2N99A

Solution structure of the slurp-2, a secreted isoform of lynx1
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
76
structure length
76
Chain Sequence
MIWCHQCTGFGGCSHGSRCLRDSTHCVTTATRVLSNTEDLPLVTKMCHIGCPDIPSLGLGPYVSIACCQTSLCNHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Neuropeptide
molecule keywords Ly-6/neurotoxin-like protein 1
publication title Secreted Isoform of Human Lynx1 (SLURP-2): Spatial Structure and Pharmacology of Interactions with Different Types of Acetylcholine Receptors.
pubmed doi rcsb
source organism Homo sapiens
total genus 9
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2015-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00021 UPAR_LY6 u-PAR/Ly-6 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2n99A00
1YWHA 2QJ9C 1KXIA 1LXGA 2QC1A 4IYEA 1KBTA 1FSCA 2OFSA 1CDSA 2HLQA 1LXHA 1NTNA 2MUPA 1IDLA 2H62D 2H7ZA 4FAOE 1KL8A 1LSIA 1UG4A 1B41B 1BTEA 2J8BA 1KTZB 4AEAA 2I9BE 4RUDA 3PLCA 1QKDA 2MUOA 1CDRA 2HLRA 1NTXA 1TXAA 1QKEA 4HQPF 3U73U 1NYSA 4P7UA 1FSSB 1TGXA 5IMYC 2PJYB 1HC9A 1S4YA 1W6BA 2LA1A 3ERAA 1CXOA 1RL5A 1IK8A 6EBXA 1CDQA 1IDIA 1CTXA 2UWRA 4LFTA 1NXBA 3U74U 5DZ5A 2H64C 1CXNA 2K3GA 2L5SA 4OM4A 2VLWA 2BHIA 1JE9A 2GOOB 1ZADA 4EY8B 1JBDA 1QM7A 2N99A 1FASA 2FD6U 1M9ZA 3KFDE 1IDHA 1PLOA 1TXBA 3NH7A 1G6MA 1KU6B 1HOYA 1REWC 2X8BB 1KFHA 5EBXA 3QB4B 3HH7A 2ERAA 1F8UB 4ZQYA 1I02A 1V6PA 2MJ0A 1FF4A 2MFAA 1CB9A 3BT2U 1ERAA 1ABTA 1KBAA 1FRAA 3BT1U 1CDTA 2LCRA 1IDGA 1CVOA 2MHYA 4QTIU 1CRFA 1CHVS 1HAJA 2MJYA 3VTSA 1JGKA 1TFSA 1L4WA 1F94A 1RGJA 1IKCA 1HAAA 1VB0A 4BIKB 1BXPA 2H7ZB 1CCQA 4UY2C 2UX2A 1ERGA 5DU1A 4XJJA 1IQ9A 1MAHF 2H62C 1H0JA 5DO6A 1CREA 2H64B 3NEQA 1LX5B 2BTXA 1NORA 1ES7B 3LAQU 1NYUA 2CDXA 1IJCA 4OM5A 1LJZA 2NBTA 2H5FA 1HC9B 2PJYC 2QJAC 1NEAA 2JQPA 1XT3A 2CRSA 1COEA 3FEVA 4DO8A 1KC4A 1CODA 5IMTD 3EVSC 2L03A 2H8UA 1DRSA 4BDTB 2CTXA 1ONJA 2GOOC 1KBSA 2CCXA 4FAOC 1FFJA 2QJBC 2ABXA 2JVEA 3EBXA 1MR6A 1KS6A 2MJ4A 2CRTA 3NDSA 3KFDI
