1CXNA

Refined three-dimensional solution structure of a snake cardiotoxin: analysis of the side-chain organisation suggests the existence of a possible phospholipid binding site
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
60
structure length
60
Chain Sequence
LKCNQLIPPFWKTCPKGKNLCYKMTMRAAPMVPVKRGCIDVCPKSSLLIKYMCCNTDKCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytotoxin
molecule keywords CARDIOTOXIN GAMMA
publication title Refined three-dimensional solution structure of a snake cardiotoxin: analysis of the side-chain organization suggests the existence of a possible phospholipid binding site.
pubmed doi rcsb
source organism Naja nigricollis
total genus 9
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 1994-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1cxnA00
2H64B 4ZQYA 2CDXA 4AEAA 4FAOE 5DO6A 6EBXA 1FRAA 2QJBC 1FFJA 1NYSA 2CTXA 1JBDA 3EVSC 3NH7A 4LFTA 1CXOA 2JQPA 1LJZA 1NXBA 1FASA 5DZ5A 2HLQA 2VLWA 2ABXA 2CRTA 1XT3A 1CB9A 1UG4A 2H62C 1HAAA 1S4YA 4RUDA 3U74U 3EBXA 1KTZB 1NTXA 1IDIA 3U73U 4P7UA 2BHIA 1ES7B 1ZADA 1FSCA 2H7ZA 2H5FA 4FAOC 1YWHA 1TXBA 2MUPA 1BXPA 1KXIA 1IQ9A 2H62D 1BTEA 1RGJA 1TFSA 4OM4A 2FD6U 1ERAA 1ERGA 2ERAA 1CCQA 2QC1A 1LSIA 1CXNA 3NDSA 3BT1U 4QTIU 3VTSA 2UWRA 4BDTB 1G6MA 2MJ4A 3KFDI 2MFAA 1RL5A 1KBAA 2PJYC 1NYUA 1REWC 2J8BA 1CREA 2UX2A 1IDGA 1IKCA 1IDHA 4DO8A 3HH7A 1COEA 4IYEA 2L03A 1ONJA 2H7ZB 1KL8A 1F94A 1NEAA 1L4WA 2N99A 1CDSA 1LXHA 2L5SA 3NEQA 5DU1A 1PLOA 3KFDE 4UY2C 1JGKA 1CODA 1IDLA 2PJYB 1CTXA 1HOYA 1KU6B 1CVOA 1KS6A 1I02A 2NBTA 1DRSA 2OFSA 2LCRA 1HAJA 1FSSB 2LA1A 1F8UB 3ERAA 1ABTA 1IK8A 4BIKB 2QJAC 2GOOC 1TGXA 5IMYC 1KFHA 4HQPF 1QKEA 1NORA 2I9BE 2QJ9C 1MAHF 2K3GA 2X8BB 1QM7A 2CRSA 4OM5A 1CHVS 2H64C 1FF4A 1QKDA 3PLCA 1NTNA 2MHYA 2MJYA 1CDTA 1IJCA 3QB4B 2MUOA 1W6BA 1CRFA 1LX5B 1CDQA 3BT2U 1KC4A 5IMTD 5EBXA 4XJJA 2JVEA 1KBTA 1MR6A 1KBSA 1TXAA 2H8UA 2CCXA 3LAQU 2MJ0A 1V6PA 2GOOB 1HC9B 1JE9A 1VB0A 1H0JA 2BTXA 1HC9A 1CDRA 2HLRA 1LXGA 3FEVA 1B41B 4EY8B 1M9ZA
