3EVSC 2H64C 2H64B 2CCXA 1CODA 1KBTA 1IDIA 1CDQA 1TXBA 1V6PA 2UX2A 3PLCA 2LA1A 2GOOC 2H7ZB 1G6MA 4OM5A 1REWC 2ABXA 2MJ4A 1NYUA 1CRFA 1FASA 4ZQYA 1KU6B 1NORA 2LCRA 1JGKA 1KBAA 1CHVS 1ERGA 1CXNA 1TFSA 3NH7A 4RUDA 1NYSA 4DO8A 5IMTD 4P7UA 4LFTA 1CVOA 2GOOB 2L03A 4OM4A 1LX5B 4FAOE 2UWRA 4FAOC 2VLWA 2N99A 1MAHF 1HC9A 1F8UB 1CXOA 1IDLA 2OFSA 3U74U 3NEQA 2L5SA 1LXHA 1CDSA 1S4YA 2QJAC 1IQ9A 2H7ZA 1FSCA 2QJBC 2CDXA 2HLRA 1LSIA 2K3GA 2ERAA 2CRSA 3U73U 4BDTB 5DU1A 2FD6U 2MJYA 1CREA 3KFDE 1HC9B 1QKDA 3QB4B 1NEAA 1B41B 1KC4A 2J8BA 1COEA 4IYEA 2BHIA 1FSSB
chains in the Genus database with same CATH topology
1PLOA 1VB0A 1NTXA 2MJ0A 2MUOA 3NDSA 4XJJA 1IKCA 1FFJA 1KS6A 2X8BB 1ES7B 4HQPF 5DZ5A 1KBSA 1NXBA 2H5FA 5IMYC 1QM7A 2H62D 1NTNA 1ERAA 4EY8B 1H0JA 4BIKB 1IJCA 1UG4A 1CB9A 1F94A 3FEVA 2QJ9C 1ABTA 4AEAA 1TGXA 3KFDI 5DO6A 1MR6A 1RGJA 2CRTA 2H8UA 1KTZB 1FF4A 4UY2C 4KSNA 1I02A 3LAQU 1W6BA 2QC1A 1HOYA 1CDRA 1BXPA 2NBTA 1KXIA 3BT1U 3EBXA 1L4WA 1TXAA 2MFAA 1IK8A 5EBXA 2PJYB 2PJYC 1LXGA 2CTXA 2JQPA 2H62C 2I9BE 2HLQA 1DRSA 3HH7A 1ZADA 4QTIU 1IDGA 1HAJA 2BTXA 1RL5A 1BTEA 1FRAA 1CTXA 1HAAA 1XT3A 1CCQA 1JE9A 1KFHA 1JBDA 3BT2U 3VTSA 1LJZA 1ONJA 3ERAA 1M9ZA 2JVEA 2MHYA 2MUPA 1QKEA 1YWHA 1CDTA 1IDHA 1KL8A 6EBXA 3EVSC 2H64C 2H64B 2CCXA 1CODA 1KBTA 1IDIA 1CDQA 1TXBA 1V6PA 2UX2A 3PLCA 2LA1A 2GOOC 2H7ZB 1G6MA 4OM5A 1REWC 2ABXA 2MJ4A 1NYUA 1CRFA 1FASA 4ZQYA 1KU6B 1NORA 2LCRA 1JGKA 1KBAA 1CHVS 1ERGA 1CXNA 1TFSA 3NH7A 4RUDA 1NYSA 4DO8A 5IMTD 4P7UA 4LFTA 1CVOA 2GOOB 2L03A 4OM4A 1LX5B 4FAOE 2UWRA 4FAOC 2VLWA 2N99A 1MAHF 1HC9A 1F8UB 1CXOA 1IDLA 2OFSA 3U74U 3NEQA 2L5SA 1LXHA 1CDSA 1S4YA 2QJAC 1IQ9A 2H7ZA 1FSCA 2QJBC 2CDXA 2HLRA 1LSIA 2K3GA 2ERAA 2CRSA 3U73U 4BDTB 5DU1A 2FD6U 2MJYA 1CREA 3KFDE 1HC9B 1QKDA 3QB4B 1NEAA 1B41B 1KC4A 2J8BA 1COEA 4IYEA 2BHIA 1FSSB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PLO A;  1VB0 A;  1NTX A;  2MJ0 A;  2MUO A;  3NDS A;  4XJJ A;  1IKC A;  1FFJ A;  1KS6 A;  2X8B B;  1ES7 B;  4HQP F;  5DZ5 A;  1KBS A;  1NXB A;  2H5F A;  5IMY C;  1QM7 A;  2H62 D;  1NTN A;  1ERA A;  4EY8 B;  1H0J A;  4BIK B;  1IJC A;  1UG4 A;  1CB9 A;  1F94 A;  3FEV A;  2QJ9 C;  1ABT A;  4AEA A;  1TGX A;  3KFD I;  5DO6 A;  1MR6 A;  1RGJ A;  2CRT A;  2H8U A;  1KTZ B;  1FF4 A;  4UY2 C;  1I02 A;  3LAQ U;  1W6B A;  2QC1 A;  1HOY A;  1CDR A;  1BXP A;  2NBT A;  1KXI A;  3BT1 U;  3EBX A;  1L4W A;  1TXA A;  2MFA A;  1IK8 A;  5EBX A;  2PJY B;  2PJY C;  1LXG A;  2CTX A;  2JQP