chains in the Genus database with same CATH superfamily
1YWHA 2QJ9C 1KXIA 1LXGA 2QC1A 4IYEA 1KBTA 1FSCA 2OFSA 1CDSA 2HLQA 1LXHA 1NTNA 2MUPA 1IDLA 2H62D 2H7ZA 4FAOE 1KL8A 1LSIA 1UG4A 1B41B 1BTEA 2J8BA 1KTZB 4KSNA 4AEAA 2I9BE 4RUDA 3PLCA 1QKDA 2MUOA 1CDRA 2HLRA 1NTXA 1TXAA 1QKEA 4HQPF 3U73U 1NYSA 4P7UA 1FSSB 1TGXA 5IMYC 2PJYB 1HC9A 1S4YA 1W6BA 2LA1A 3ERAA 1CXOA 1RL5A 1IK8A 6EBXA 1CDQA 1IDIA 1CTXA 2UWRA 4LFTA 1NXBA 3U74U 5DZ5A 2H64C 1CXNA 2K3GA 2L5SA 4OM4A 2VLWA 2BHIA 1JE9A 2GOOB 1ZADA 4EY8B 1JBDA 1QM7A 2N99A 1FASA 2FD6U 1M9ZA 3KFDE 1IDHA 1PLOA 1TXBA 3NH7A 1G6MA 1KU6B 1HOYA 1REWC 2X8BB 1KFHA 5EBXA 3QB4B 3HH7A 2ERAA 1F8UB 4ZQYA 1I02A 1V6PA 2MJ0A 1FF4A 2MFAA 1CB9A 3BT2U 1ERAA 1ABTA 1KBAA 1FRAA 3BT1U 1CDTA 2LCRA 1IDGA 1CVOA 2MHYA 4QTIU 1CRFA 1CHVS 1HAJA 2MJYA 3VTSA 1JGKA 1TFSA 1L4WA 1F94A 1RGJA 1IKCA 1HAAA 1VB0A 4BIKB 1BXPA 2H7ZB 1CCQA 4UY2C 2UX2A 1ERGA 5DU1A 4XJJA 1IQ9A 1MAHF 2H62C 1H0JA 5DO6A 1CREA 2H64B 3NEQA 1LX5B 2BTXA 1NORA 1ES7B 3LAQU 1NYUA 2CDXA 1IJCA 4OM5A 1LJZA 2NBTA 2H5FA 1HC9B 2PJYC 2QJAC 1NEAA 2JQPA 1XT3A 2CRSA 1COEA 3FEVA 4DO8A 1KC4A 1CODA 5IMTD 3EVSC 2L03A 2H8UA 1DRSA 4BDTB 2CTXA 1ONJA 2GOOC 1KBSA 2CCXA 4FAOC 1FFJA 2QJBC 2ABXA 2JVEA 3EBXA 1MR6A 1KS6A 2MJ4A 2CRTA 3NDSA 3KFDI
chains in the Genus database with same CATH topology
1YWHA 2QJ9C 1KXIA 1LXGA 2QC1A 4IYEA 1KBTA 1FSCA 2OFSA 1CDSA 2HLQA 1LXHA 1NTNA 2MUPA 1IDLA 2H62D 2H7ZA 4FAOE 1KL8A 1LSIA 1UG4A 1B41B 1BTEA 2J8BA 1KTZB 4KSNA 4AEAA 2I9BE 4RUDA 3PLCA 1QKDA 2MUOA 1CDRA 2HLRA 1NTXA 1TXAA 1QKEA 4HQPF 3U73U 1NYSA 4P7UA 1FSSB 1TGXA 5IMYC 2PJYB 1HC9A 1S4YA 1W6BA 2LA1A 3ERAA 1CXOA 1RL5A 1IK8A 6EBXA 1CDQA 1IDIA 1CTXA 2UWRA 4LFTA 1NXBA 3U74U 5DZ5A 2H64C 1CXNA 2K3GA 2L5SA 4OM4A 2VLWA 2BHIA 1JE9A 2GOOB 1ZADA 4EY8B 1JBDA 1QM7A 2N99A 1FASA 2FD6U 1M9ZA 3KFDE 1IDHA 1PLOA 1TXBA 3NH7A 1G6MA 1KU6B 1HOYA 1REWC 2X8BB 1KFHA 5EBXA 3QB4B 3HH7A 2ERAA 1F8UB 4ZQYA 1I02A 1V6PA 2MJ0A 1FF4A 2MFAA 1CB9A 3BT2U 1ERAA 1ABTA 1KBAA 1FRAA 3BT1U 1CDTA 2LCRA 1IDGA 1CVOA 2MHYA 4QTIU 1CRFA 1CHVS 1HAJA 