2H62D

Crystal structure of a ternary ligand-receptor complex of bmp-2
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
93
structure length
93
Chain Sequence
AETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hormone/growth factor
molecule keywords Bone morphogenetic protein 2
publication title A silent H-bond can be mutationally activated for high-affinity interaction of BMP-2 and activin type IIB receptor.
pubmed doi rcsb
source organism Homo sapiens
total genus 21
structure length 93
sequence length 93
ec nomenclature ec 2.7.11.30: Receptor protein serine/threonine kinase.
pdb deposition date 2006-05-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2h62D00
5DO6A 1FFJA 1NEAA 6EBXA 1KXIA 1NXBA 1IJCA 2MUOA 3EVSC 2QC1A 2CTXA 1FASA 4QTIU 2LA1A 1NYSA 1COEA 1TXAA 2JVEA 1ABTA 2BTXA 1UG4A 1NTNA 1TXBA 1FRAA 2ERAA 1BTEA 1IDLA 2CDXA 1CRFA 4LFTA 1I02A 1IK8A 2H7ZA 2K3GA 1XT3A 2L5SA 1RL5A 3NH7A 3U74U 1CCQA 1CB9A 3FEVA 2OFSA 5EBXA 2N99A 4EY8B 1CDRA 2QJ9C 1QM7A 3HH7A 1LJZA 2CCXA 1LXHA 1QKEA 1TFSA 1CREA 1JBDA 1ES7B 4FAOE 3KFDI 2I9BE 1CXNA 3VTSA 1CHVS 2QJBC 5DU1A 2MFAA 3QB4B 2MHYA 1MAHF 1F94A 2J8BA 1G6MA 2H7ZB 2MJ4A 1BXPA 1FSSB 1ERGA 1F8UB 2VLWA 3BT1U 2GOOC 1NTXA 1LSIA 2CRSA 1NORA 4OM5A 1V6PA 1MR6A 1KU6B 1JE9A 2H62D 2CRTA 1RGJA 2H5FA 1HC9A 1KBSA 1VB0A 1CDTA 1JGKA 4IYEA 2NBTA 1IKCA 2ABXA 1ZADA 2HLRA 2MJYA 2QJAC 1CTXA 1IDHA 4BDTB 1FSCA 2H62C 1DRSA 2PJYB 1LX5B 1IDGA 1QKDA 2PJYC 2MUPA 3BT2U 1TGXA 1NYUA 2GOOB 5DZ5A 1IDIA 1B41B 3ERAA 1CDSA 1CXOA 1KTZB 1FF4A 2FD6U 1YWHA 1CVOA 1W6BA 4HQPF 1HAJA 1KBTA 4P7UA 4FAOC 1KFHA 2JQPA 2LCRA 1HOYA 4UY2C 1M9ZA 3EBXA 1PLOA 4BIKB 1HC9B 2H64B 3LAQU 4AEAA 4OM4A 2H64C 3NEQA 1H0JA 1KBAA 1CDQA 1REWC 2UX2A 2H8UA 1L4WA 1ERAA 1CODA 2MJ0A 3U73U 2L03A 2UWRA 2BHIA 5IMTD 5IMYC 3KFDE 1KL8A 1ONJA 1KC4A 1LXGA 4XJJA 4ZQYA 4RUDA 3NDSA 1IQ9A 2HLQA 1KS6A 1HAAA 3PLCA 2X8BB 1S4YA 4DO8A
chains in the Genus database with same CATH superfamily
