2N99A

Solution structure of the slurp-2, a secreted isoform of lynx1
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
76
structure length
76
Chain Sequence
MIWCHQCTGFGGCSHGSRCLRDSTHCVTTATRVLSNTEDLPLVTKMCHIGCPDIPSLGLGPYVSIACCQTSLCNHD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ly-6/neurotoxin-like protein 1
publication title Secreted Isoform of Human Lynx1 (SLURP-2): Spatial Structure and Pharmacology of Interactions with Different Types of Acetylcholine Receptors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Neuropeptide
total genus 9
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2015-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00021 UPAR_LY6 u-PAR/Ly-6 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2n99A00
1IDIA 3PLCA 5IMYC 2N99A 1IK8A 1JBDA 1NTXA 3VTSA 1CDQA 2H64B 4OM5A 1COEA 1F8UB 2UX2A 1IDGA 2VLWA 2LCRA 2MJYA 4RUDA 2CCXA 2QJBC 6EBXA 1HAJA 1NXBA 1CTXA 1IDLA 1KBAA 4OM4A 1VB0A 5IMTD 2CRSA 1TFSA 2HLRA 2QJAC 2GOOC 5EBXA 1QKEA 4FAOE 1CRFA 1V6PA 1FSCA 1QM7A 1CHVS 1KC4A 2NBTA 4P7UA 3LAQU 3BT1U 2X8BB 1CREA 1KTZB 2ABXA 1CXNA 2MUPA 3KFDI 1MAHF 2J8BA 4BIKB 1KBTA 3U74U 2JQPA 1CODA 2FD6U 2MFAA 4AEAA 1I02A 1W6BA 1FRAA 2UWRA 1IJCA 1CCQA 4DO8A 1M9ZA 1JE9A 3EBXA 4LFTA 1LXGA 1TXBA 2LA1A 4BDTB 2CDXA 3ERAA 1RL5A 2QJ9C 1IQ9A 2H62D 2ERAA 1IKCA 3BT2U 1ZADA 1B41B 1F94A 2L5SA 1CXOA 2MUOA 2JVEA 1TXAA 2BTXA 1BXPA 1FSSB 3NDSA 1REWC 1L4WA 1IDHA 2PJYC 1KS6A 4ZQYA 1XT3A 1ES7B 2GOOB 4IYEA 1KL8A 4UY2C 5DU1A 3KFDE 1BTEA 3FEVA 4QTIU 5DO6A 1FF4A 2H5FA 1H0JA 1YWHA 2MJ4A 2QC1A 1ERGA 2CTXA 1KFHA 1KBSA 1NYSA 3NEQA 4HQPF 1HAAA 4FAOC 3EVSC 1HC9B 1S4YA 1CVOA 1NTNA 1NORA 2CRTA 1HOYA 1MR6A 3HH7A 3NH7A 2BHIA 1TGXA 1KXIA 1NYUA 2HLQA 2H7ZB 1FFJA 1DRSA 2MJ0A 2MHYA 4EY8B 2L03A 1G6MA 1LJZA 1JGKA 1HC9A 1ONJA 1PLOA 2K3GA 2OFSA 1ERAA 1FASA 1LSIA 1LXHA 3QB4B 1LX5B 1CDTA 1CDSA 2H7ZA 1CDRA 2PJYB 1ABTA 2H8UA 1CB9A 1NEAA 1QKDA 2H62C 1KU6B 2H64C 4XJJA 1UG4A 2I9BE 3U73U 1RGJA 5DZ5A
chains in the Genus database with same CATH superfamily