2MJYA 3VTSA 1JGKA 1TFSA 1L4WA 1F94A 1RGJA 1IKCA 1HAAA 1VB0A 4BIKB 1BXPA 2H7ZB 1CCQA 4UY2C 2UX2A 1ERGA 5DU1A 4XJJA 1IQ9A 1MAHF 2H62C 1H0JA 5DO6A 1CREA 2H64B 3NEQA 1LX5B 2BTXA 1NORA 1ES7B 3LAQU 1NYUA 2CDXA 1IJCA 4OM5A 1LJZA 2NBTA 2H5FA 1HC9B 2PJYC 2QJAC 1NEAA 2JQPA 1XT3A 2CRSA 1COEA 3FEVA 4DO8A 1KC4A 1CODA 5IMTD 3EVSC 2L03A 2H8UA 1DRSA 4BDTB 2CTXA 1ONJA 2GOOC 1KBSA 2CCXA 4FAOC 1FFJA 2QJBC 2ABXA 2JVEA 3EBXA 1MR6A 1KS6A 2MJ4A 2CRTA 3NDSA 3KFDI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YWH A;  2QJ9 C;  1KXI A;  1LXG A;  2QC1 A;  4IYE A;  1KBT A;  1FSC A;  2OFS A;  1CDS A;  2HLQ A;  1LXH A;  1NTN A;  2MUP A;  1IDL A;  2H62 D;  2H7Z A;  4FAO E;  1KL8 A;  1LSI A;  1UG4 A;  1B41 B;  1BTE A;  2J8B A;  1KTZ B;  4AEA A;  2I9B E;  4RUD A;  3PLC A;  1QKD A;  2MUO A;  1CDR A;  2HLR A;  1NTX A;  1TXA A;  1QKE A;  4HQP F;  3U73 U;  1NYS A;  4P7U A;  1FSS B;  1TGX A;  5IMY C;  2PJY B;  1HC9 A;  1S4Y A;  1W6B A;  2LA1 A;  3ERA A;  1CXO A;  1RL5 A;  1IK8 A;  6EBX A;  1CDQ A;  1IDI A;  1CTX A;  2UWR A;  4LFT A;  1NXB A;  3U74 U;  5DZ5 A;  2H64 C;  1CXN A;  2K3G A;  2L5S A;  4OM4 A;  2VLW A;  2BHI A;  1JE9 A;  2GOO B;  1ZAD A;  4EY8 B;  1JBD A;  1QM7 A;  2N99 A;  1FAS A;  2FD6 U;  1M9Z A;  3KFD E;  1IDH A;  1PLO A;  1TXB A;  3NH7 A;  1G6M A;  1KU6 B;  1HOY A;  1REW C;  2X8B B;  1KFH A;  5EBX A;  3QB4 B;  3HH7 A;  2ERA A;  1F8U B;  4ZQY A;  1I02 A;  1V6P A;  2MJ0 A;  1FF4 A;  2MFA A;  1CB9 A;  3BT2 U;  1ERA A;  1ABT A;  1KBA A;  1FRA A;  3BT1 U;  1CDT A;  2LCR A;  1IDG A;  1CVO A;  2MHY A;  4QTI U;  1CRF A;  1CHV S;  1HAJ A;  2MJY A;  3VTS A;  1JGK A;  1TFS A;  1L4W A;  1F94 A;  1RGJ A;  1IKC A;  1HAA A;  1VB0 A;  4BIK B;  1BXP A;  2H7Z B;  1CCQ A;  4UY2 C;  2UX2 A;  1ERG A;  5DU1 A;  4XJJ A;  1IQ9 A;  1MAH F;  2H62 C;  1H0J A;  5DO6 A;  1CRE A;  2H64 B;  3NEQ A;  1LX5 B;  2BTX A;  1NOR A;  1ES7 B;  3LAQ U;  1NYU A;  2CDX A;  1IJC A;  4OM5 A;  1LJZ A;  2NBT A;  2H5F A;  1HC9 B;  2PJY C;  2QJA C;  1NEA A;  2JQP A;  1XT3 A;  2CRS A;  1COE A;  3FEV A;  4DO8 A;  1KC4 A;  1COD A;  5IMT D;  3EVS C;  2L03 A;  2H8U A;  1DRS A;  4BDT B;  2CTX A;  1ONJ A;  2GOO C;  1KBS A;  2CCX A;  4FAO C;  1FFJ A;  2QJB C;  2ABX A;  2JVE A;  3EBX A;  1MR6 A;  1KS6 A;  2MJ4 A;  2CRT A;  3NDS A;  3KFD I; 