5DO6A 1FFJA 1NEAA 6EBXA 1KXIA 1NXBA 1IJCA 2MUOA 3EVSC 2QC1A 2CTXA 1FASA 4QTIU 2LA1A 1NYSA 1COEA 1TXAA 2JVEA 1ABTA 2BTXA 1UG4A 1NTNA 1TXBA 1FRAA 2ERAA 1BTEA 1IDLA 2CDXA 1CRFA 4LFTA 1I02A 1IK8A 2H7ZA 2K3GA 1XT3A 2L5SA 1RL5A 3NH7A 3U74U 1CCQA 1CB9A 3FEVA 2OFSA 5EBXA 2N99A 4EY8B 1CDRA 2QJ9C 1QM7A 3HH7A 1LJZA 2CCXA 1LXHA 1QKEA 1TFSA 1CREA 1JBDA 1ES7B 4FAOE 3KFDI 2I9BE 1CXNA 3VTSA 1CHVS 2QJBC 5DU1A 2MFAA 3QB4B 2MHYA 1MAHF 1F94A 2J8BA 1G6MA 2H7ZB 2MJ4A 1BXPA 1FSSB 1ERGA 1F8UB 2VLWA 3BT1U 2GOOC 1NTXA 1LSIA 2CRSA 1NORA 4OM5A 1V6PA 1MR6A 1KU6B 1JE9A 2H62D 2CRTA 1RGJA 2H5FA 1HC9A 1KBSA 1VB0A 1CDTA 1JGKA 4IYEA 2NBTA 1IKCA 2ABXA 1ZADA 2HLRA 2MJYA 2QJAC 1CTXA 1IDHA 4BDTB 1FSCA 2H62C 1DRSA 2PJYB 1LX5B 1IDGA 1QKDA 2PJYC 2MUPA 3BT2U 1TGXA 1NYUA 2GOOB 5DZ5A 1IDIA 1B41B 3ERAA 1CDSA 1CXOA 1KTZB 1FF4A 2FD6U 1YWHA 1CVOA 1W6BA 4HQPF 1HAJA 1KBTA 4P7UA 4FAOC 1KFHA 2JQPA 2LCRA 1HOYA 4UY2C 1M9ZA 3EBXA 1PLOA 4BIKB 1HC9B 2H64B 3LAQU 4AEAA 4OM4A 2H64C 3NEQA 1H0JA 1KBAA 1CDQA 1REWC 2UX2A 2H8UA 1L4WA 1ERAA 1CODA 2MJ0A 3U73U 2L03A 2UWRA 2BHIA 5IMTD 5IMYC 3KFDE 1KL8A 1ONJA 1KC4A 1LXGA 4XJJA 4KSNA 4ZQYA 4RUDA 3NDSA 1IQ9A 2HLQA 1KS6A 1HAAA 3PLCA 2X8BB 1S4YA 4DO8A
chains in the Genus database with same CATH topology
5DO6A 1FFJA 1NEAA 6EBXA 1KXIA 1NXBA 1IJCA 2MUOA 3EVSC 2QC1A 2CTXA 1FASA 4QTIU 2LA1A 1NYSA 1COEA 1TXAA 2JVEA 1ABTA 2BTXA 1UG4A 1NTNA 1TXBA 1FRAA 2ERAA 1BTEA 1IDLA 2CDXA 1CRFA 4LFTA 1I02A 1IK8A 2H7ZA 2K3GA 1XT3A 2L5SA 1RL5A 3NH7A 3U74U 1CCQA 1CB9A 3FEVA 2OFSA 5EBXA 2N99A 4EY8B 1CDRA 2QJ9C 1QM7A 3HH7A 1LJZA 2CCXA 1LXHA 1QKEA 1TFSA 1CREA 1JBDA 1ES7B 4FAOE 3KFDI 2I9BE 1CXNA 3VTSA 1CHVS 2QJBC 5DU1A 2MFAA 3QB4B 2MHYA 1MAHF 1F94A 2J8BA 1G6MA 2H7ZB 2MJ4A 1BXPA 1FSSB 1ERGA 1F8UB 2VLWA 3BT1U 2GOOC 1NTXA 1LSIA 2CRSA 1NORA 4OM5A 1V6PA 1MR6A 1KU6B 1JE9A 2H62D 2CRTA 1RGJA 2H5FA 1HC9A 1KBSA 1VB0A 1CDTA 1JGKA 4IYEA 2NBTA 1IKCA 2ABXA 1ZADA 2HLRA 2MJYA 