1IDIA 3PLCA 5IMYC 2N99A 1IK8A 1JBDA 1NTXA 3VTSA 1CDQA 2H64B 4OM5A 1COEA 1F8UB 2UX2A 1IDGA 2VLWA 2LCRA 2MJYA 4RUDA 2CCXA 2QJBC 6EBXA 1HAJA 4KSNA 1NXBA 1CTXA 1IDLA 1KBAA 4OM4A 1VB0A 5IMTD 2CRSA 1TFSA 2HLRA 2QJAC 2GOOC 5EBXA 1QKEA 4FAOE 1CRFA 1V6PA 1FSCA 1QM7A 1CHVS 1KC4A 2NBTA 4P7UA 3LAQU 3BT1U 2X8BB 1CREA 1KTZB 2ABXA 1CXNA 2MUPA 3KFDI 1MAHF 2J8BA 4BIKB 1KBTA 3U74U 2JQPA 1CODA 2FD6U 2MFAA 4AEAA 1I02A 1W6BA 1FRAA 2UWRA 1IJCA 1CCQA 4DO8A 1M9ZA 1JE9A 3EBXA 4LFTA 1LXGA 1TXBA 2LA1A 4BDTB 2CDXA 3ERAA 1RL5A 2QJ9C 1IQ9A 2H62D 2ERAA 1IKCA 3BT2U 1ZADA 1B41B 1F94A 2L5SA 1CXOA 2MUOA 2JVEA 1TXAA 2BTXA 1BXPA 1FSSB 3NDSA 1REWC 1L4WA 1IDHA 2PJYC 1KS6A 4ZQYA 1XT3A 1ES7B 2GOOB 4IYEA 1KL8A 4UY2C 5DU1A 3KFDE 1BTEA 3FEVA 4QTIU 5DO6A 1FF4A 2H5FA 1H0JA 1YWHA 2MJ4A 2QC1A 1ERGA 2CTXA 1KFHA 1KBSA 1NYSA 3NEQA 4HQPF 1HAAA 4FAOC 3EVSC 1HC9B 1S4YA 1CVOA 1NTNA 1NORA 2CRTA 1HOYA 1MR6A 3HH7A 3NH7A 2BHIA 1TGXA 1KXIA 1NYUA 2HLQA 2H7ZB 1FFJA 1DRSA 2MJ0A 2MHYA 4EY8B 2L03A 1G6MA 1LJZA 1JGKA 1HC9A 1ONJA 1PLOA 2K3GA 2OFSA 1ERAA 1FASA 1LSIA 1LXHA 3QB4B 1LX5B 1CDTA 1CDSA 2H7ZA 1CDRA 2PJYB 1ABTA 2H8UA 1CB9A 1NEAA 1QKDA 2H62C 1KU6B 2H64C 4XJJA 1UG4A 2I9BE 3U73U 1RGJA 5DZ5A
chains in the Genus database with same CATH topology
1IDIA 3PLCA 5IMYC 2N99A 1IK8A 1JBDA 1NTXA 3VTSA 1CDQA 2H64B 4OM5A 1COEA 1F8UB 2UX2A 1IDGA 2VLWA 2LCRA 2MJYA 4RUDA 2CCXA 2QJBC 6EBXA 1HAJA 4KSNA 1NXBA 1CTXA 1IDLA 1KBAA 4OM4A 1VB0A 5IMTD 2CRSA 1TFSA 2HLRA 2QJAC 2GOOC 5EBXA 1QKEA 4FAOE 1CRFA 1V6PA 1FSCA 1QM7A 1CHVS 1KC4A 2NBTA 4P7UA 3LAQU 3BT1U 2X8BB 1CREA 1KTZB 2ABXA 1CXNA 2MUPA 3KFDI 1MAHF 2J8BA 4BIKB 1KBTA 3U74U 2JQPA 1CODA 2FD6U 2MFAA 4AEAA 1I02A 1W6BA 1FRAA 2UWRA 1IJCA 1CCQA 4DO8A 1M9ZA 1JE9A 3EBXA 4LFTA 1LXGA 1TXBA 2LA1A 4BDTB 2CDXA 3ERAA 1RL5A 2QJ9C 1IQ9A 2H62D 2ERAA 1IKCA 3BT2U 1ZADA 1B41B 1F94A 2L5SA 1CXOA 2MUOA 2JVEA 1TXAA 2BTXA 1BXPA 1FSSB 3NDSA 1REWC 1L4WA 1IDHA 2PJYC 1KS6A 4ZQYA 1XT3A 1ES7B 2GOOB 4IYEA 1KL8A 4UY2C 5DU1A 3KFDE 1BTEA 3FEVA 