chains in the Genus database with same CATH superfamily
2H64B 4ZQYA 2CDXA 4AEAA 4FAOE 5DO6A 6EBXA 1FRAA 2QJBC 1FFJA 1NYSA 2CTXA 1JBDA 3EVSC 3NH7A 4LFTA 1CXOA 2JQPA 1LJZA 1NXBA 1FASA 5DZ5A 2HLQA 2VLWA 2ABXA 2CRTA 1XT3A 1CB9A 1UG4A 2H62C 1HAAA 1S4YA 4RUDA 3U74U 3EBXA 1KTZB 1NTXA 1IDIA 3U73U 4P7UA 2BHIA 1ES7B 1ZADA 1FSCA 2H7ZA 2H5FA 4FAOC 1YWHA 1TXBA 2MUPA 1BXPA 1KXIA 1IQ9A 2H62D 1BTEA 1RGJA 1TFSA 4OM4A 2FD6U 1ERAA 1ERGA 2ERAA 1CCQA 2QC1A 1LSIA 1CXNA 3NDSA 3BT1U 4QTIU 3VTSA 2UWRA 4BDTB 1G6MA 2MJ4A 3KFDI 2MFAA 1RL5A 1KBAA 2PJYC 1NYUA 1REWC 2J8BA 1CREA 2UX2A 1IDGA 1IKCA 1IDHA 4DO8A 3HH7A 1COEA 4IYEA 2L03A 1ONJA 2H7ZB 1KL8A 1F94A 1NEAA 1L4WA 2N99A 1CDSA 1LXHA 2L5SA 3NEQA 5DU1A 1PLOA 3KFDE 4UY2C 1JGKA 1CODA 1IDLA 2PJYB 1CTXA 1HOYA 1KU6B 1CVOA 1KS6A 1I02A 2NBTA 1DRSA 2OFSA 2LCRA 1HAJA 1FSSB 2LA1A 1F8UB 3ERAA 1ABTA 1IK8A 4BIKB 2QJAC 2GOOC 1TGXA 5IMYC 1KFHA 4HQPF 1QKEA 1NORA 2I9BE 2QJ9C 1MAHF 2K3GA 2X8BB 1QM7A 2CRSA 4OM5A 1CHVS 2H64C 1FF4A 1QKDA 3PLCA 1NTNA 2MHYA 2MJYA 1CDTA 1IJCA 3QB4B 2MUOA 1W6BA 1CRFA 1LX5B 1CDQA 3BT2U 1KC4A 5IMTD 5EBXA 4XJJA 2JVEA 1KBTA 1MR6A 1KBSA 1TXAA 2H8UA 4KSNA 2CCXA 3LAQU 2MJ0A 1V6PA 2GOOB 1HC9B 1JE9A 1VB0A 1H0JA 2BTXA 1HC9A 1CDRA 2HLRA 1LXGA 3FEVA 1B41B 4EY8B 1M9ZA
chains in the Genus database with same CATH topology
2H64B 4ZQYA 2CDXA 4AEAA 4FAOE 5DO6A 6EBXA 1FRAA 2QJBC 1FFJA 1NYSA 2CTXA 1JBDA 3EVSC 3NH7A 4LFTA 1CXOA 2JQPA 1LJZA 1NXBA 1FASA 5DZ5A 2HLQA 2VLWA 2ABXA 2CRTA 1XT3A 1CB9A 1UG4A 2H62C 1HAAA 1S4YA 4RUDA 3U74U 3EBXA 1KTZB 1NTXA 1IDIA 3U73U 4P7UA 2BHIA 1ES7B 1ZADA 1FSCA 2H7ZA 2H5FA 4FAOC 1YWHA 1TXBA 2MUPA 1BXPA 1KXIA 1IQ9A 2H62D 1BTEA 1RGJA 1TFSA 4OM4A 2FD6U 1ERAA 1ERGA 2ERAA 1CCQA 2QC1A 1LSIA 1CXNA 3NDSA 3BT1U 4QTIU 3VTSA 2UWRA 4BDTB 1G6MA 2MJ4A 3KFDI 2MFAA 1RL5A 1KBAA 2PJYC 1NYUA 1REWC 2J8BA 1CREA 2UX2A 1IDGA 1IKCA 1IDHA 4DO8A 3HH7A 1COEA 4IYEA 2L03A 1ONJA 2H7ZB 1KL8A 1F94A 1NEAA 1L4WA 2N99A 1CDSA 1LXHA 2L5SA 3NEQA 5DU1A 1PLOA 3KFDE 4UY2C 1JGKA 1CODA 1IDLA 2PJYB 1CTXA 1HOYA 1KU6B 