A;  2H62 C;  2I9B E;  2HLQ A;  1DRS A;  3HH7 A;  1ZAD A;  4QTI U;  1IDG A;  1HAJ A;  2BTX A;  1RL5 A;  1BTE A;  1FRA A;  1CTX A;  1HAA A;  1XT3 A;  1CCQ A;  1JE9 A;  1KFH A;  1JBD A;  3BT2 U;  3VTS A;  1LJZ A;  1ONJ A;  3ERA A;  1M9Z A;  2JVE A;  2MHY A;  2MUP A;  1QKE A;  1YWH A;  1CDT A;  1IDH A;  1KL8 A;  6EBX A;  3EVS C;  2H64 C;  2H64 B;  2CCX A;  1COD A;  1KBT A;  1IDI A;  1CDQ A;  1TXB A;  1V6P A;  2UX2 A;  3PLC A;  2LA1 A;  2GOO C;  2H7Z B;  1G6M A;  4OM5 A;  1REW C;  2ABX A;  2MJ4 A;  1NYU A;  1CRF A;  1FAS A;  4ZQY A;  1KU6 B;  1NOR A;  2LCR A;  1JGK A;  1KBA A;  1CHV S;  1ERG A;  1CXN A;  1TFS A;  3NH7 A;  4RUD A;  1NYS A;  4DO8 A;  5IMT D;  4P7U A;  4LFT A;  1CVO A;  2GOO B;  2L03 A;  4OM4 A;  1LX5 B;  4FAO E;  2UWR A;  4FAO C;  2VLW A;  2N99 A;  1MAH F;  1HC9 A;  1F8U B;  1CXO A;  1IDL A;  2OFS A;  3U74 U;  3NEQ A;  2L5S A;  1LXH A;  1CDS A;  1S4Y A;  2QJA C;  1IQ9 A;  2H7Z A;  1FSC A;  2QJB C;  2CDX A;  2HLR A;  1LSI A;  2K3G A;  2ERA A;  2CRS A;  3U73 U;  4BDT B;  5DU1 A;  2FD6 U;  2MJY A;  1CRE A;  3KFD E;  1HC9 B;  1QKD A;  3QB4 B;  1NEA A;  1B41 B;  1KC4 A;  2J8B A;  1COE A;  4IYE A;  2BHI A;  1FSS B; 
#chains in the Genus database with same CATH topology
 1PLO A;  1VB0 A;  1NTX A;  2MJ0 A;  2MUO A;  3NDS A;  4XJJ A;  1IKC A;  1FFJ A;  1KS6 A;  2X8B B;  1ES7 B;  4HQP F;  5DZ5 A;  1KBS A;  1NXB A;  2H5F A;  5IMY C;  1QM7 A;  2H62 D;  1NTN A;  1ERA A;  4EY8 B;  1H0J A;  4BIK B;  1IJC A;  1UG4 A;  1CB9 A;  1F94 A;  3FEV A;  2QJ9 C;  1ABT A;  4AEA A;  1TGX A;  3KFD I;  5DO6 A;  1MR6 A;  1RGJ A;  2CRT A;  2H8U A;  1KTZ B;  1FF4 A;  4UY2 C;  4KSN A;  1I02 A;  3LAQ U;  1W6B A;  2QC1 A;  1HOY A;  1CDR A;  1BXP A;  2NBT A;  1KXI A;  3BT1 U;  3EBX A;  1L4W A;  1TXA A;  2MFA A;  1IK8 A;  5EBX A;  2PJY B;  2PJY C;  1LXG A;  2CTX A;  2JQP A;  2H62 C;  2I9B E;  2HLQ A;  1DRS A;  3HH7 A;  1ZAD A;  4QTI U;  1IDG A;  1HAJ A;  2BTX A;  1RL5 A;  1BTE A;  1FRA A;  1CTX A;  1HAA A;  1XT3 A;  1CCQ A;  1JE9 A;  1KFH A;  1JBD A;  3BT2 U;  3VTS A;  1LJZ A;  1ONJ A;  3ERA A;  1M9Z A;  2JVE A;  2MHY A;  2MUP A;  1QKE A;  1YWH A;  1CDT A;  1IDH A;  1KL8 A;  6EBX A;  3EVS C;  2H64 C;  2H64 B;  2CCX A;  1COD A;  1KBT A;  1IDI A;  1CDQ A;  1TXB A;  1V6P A;  2UX2 A;  3PLC A;  2LA1 A;  2GOO C;  2H7Z B;  1G6M A;  4OM5 A;  1REW C;  2ABX A;  2MJ4 A;  1NYU A;  1CRF A;  1FAS A;  4ZQY A;  1KU6 B;  1NOR A;  2LCR A;  1JGK A;  1KBA A;  1CHV S;  1ERG