4QTIU 5DO6A 1FF4A 2H5FA 1H0JA 1YWHA 2MJ4A 2QC1A 1ERGA 2CTXA 1KFHA 1KBSA 1NYSA 3NEQA 4HQPF 1HAAA 4FAOC 3EVSC 1HC9B 1S4YA 1CVOA 1NTNA 1NORA 2CRTA 1HOYA 1MR6A 3HH7A 3NH7A 2BHIA 1TGXA 1KXIA 1NYUA 2HLQA 2H7ZB 1FFJA 1DRSA 2MJ0A 2MHYA 4EY8B 2L03A 1G6MA 1LJZA 1JGKA 1HC9A 1ONJA 1PLOA 2K3GA 2OFSA 1ERAA 1FASA 1LSIA 1LXHA 3QB4B 1LX5B 1CDTA 1CDSA 2H7ZA 1CDRA 2PJYB 1ABTA 2H8UA 1CB9A 1NEAA 1QKDA 2H62C 1KU6B 2H64C 4XJJA 1UG4A 2I9BE 3U73U 1RGJA 5DZ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IDI A;  3PLC A;  5IMY C;  2N99 A;  1IK8 A;  1JBD A;  1NTX A;  3VTS A;  1CDQ A;  2H64 B;  4OM5 A;  1COE A;  1F8U B;  2UX2 A;  1IDG A;  2VLW A;  2LCR A;  2MJY A;  4RUD A;  2CCX A;  2QJB C;  6EBX A;  1HAJ A;  1NXB A;  1CTX A;  1IDL A;  1KBA A;  4OM4 A;  1VB0 A;  5IMT D;  2CRS A;  1TFS A;  2HLR A;  2QJA C;  2GOO C;  5EBX A;  1QKE A;  4FAO E;  1CRF A;  1V6P A;  1FSC A;  1QM7 A;  1CHV S;  1KC4 A;  2NBT A;  4P7U A;  3LAQ U;  3BT1 U;  2X8B B;  1CRE A;  1KTZ B;  2ABX A;  1CXN A;  2MUP A;  3KFD I;  1MAH F;  2J8B A;  4BIK B;  1KBT A;  3U74 U;  2JQP A;  1COD A;  2FD6 U;  2MFA A;  4AEA A;  1I02 A;  1W6B A;  1FRA A;  2UWR A;  1IJC A;  1CCQ A;  4DO8 A;  1M9Z A;  1JE9 A;  3EBX A;  4LFT A;  1LXG A;  1TXB A;  2LA1 A;  4BDT B;  2CDX A;  3ERA A;  1RL5 A;  2QJ9 C;  1IQ9 A;  2H62 D;  2ERA A;  1IKC A;  3BT2 U;  1ZAD A;  1B41 B;  1F94 A;  2L5S A;  1CXO A;  2MUO A;  2JVE A;  1TXA A;  2BTX A;  1BXP A;  1FSS B;  3NDS A;  1REW C;  1L4W A;  1IDH A;  2PJY C;  1KS6 A;  4ZQY A;  1XT3 A;  1ES7 B;  2GOO B;  4IYE A;  1KL8 A;  4UY2 C;  5DU1 A;  3KFD E;  1BTE A;  3FEV A;  4QTI U;  5DO6 A;  1FF4 A;  2H5F A;  1H0J A;  1YWH A;  2MJ4 A;  2QC1 A;  1ERG A;  2CTX A;  1KFH A;  1KBS A;  1NYS A;  3NEQ A;  4HQP F;  1HAA A;  4FAO C;  3EVS C;  1HC9 B;  1S4Y A;  1CVO A;  1NTN A;  1NOR A;  2CRT A;  1HOY A;  1MR6 A;  3HH7 A;  3NH7 A;  2BHI A;  1TGX A;  1KXI A;  1NYU A;  2HLQ A;  2H7Z B;  1FFJ A;  1DRS A;  2MJ0 A;  2MHY A;  4EY8 B;  2L03 A;  1G6M A;  1LJZ A;  1JGK A;  1HC9 A;  1ONJ A;  1PLO A;  2K3G A;  2OFS A;  1ERA A;  1FAS A;  1LSI A;  1LXH A;  3QB4 B;  1LX5 B;  1CDT A;  1CDS A;  2H7Z A;  1CDR A;  2PJY B;  1ABT A;  2H8U A;  1CB9 A;  1NEA A;  1QKD A;  2H62 C;  1KU6 B;  2H64 C;  4XJJ A;  1UG4 A;  2I9B E;  3U73 U;  1RGJ A;  5DZ5 A; 