1CVOA 1KS6A 1I02A 2NBTA 1DRSA 2OFSA 2LCRA 1HAJA 1FSSB 2LA1A 1F8UB 3ERAA 1ABTA 1IK8A 4BIKB 2QJAC 2GOOC 1TGXA 5IMYC 1KFHA 4HQPF 1QKEA 1NORA 2I9BE 2QJ9C 1MAHF 2K3GA 2X8BB 1QM7A 2CRSA 4OM5A 1CHVS 2H64C 1FF4A 1QKDA 3PLCA 1NTNA 2MHYA 2MJYA 1CDTA 1IJCA 3QB4B 2MUOA 1W6BA 1CRFA 1LX5B 1CDQA 3BT2U 1KC4A 5IMTD 5EBXA 4XJJA 2JVEA 1KBTA 1MR6A 1KBSA 1TXAA 2H8UA 4KSNA 2CCXA 3LAQU 2MJ0A 1V6PA 2GOOB 1HC9B 1JE9A 1VB0A 1H0JA 2BTXA 1HC9A 1CDRA 2HLRA 1LXGA 3FEVA 1B41B 4EY8B 1M9ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H64 B;  4ZQY A;  2CDX A;  4AEA A;  4FAO E;  5DO6 A;  6EBX A;  1FRA A;  2QJB C;  1FFJ A;  1NYS A;  2CTX A;  1JBD A;  3EVS C;  3NH7 A;  4LFT A;  1CXO A;  2JQP A;  1LJZ A;  1NXB A;  1FAS A;  5DZ5 A;  2HLQ A;  2VLW A;  2ABX A;  2CRT A;  1XT3 A;  1CB9 A;  1UG4 A;  2H62 C;  1HAA A;  1S4Y A;  4RUD A;  3U74 U;  3EBX A;  1KTZ B;  1NTX A;  1IDI A;  3U73 U;  4P7U A;  2BHI A;  1ES7 B;  1ZAD A;  1FSC A;  2H7Z A;  2H5F A;  4FAO C;  1YWH A;  1TXB A;  2MUP A;  1BXP A;  1KXI A;  1IQ9 A;  2H62 D;  1BTE A;  1RGJ A;  1TFS A;  4OM4 A;  2FD6 U;  1ERA A;  1ERG A;  2ERA A;  1CCQ A;  2QC1 A;  1LSI A;  1CXN A;  3NDS A;  3BT1 U;  4QTI U;  3VTS A;  2UWR A;  4BDT B;  1G6M A;  2MJ4 A;  3KFD I;  2MFA A;  1RL5 A;  1KBA A;  2PJY C;  1NYU A;  1REW C;  2J8B A;  1CRE A;  2UX2 A;  1IDG A;  1IKC A;  1IDH A;  4DO8 A;  3HH7 A;  1COE A;  4IYE A;  2L03 A;  1ONJ A;  2H7Z B;  1KL8 A;  1F94 A;  1NEA A;  1L4W A;  2N99 A;  1CDS A;  1LXH A;  2L5S A;  3NEQ A;  5DU1 A;  1PLO A;  3KFD E;  4UY2 C;  1JGK A;  1COD A;  1IDL A;  2PJY B;  1CTX A;  1HOY A;  1KU6 B;  1CVO A;  1KS6 A;  1I02 A;  2NBT A;  1DRS A;  2OFS A;  2LCR A;  1HAJ A;  1FSS B;  2LA1 A;  1F8U B;  3ERA A;  1ABT A;  1IK8 A;  4BIK B;  2QJA C;  2GOO C;  1TGX A;  5IMY C;  1KFH A;  4HQP F;  1QKE A;  1NOR A;  2I9B E;  2QJ9 C;  1MAH F;  2K3G A;  2X8B B;  1QM7 A;  2CRS A;  4OM5 A;  1CHV S;  2H64 C;  1FF4 A;  1QKD A;  3PLC A;  1NTN A;  2MHY A;  2MJY A;  1CDT A;  1IJC A;  3QB4 B;  2MUO A;  1W6B A;  1CRF A;  1LX5 B;  1CDQ A;  3BT2 U;  1KC4 A;  5IMT D;  5EBX A;  4XJJ A;  2JVE A;  1KBT A;  1MR6 A;  1KBS A;  1TXA A;  2H8U A;  2CCX A;  3LAQ U;  2MJ0 A;  1V6P A;  2GOO B;  1HC9 B;  1JE9 A;  1VB0 A;  1H0J A;  2BTX A;  1HC9 A;  1CDR A;  2HLR A;  1LXG A;  3FEV A;  1B41 B;  4EY8 B;  1M9Z A; 