A;  1CXN A;  1TFS A;  3NH7 A;  4RUD A;  1NYS A;  4DO8 A;  5IMT D;  4P7U A;  4LFT A;  1CVO A;  2GOO B;  2L03 A;  4OM4 A;  1LX5 B;  4FAO E;  2UWR A;  4FAO C;  2VLW A;  2N99 A;  1MAH F;  1HC9 A;  1F8U B;  1CXO A;  1IDL A;  2OFS A;  3U74 U;  3NEQ A;  2L5S A;  1LXH A;  1CDS A;  1S4Y A;  2QJA C;  1IQ9 A;  2H7Z A;  1FSC A;  2QJB C;  2CDX A;  2HLR A;  1LSI A;  2K3G A;  2ERA A;  2CRS A;  3U73 U;  4BDT B;  5DU1 A;  2FD6 U;  2MJY A;  1CRE A;  3KFD E;  1HC9 B;  1QKD A;  3QB4 B;  1NEA A;  1B41 B;  1KC4 A;  2J8B A;  1COE A;  4IYE A;  2BHI A;  1FSS B; 
#chains in the Genus database with same CATH homology
 1PLO A;  1VB0 A;  1NTX A;  2MJ0 A;  2MUO A;  3NDS A;  4XJJ A;  1IKC A;  1FFJ A;  1KS6 A;  2X8B B;  1ES7 B;  4HQP F;  5DZ5 A;  1KBS A;  1NXB A;  2H5F A;  5IMY C;  1QM7 A;  2H62 D;  1NTN A;  1ERA A;  4EY8 B;  1H0J A;  4BIK B;  1IJC A;  1UG4 A;  1CB9 A;  1F94 A;  3FEV A;  2QJ9 C;  1ABT A;  4AEA A;  1TGX A;  3KFD I;  5DO6 A;  1MR6 A;  1RGJ A;  2CRT A;  2H8U A;  1KTZ B;  1FF4 A;  4UY2 C;  4KSN A;  1I02 A;  3LAQ U;  1W6B A;  2QC1 A;  1HOY A;  1CDR A;  1BXP A;  2NBT A;  1KXI A;  3BT1 U;  3EBX A;  1L4W A;  1TXA A;  2MFA A;  1IK8 A;  5EBX A;  2PJY B;  2PJY C;  1LXG A;  2CTX A;  2JQP A;  2H62 C;  2I9B E;  2HLQ A;  1DRS A;  3HH7 A;  1ZAD A;  4QTI U;  1IDG A;  1HAJ A;  2BTX A;  1RL5 A;  1BTE A;  1FRA A;  1CTX A;  1HAA A;  1XT3 A;  1CCQ A;  1JE9 A;  1KFH A;  1JBD A;  3BT2 U;  3VTS A;  1LJZ A;  1ONJ A;  3ERA A;  1M9Z A;  2JVE A;  2MHY A;  2MUP A;  1QKE A;  1YWH A;  1CDT A;  1IDH A;  1KL8 A;  6EBX A;  3EVS C;  2H64 C;  2H64 B;  2CCX A;  1COD A;  1KBT A;  1IDI A;  1CDQ A;  1TXB A;  1V6P A;  2UX2 A;  3PLC A;  2LA1 A;  2GOO C;  2H7Z B;  1G6M A;  4OM5 A;  1REW C;  2ABX A;  2MJ4 A;  1NYU A;  1CRF A;  1FAS A;  4ZQY A;  1KU6 B;  1NOR A;  2LCR A;  1JGK A;  1KBA A;  1CHV S;  1ERG A;  1CXN A;  1TFS A;  3NH7 A;  4RUD A;  1NYS A;  4DO8 A;  5IMT D;  4P7U A;  4LFT A;  1CVO A;  2GOO B;  2L03 A;  4OM4 A;  1LX5 B;  4FAO E;  2UWR A;  4FAO C;  2VLW A;  2N99 A;  1MAH F;  1HC9 A;  1F8U B;  1CXO A;  1IDL A;  2OFS A;  3U74 U;  3NEQ A;  2L5S A;  1LXH A;  1CDS A;  1S4Y A;  2QJA C;  1IQ9 A;  2H7Z A;  1FSC A;  2QJB C;  2CDX A;  2HLR A;  1LSI A;  2K3G A;  2ERA A;  2CRS A;  3U73 U;  4BDT B;  5DU1 A;  2FD6 U;  2MJY A;  1CRE A;  3KFD E;  1HC9 B;  1QKD A;  3QB4 B;  1NEA A;  1B41 B;  1KC4 A;  2J8B A;  1COE A;  4IYE A;  2BHI A;  1FSS B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...