2QJAC 1CTXA 1IDHA 4BDTB 1FSCA 2H62C 1DRSA 2PJYB 1LX5B 1IDGA 1QKDA 2PJYC 2MUPA 3BT2U 1TGXA 1NYUA 2GOOB 5DZ5A 1IDIA 1B41B 3ERAA 1CDSA 1CXOA 1KTZB 1FF4A 2FD6U 1YWHA 1CVOA 1W6BA 4HQPF 1HAJA 1KBTA 4P7UA 4FAOC 1KFHA 2JQPA 2LCRA 1HOYA 4UY2C 1M9ZA 3EBXA 1PLOA 4BIKB 1HC9B 2H64B 3LAQU 4AEAA 4OM4A 2H64C 3NEQA 1H0JA 1KBAA 1CDQA 1REWC 2UX2A 2H8UA 1L4WA 1ERAA 1CODA 2MJ0A 3U73U 2L03A 2UWRA 2BHIA 5IMTD 5IMYC 3KFDE 1KL8A 1ONJA 1KC4A 1LXGA 4XJJA 4KSNA 4ZQYA 4RUDA 3NDSA 1IQ9A 2HLQA 1KS6A 1HAAA 3PLCA 2X8BB 1S4YA 4DO8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DO6 A;  1FFJ A;  1NEA A;  6EBX A;  1KXI A;  1NXB A;  1IJC A;  2MUO A;  3EVS C;  2QC1 A;  2CTX A;  1FAS A;  4QTI U;  2LA1 A;  1NYS A;  1COE A;  1TXA A;  2JVE A;  1ABT A;  2BTX A;  1UG4 A;  1NTN A;  1TXB A;  1FRA A;  2ERA A;  1BTE A;  1IDL A;  2CDX A;  1CRF A;  4LFT A;  1I02 A;  1IK8 A;  2H7Z A;  2K3G A;  1XT3 A;  2L5S A;  1RL5 A;  3NH7 A;  3U74 U;  1CCQ A;  1CB9 A;  3FEV A;  2OFS A;  5EBX A;  2N99 A;  4EY8 B;  1CDR A;  2QJ9 C;  1QM7 A;  3HH7 A;  1LJZ A;  2CCX A;  1LXH A;  1QKE A;  1TFS A;  1CRE A;  1JBD A;  1ES7 B;  4FAO E;  3KFD I;  2I9B E;  1CXN A;  3VTS A;  1CHV S;  2QJB C;  5DU1 A;  2MFA A;  3QB4 B;  2MHY A;  1MAH F;  1F94 A;  2J8B A;  1G6M A;  2H7Z B;  2MJ4 A;  1BXP A;  1FSS B;  1ERG A;  1F8U B;  2VLW A;  3BT1 U;  2GOO C;  1NTX A;  1LSI A;  2CRS A;  1NOR A;  4OM5 A;  1V6P A;  1MR6 A;  1KU6 B;  1JE9 A;  2H62 D;  2CRT A;  1RGJ A;  2H5F A;  1HC9 A;  1KBS A;  1VB0 A;  1CDT A;  1JGK A;  4IYE A;  2NBT A;  1IKC A;  2ABX A;  1ZAD A;  2HLR A;  2MJY A;  2QJA C;  1CTX A;  1IDH A;  4BDT B;  1FSC A;  2H62 C;  1DRS A;  2PJY B;  1LX5 B;  1IDG A;  1QKD A;  2PJY C;  2MUP A;  3BT2 U;  1TGX A;  1NYU A;  2GOO B;  5DZ5 A;  1IDI A;  1B41 B;  3ERA A;  1CDS A;  1CXO A;  1KTZ B;  1FF4 A;  2FD6 U;  1YWH A;  1CVO A;  1W6B A;  4HQP F;  1HAJ A;  1KBT A;  4P7U A;  4FAO C;  1KFH A;  2JQP A;  2LCR A;  1HOY A;  