#chains in the Genus database with same CATH topology
 2H64 B;  4ZQY A;  2CDX A;  4AEA A;  4FAO E;  5DO6 A;  6EBX A;  1FRA A;  2QJB C;  1FFJ A;  1NYS A;  2CTX A;  1JBD A;  3EVS C;  3NH7 A;  4LFT A;  1CXO A;  2JQP A;  1LJZ A;  1NXB A;  1FAS A;  5DZ5 A;  2HLQ A;  2VLW A;  2ABX A;  2CRT A;  1XT3 A;  1CB9 A;  1UG4 A;  2H62 C;  1HAA A;  1S4Y A;  4RUD A;  3U74 U;  3EBX A;  1KTZ B;  1NTX A;  1IDI A;  3U73 U;  4P7U A;  2BHI A;  1ES7 B;  1ZAD A;  1FSC A;  2H7Z A;  2H5F A;  4FAO C;  1YWH A;  1TXB A;  2MUP A;  1BXP A;  1KXI A;  1IQ9 A;  2H62 D;  1BTE A;  1RGJ A;  1TFS A;  4OM4 A;  2FD6 U;  1ERA A;  1ERG A;  2ERA A;  1CCQ A;  2QC1 A;  1LSI A;  1CXN A;  3NDS A;  3BT1 U;  4QTI U;  3VTS A;  2UWR A;  4BDT B;  1G6M A;  2MJ4 A;  3KFD I;  2MFA A;  1RL5 A;  1KBA A;  2PJY C;  1NYU A;  1REW C;  2J8B A;  1CRE A;  2UX2 A;  1IDG A;  1IKC A;  1IDH A;  4DO8 A;  3HH7 A;  1COE A;  4IYE A;  2L03 A;  1ONJ A;  2H7Z B;  1KL8 A;  1F94 A;  1NEA A;  1L4W A;  2N99 A;  1CDS A;  1LXH A;  2L5S A;  3NEQ A;  5DU1 A;  1PLO A;  3KFD E;  4UY2 C;  1JGK A;  1COD A;  1IDL A;  2PJY B;  1CTX A;  1HOY A;  1KU6 B;  1CVO A;  1KS6 A;  1I02 A;  2NBT A;  1DRS A;  2OFS A;  2LCR A;  1HAJ A;  1FSS B;  2LA1 A;  1F8U B;  3ERA A;  1ABT A;  1IK8 A;  4BIK B;  2QJA C;  2GOO C;  1TGX A;  5IMY C;  1KFH A;  4HQP F;  1QKE A;  1NOR A;  2I9B E;  2QJ9 C;  1MAH F;  2K3G A;  2X8B B;  1QM7 A;  2CRS A;  4OM5 A;  1CHV S;  2H64 C;  1FF4 A;  1QKD A;  3PLC A;  1NTN A;  2MHY A;  2MJY A;  1CDT A;  1IJC A;  3QB4 B;  2MUO A;  1W6B A;  1CRF A;  1LX5 B;  1CDQ A;  3BT2 U;  1KC4 A;  5IMT D;  5EBX A;  4XJJ A;  2JVE A;  1KBT A;  1MR6 A;  1KBS A;  1TXA A;  2H8U A;  4KSN A;  2CCX A;  3LAQ U;  2MJ0 A;  1V6P A;  2GOO B;  1HC9 B;  1JE9 A;  1VB0 A;  1H0J A;  2BTX A;  1HC9 A;  1CDR A;  2HLR A;  1LXG A;  3FEV A;  1B41 B;  4EY8 B;  1M9Z A; 