#chains in the Genus database with same CATH topology
 1IDI A;  3PLC A;  5IMY C;  2N99 A;  1IK8 A;  1JBD A;  1NTX A;  3VTS A;  1CDQ A;  2H64 B;  4OM5 A;  1COE A;  1F8U B;  2UX2 A;  1IDG A;  2VLW A;  2LCR A;  2MJY A;  4RUD A;  2CCX A;  2QJB C;  6EBX A;  1HAJ A;  4KSN A;  1NXB A;  1CTX A;  1IDL A;  1KBA A;  4OM4 A;  1VB0 A;  5IMT D;  2CRS A;  1TFS A;  2HLR A;  2QJA C;  2GOO C;  5EBX A;  1QKE A;  4FAO E;  1CRF A;  1V6P A;  1FSC A;  1QM7 A;  1CHV S;  1KC4 A;  2NBT A;  4P7U A;  3LAQ U;  3BT1 U;  2X8B B;  1CRE A;  1KTZ B;  2ABX A;  1CXN A;  2MUP A;  3KFD I;  1MAH F;  2J8B A;  4BIK B;  1KBT A;  3U74 U;  2JQP A;  1COD A;  2FD6 U;  2MFA A;  4AEA A;  1I02 A;  1W6B A;  1FRA A;  2UWR A;  1IJC A;  1CCQ A;  4DO8 A;  1M9Z A;  1JE9 A;  3EBX A;  4LFT A;  1LXG A;  1TXB A;  2LA1 A;  4BDT B;  2CDX A;  3ERA A;  1RL5 A;  2QJ9 C;  1IQ9 A;  2H62 D;  2ERA A;  1IKC A;  3BT2 U;  1ZAD A;  1B41 B;  1F94 A;  2L5S A;  1CXO A;  2MUO A;  2JVE A;  1TXA A;  2BTX A;  1BXP A;  1FSS B;  3NDS A;  1REW C;  1L4W A;  1IDH A;  2PJY C;  1KS6 A;  4ZQY A;  1XT3 A;  1ES7 B;  2GOO B;  4IYE A;  1KL8 A;  4UY2 C;  5DU1 A;  3KFD E;  1BTE A;  3FEV A;  4QTI U;  5DO6 A;  1FF4 A;  2H5F A;  1H0J A;  1YWH A;  2MJ4 A;  2QC1 A;  1ERG A;  2CTX A;  1KFH A;  1KBS A;  1NYS A;  3NEQ A;  4HQP F;  1HAA A;  4FAO C;  3EVS C;  1HC9 B;  1S4Y A;  1CVO A;  1NTN A;  1NOR A;  2CRT A;  1HOY A;  1MR6 A;  3HH7 A;  3NH7 A;  2BHI A;  1TGX A;  1KXI A;  1NYU A;  2HLQ A;  2H7Z B;  1FFJ A;  1DRS A;  2MJ0 A;  2MHY A;  4EY8 B;  2L03 A;  1G6M A;  1LJZ A;  1JGK A;  1HC9 A;  1ONJ A;  1PLO A;  2K3G A;  2OFS A;  1ERA A;  1FAS A;  1LSI A;  1LXH A;  3QB4 B;  1LX5 B;  1CDT A;  1CDS A;  2H7Z A;  1CDR A;  2PJY B;  1ABT A;  2H8U A;  1CB9 A;  1NEA A;  1QKD A;  2H62 C;  1KU6 B;  2H64 C;  4XJJ A;  1UG4 A;  2I9B E;  3U73 U;  1RGJ A;  5DZ5 A; 