#chains in the Genus database with same CATH topology
 1YWH A;  2QJ9 C;  1KXI A;  1LXG A;  2QC1 A;  4IYE A;  1KBT A;  1FSC A;  2OFS A;  1CDS A;  2HLQ A;  1LXH A;  1NTN A;  2MUP A;  1IDL A;  2H62 D;  2H7Z A;  4FAO E;  1KL8 A;  1LSI A;  1UG4 A;  1B41 B;  1BTE A;  2J8B A;  1KTZ B;  4KSN A;  4AEA A;  2I9B E;  4RUD A;  3PLC A;  1QKD A;  2MUO A;  1CDR A;  2HLR A;  1NTX A;  1TXA A;  1QKE A;  4HQP F;  3U73 U;  1NYS A;  4P7U A;  1FSS B;  1TGX A;  5IMY C;  2PJY B;  1HC9 A;  1S4Y A;  1W6B A;  2LA1 A;  3ERA A;  1CXO A;  1RL5 A;  1IK8 A;  6EBX A;  1CDQ A;  1IDI A;  1CTX A;  2UWR A;  4LFT A;  1NXB A;  3U74 U;  5DZ5 A;  2H64 C;  1CXN A;  2K3G A;  2L5S A;  4OM4 A;  2VLW A;  2BHI A;  1JE9 A;  2GOO B;  1ZAD A;  4EY8 B;  1JBD A;  1QM7 A;  2N99 A;  1FAS A;  2FD6 U;  1M9Z A;  3KFD E;  1IDH A;  1PLO A;  1TXB A;  3NH7 A;  1G6M A;  1KU6 B;  1HOY A;  1REW C;  2X8B B;  1KFH A;  5EBX A;  3QB4 B;  3HH7 A;  2ERA A;  1F8U B;  4ZQY A;  1I02 A;  1V6P A;  2MJ0 A;  1FF4 A;  2MFA A;  1CB9 A;  3BT2 U;  1ERA A;  1ABT A;  1KBA A;  1FRA A;  3BT1 U;  1CDT A;  2LCR A;  1IDG A;  1CVO A;  2MHY A;  4QTI U;  1CRF A;  1CHV S;  1HAJ A;  2MJY A;  3VTS A;  1JGK A;  1TFS A;  1L4W A;  1F94 A;  1RGJ A;  1IKC A;  1HAA A;  1VB0 A;  4BIK B;  1BXP A;  2H7Z B;  1CCQ A;  4UY2 C;  2UX2 A;  1ERG A;  5DU1 A;  4XJJ A;  1IQ9 A;  1MAH F;  2H62 C;  1H0J A;  5DO6 A;  1CRE A;  2H64 B;  3NEQ A;  1LX5 B;  2BTX A;  1NOR A;  1ES7 B;  3LAQ U;  1NYU A;  2CDX A;  1IJC A;  4OM5 A;  1LJZ A;  2NBT A;  2H5F A;  1HC9 B;  2PJY C;  2QJA C;  1NEA A;  2JQP A;  1XT3 A;  2CRS A;  1COE A;  3FEV A;  4DO8 A;  1KC4 A;  1COD A;  5IMT D;  3EVS C;  2L03 A;  2H8U A;  1DRS A;  4BDT B;  2CTX A;  1ONJ A;  2GOO C;  1KBS A;  2CCX A;  4FAO C;  1FFJ A;  2QJB C;  2ABX A;  2JVE A;  3EBX A;  1MR6 A;  1KS6 A;  2MJ4 A;  2CRT A;  3NDS A;  3KFD I; 