#chains in the Genus database with same CATH homology
 2H64 B;  4ZQY A;  2CDX A;  4AEA A;  4FAO E;  5DO6 A;  6EBX A;  1FRA A;  2QJB C;  1FFJ A;  1NYS A;  2CTX A;  1JBD A;  3EVS C;  3NH7 A;  4LFT A;  1CXO A;  2JQP A;  1LJZ A;  1NXB A;  1FAS A;  5DZ5 A;  2HLQ A;  2VLW A;  2ABX A;  2CRT A;  1XT3 A;  1CB9 A;  1UG4 A;  2H62 C;  1HAA A;  1S4Y A;  4RUD A;  3U74 U;  3EBX A;  1KTZ B;  1NTX A;  1IDI A;  3U73 U;  4P7U A;  2BHI A;  1ES7 B;  1ZAD A;  1FSC A;  2H7Z A;  2H5F A;  4FAO C;  1YWH A;  1TXB A;  2MUP A;  1BXP A;  1KXI A;  1IQ9 A;  2H62 D;  1BTE A;  1RGJ A;  1TFS A;  4OM4 A;  2FD6 U;  1ERA A;  1ERG A;  2ERA A;  1CCQ A;  2QC1 A;  1LSI A;  1CXN A;  3NDS A;  3BT1 U;  4QTI U;  3VTS A;  2UWR A;  4BDT B;  1G6M A;  2MJ4 A;  3KFD I;  2MFA A;  1RL5 A;  1KBA A;  2PJY C;  1NYU A;  1REW C;  2J8B A;  1CRE A;  2UX2 A;  1IDG A;  1IKC A;  1IDH A;  4DO8 A;  3HH7 A;  1COE A;  4IYE A;  2L03 A;  1ONJ A;  2H7Z B;  1KL8 A;  1F94 A;  1NEA A;  1L4W A;  2N99 A;  1CDS A;  1LXH A;  2L5S A;  3NEQ A;  5DU1 A;  1PLO A;  3KFD E;  4UY2 C;  1JGK A;  1COD A;  1IDL A;  2PJY B;  1CTX A;  1HOY A;  1KU6 B;  1CVO A;  1KS6 A;  1I02 A;  2NBT A;  1DRS A;  2OFS A;  2LCR A;  1HAJ A;  1FSS B;  2LA1 A;  1F8U B;  3ERA A;  1ABT A;  1IK8 A;  4BIK B;  2QJA C;  2GOO C;  1TGX A;  5IMY C;  1KFH A;  4HQP F;  1QKE A;  1NOR A;  2I9B E;  2QJ9 C;  1MAH F;  2K3G A;  2X8B B;  1QM7 A;  2CRS A;  4OM5 A;  1CHV S;  2H64 C;  1FF4 A;  1QKD A;  3PLC A;  1NTN A;  2MHY A;  2MJY A;  1CDT A;  1IJC A;  3QB4 B;  2MUO A;  1W6B A;  1CRF A;  1LX5 B;  1CDQ A;  3BT2 U;  1KC4 A;  5IMT D;  5EBX A;  4XJJ A;  2JVE A;  1KBT A;  1MR6 A;  1KBS A;  1TXA A;  2H8U A;  4KSN A;  2CCX A;  3LAQ U;  2MJ0 A;  1V6P A;  2GOO B;  1HC9 B;  1JE9 A;  1VB0 A;  1H0J A;  2BTX A;  1HC9 A;  1CDR A;  2HLR A;  1LXG A;  3FEV A;  1B41 B;  4EY8 B;  1M9Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...