4UY2 C;  1M9Z A;  3EBX A;  1PLO A;  4BIK B;  1HC9 B;  2H64 B;  3LAQ U;  4AEA A;  4OM4 A;  2H64 C;  3NEQ A;  1H0J A;  1KBA A;  1CDQ A;  1REW C;  2UX2 A;  2H8U A;  1L4W A;  1ERA A;  1COD A;  2MJ0 A;  3U73 U;  2L03 A;  2UWR A;  2BHI A;  5IMT D;  5IMY C;  3KFD E;  1KL8 A;  1ONJ A;  1KC4 A;  1LXG A;  4XJJ A;  4ZQY A;  4RUD A;  3NDS A;  1IQ9 A;  2HLQ A;  1KS6 A;  1HAA A;  3PLC A;  2X8B B;  1S4Y A;  4DO8 A; 
#chains in the Genus database with same CATH topology
 5DO6 A;  1FFJ A;  1NEA A;  6EBX A;  1KXI A;  1NXB A;  1IJC A;  2MUO A;  3EVS C;  2QC1 A;  2CTX A;  1FAS A;  4QTI U;  2LA1 A;  1NYS A;  1COE A;  1TXA A;  2JVE A;  1ABT A;  2BTX A;  1UG4 A;  1NTN A;  1TXB A;  1FRA A;  2ERA A;  1BTE A;  1IDL A;  2CDX A;  1CRF A;  4LFT A;  1I02 A;  1IK8 A;  2H7Z A;  2K3G A;  1XT3 A;  2L5S A;  1RL5 A;  3NH7 A;  3U74 U;  1CCQ A;  1CB9 A;  3FEV A;  2OFS A;  5EBX A;  2N99 A;  4EY8 B;  1CDR A;  2QJ9 C;  1QM7 A;  3HH7 A;  1LJZ A;  2CCX A;  1LXH A;  1QKE A;  1TFS A;  1CRE A;  1JBD A;  1ES7 B;  4FAO E;  3KFD I;  2I9B E;  1CXN A;  3VTS A;  1CHV S;  2QJB C;  5DU1 A;  2MFA A;  3QB4 B;  2MHY A;  1MAH F;  1F94 A;  2J8B A;  1G6M A;  2H7Z B;  2MJ4 A;  1BXP A;  1FSS B;  1ERG A;  1F8U B;  2VLW A;  3BT1 U;  2GOO C;  1NTX A;  1LSI A;  2CRS A;  1NOR A;  4OM5 A;  1V6P A;  1MR6 A;  1KU6 B;  1JE9 A;  2H62 D;  2CRT A;  1RGJ A;  2H5F A;  1HC9 A;  1KBS A;  1VB0 A;  1CDT A;  1JGK A;  4IYE A;  2NBT A;  1IKC A;  2ABX A;  1ZAD A;  2HLR A;  2MJY A;  2QJA C;  1CTX A;  1IDH A;  4BDT B;  1FSC A;  2H62 C;  1DRS A;  2PJY B;  1LX5 B;  1IDG A;  1QKD A;  2PJY C;  2MUP A;  3BT2 U;  1TGX A;  1NYU A;  2GOO B;  5DZ5 A;  1IDI A;  1B41 B;  3ERA A;  1CDS A;  1CXO A;  1KTZ B;  1FF4 A;  2FD6 U;  1YWH A;  1CVO A;  1W6B A;  4HQP F;  1HAJ A;  1KBT A;  4P7U A;  4FAO C;  1KFH A;  2JQP A;  2LCR A;  1HOY A;  4UY2 C;  1M9Z A;  3EBX A;  1PLO A;  4BIK B;  1HC9 B;  2H64 B;  3LAQ U;  4AEA A;  4OM4 A;  2H64 