#chains in the Genus database with same CATH homology
 1YWH A;  2QJ9 C;  1KXI A;  1LXG A;  2QC1 A;  4IYE A;  1KBT A;  1FSC A;  2OFS A;  1CDS A;  2HLQ A;  1LXH A;  1NTN A;  2MUP A;  1IDL A;  2H62 D;  2H7Z A;  4FAO E;  1KL8 A;  1LSI A;  1UG4 A;  1B41 B;  1BTE A;  2J8B A;  1KTZ B;  4KSN A;  4AEA A;  2I9B E;  4RUD A;  3PLC A;  1QKD A;  2MUO A;  1CDR A;  2HLR A;  1NTX A;  1TXA A;  1QKE A;  4HQP F;  3U73 U;  1NYS A;  4P7U A;  1FSS B;  1TGX A;  5IMY C;  2PJY B;  1HC9 A;  1S4Y A;  1W6B A;  2LA1 A;  3ERA A;  1CXO A;  1RL5 A;  1IK8 A;  6EBX A;  1CDQ A;  1IDI A;  1CTX A;  2UWR A;  4LFT A;  1NXB A;  3U74 U;  5DZ5 A;  2H64 C;  1CXN A;  2K3G A;  2L5S A;  4OM4 A;  2VLW A;  2BHI A;  1JE9 A;  2GOO B;  1ZAD A;  4EY8 B;  1JBD A;  1QM7 A;  2N99 A;  1FAS A;  2FD6 U;  1M9Z A;  3KFD E;  1IDH A;  1PLO A;  1TXB A;  3NH7 A;  1G6M A;  1KU6 B;  1HOY A;  1REW C;  2X8B B;  1KFH A;  5EBX A;  3QB4 B;  3HH7 A;  2ERA A;  1F8U B;  4ZQY A;  1I02 A;  1V6P A;  2MJ0 A;  1FF4 A;  2MFA A;  1CB9 A;  3BT2 U;  1ERA A;  1ABT A;  1KBA A;  1FRA A;  3BT1 U;  1CDT A;  2LCR A;  1IDG A;  1CVO A;  2MHY A;  4QTI U;  1CRF A;  1CHV S;  1HAJ A;  2MJY A;  3VTS A;  1JGK A;  1TFS A;  1L4W A;  1F94 A;  1RGJ A;  1IKC A;  1HAA A;  1VB0 A;  4BIK B;  1BXP A;  2H7Z B;  1CCQ A;  4UY2 C;  2UX2 A;  1ERG A;  5DU1 A;  4XJJ A;  1IQ9 A;  1MAH F;  2H62 C;  1H0J A;  5DO6 A;  1CRE A;  2H64 B;  3NEQ A;  1LX5 B;  2BTX A;  1NOR A;  1ES7 B;  3LAQ U;  1NYU A;  2CDX A;  1IJC A;  4OM5 A;  1LJZ A;  2NBT A;  2H5F A;  1HC9 B;  2PJY C;  2QJA C;  1NEA A;  2JQP A;  1XT3 A;  2CRS A;  1COE A;  3FEV A;  4DO8 A;  1KC4 A;  1COD A;  5IMT D;  3EVS C;  2L03 A;  2H8U A;  1DRS A;  4BDT B;  2CTX A;  1ONJ A;  2GOO C;  1KBS A;  2CCX A;  4FAO C;  1FFJ A;  2QJB C;  2ABX A;  2JVE A;  3EBX A;  1MR6 A;  1KS6 A;  2MJ4 A;  2CRT A;  3NDS A;  3KFD I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...