#chains in the Genus database with same CATH homology
 1IDI A;  3PLC A;  5IMY C;  2N99 A;  1IK8 A;  1JBD A;  1NTX A;  3VTS A;  1CDQ A;  2H64 B;  4OM5 A;  1COE A;  1F8U B;  2UX2 A;  1IDG A;  2VLW A;  2LCR A;  2MJY A;  4RUD A;  2CCX A;  2QJB C;  6EBX A;  1HAJ A;  4KSN A;  1NXB A;  1CTX A;  1IDL A;  1KBA A;  4OM4 A;  1VB0 A;  5IMT D;  2CRS A;  1TFS A;  2HLR A;  2QJA C;  2GOO C;  5EBX A;  1QKE A;  4FAO E;  1CRF A;  1V6P A;  1FSC A;  1QM7 A;  1CHV S;  1KC4 A;  2NBT A;  4P7U A;  3LAQ U;  3BT1 U;  2X8B B;  1CRE A;  1KTZ B;  2ABX A;  1CXN A;  2MUP A;  3KFD I;  1MAH F;  2J8B A;  4BIK B;  1KBT A;  3U74 U;  2JQP A;  1COD A;  2FD6 U;  2MFA A;  4AEA A;  1I02 A;  1W6B A;  1FRA A;  2UWR A;  1IJC A;  1CCQ A;  4DO8 A;  1M9Z A;  1JE9 A;  3EBX A;  4LFT A;  1LXG A;  1TXB A;  2LA1 A;  4BDT B;  2CDX A;  3ERA A;  1RL5 A;  2QJ9 C;  1IQ9 A;  2H62 D;  2ERA A;  1IKC A;  3BT2 U;  1ZAD A;  1B41 B;  1F94 A;  2L5S A;  1CXO A;  2MUO A;  2JVE A;  1TXA A;  2BTX A;  1BXP A;  1FSS B;  3NDS A;  1REW C;  1L4W A;  1IDH A;  2PJY C;  1KS6 A;  4ZQY A;  1XT3 A;  1ES7 B;  2GOO B;  4IYE A;  1KL8 A;  4UY2 C;  5DU1 A;  3KFD E;  1BTE A;  3FEV A;  4QTI U;  5DO6 A;  1FF4 A;  2H5F A;  1H0J A;  1YWH A;  2MJ4 A;  2QC1 A;  1ERG A;  2CTX A;  1KFH A;  1KBS A;  1NYS A;  3NEQ A;  4HQP F;  1HAA A;  4FAO C;  3EVS C;  1HC9 B;  1S4Y A;  1CVO A;  1NTN A;  1NOR A;  2CRT A;  1HOY A;  1MR6 A;  3HH7 A;  3NH7 A;  2BHI A;  1TGX A;  1KXI A;  1NYU A;  2HLQ A;  2H7Z B;  1FFJ A;  1DRS A;  2MJ0 A;  2MHY A;  4EY8 B;  2L03 A;  1G6M A;  1LJZ A;  1JGK A;  1HC9 A;  1ONJ A;  1PLO A;  2K3G A;  2OFS A;  1ERA A;  1FAS A;  1LSI A;  1LXH A;  3QB4 B;  1LX5 B;  1CDT A;  1CDS A;  2H7Z A;  1CDR A;  2PJY B;  1ABT A;  2H8U A;  1CB9 A;  1NEA A;  1QKD A;  2H62 C;  1KU6 B;  2H64 C;  4XJJ A;  1UG4 A;  2I9B E;  3U73 U;  1RGJ A;  5DZ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...