C;  3NEQ A;  1H0J A;  1KBA A;  1CDQ A;  1REW C;  2UX2 A;  2H8U A;  1L4W A;  1ERA A;  1COD A;  2MJ0 A;  3U73 U;  2L03 A;  2UWR A;  2BHI A;  5IMT D;  5IMY C;  3KFD E;  1KL8 A;  1ONJ A;  1KC4 A;  1LXG A;  4XJJ A;  4KSN A;  4ZQY A;  4RUD A;  3NDS A;  1IQ9 A;  2HLQ A;  1KS6 A;  1HAA A;  3PLC A;  2X8B B;  1S4Y A;  4DO8 A; 
#chains in the Genus database with same CATH homology
 5DO6 A;  1FFJ A;  1NEA A;  6EBX A;  1KXI A;  1NXB A;  1IJC A;  2MUO A;  3EVS C;  2QC1 A;  2CTX A;  1FAS A;  4QTI U;  2LA1 A;  1NYS A;  1COE A;  1TXA A;  2JVE A;  1ABT A;  2BTX A;  1UG4 A;  1NTN A;  1TXB A;  1FRA A;  2ERA A;  1BTE A;  1IDL A;  2CDX A;  1CRF A;  4LFT A;  1I02 A;  1IK8 A;  2H7Z A;  2K3G A;  1XT3 A;  2L5S A;  1RL5 A;  3NH7 A;  3U74 U;  1CCQ A;  1CB9 A;  3FEV A;  2OFS A;  5EBX A;  2N99 A;  4EY8 B;  1CDR A;  2QJ9 C;  1QM7 A;  3HH7 A;  1LJZ A;  2CCX A;  1LXH A;  1QKE A;  1TFS A;  1CRE A;  1JBD A;  1ES7 B;  4FAO E;  3KFD I;  2I9B E;  1CXN A;  3VTS A;  1CHV S;  2QJB C;  5DU1 A;  2MFA A;  3QB4 B;  2MHY A;  1MAH F;  1F94 A;  2J8B A;  1G6M A;  2H7Z B;  2MJ4 A;  1BXP A;  1FSS B;  1ERG A;  1F8U B;  2VLW A;  3BT1 U;  2GOO C;  1NTX A;  1LSI A;  2CRS A;  1NOR A;  4OM5 A;  1V6P A;  1MR6 A;  1KU6 B;  1JE9 A;  2H62 D;  2CRT A;  1RGJ A;  2H5F A;  1HC9 A;  1KBS A;  1VB0 A;  1CDT A;  1JGK A;  4IYE A;  2NBT A;  1IKC A;  2ABX A;  1ZAD A;  2HLR A;  2MJY A;  2QJA C;  1CTX A;  1IDH A;  4BDT B;  1FSC A;  2H62 C;  1DRS A;  2PJY B;  1LX5 B;  1IDG A;  1QKD A;  2PJY C;  2MUP A;  3BT2 U;  1TGX A;  1NYU A;  2GOO B;  5DZ5 A;  1IDI A;  1B41 B;  3ERA A;  1CDS A;  1CXO A;  1KTZ B;  1FF4 A;  2FD6 U;  1YWH A;  1CVO A;  1W6B A;  4HQP F;  1HAJ A;  1KBT A;  4P7U A;  4FAO C;  1KFH A;  2JQP A;  2LCR A;  1HOY A;  4UY2 C;  1M9Z A;  3EBX A;  1PLO A;  4BIK B;  1HC9 B;  2H64 B;  3LAQ U;  4AEA A;  4OM4 A;  2H64 C;  3NEQ A;  1H0J A;  1KBA A;  1CDQ A;  1REW C;  2UX2 A;  2H8U A;  1L4W A;  1ERA A;  1COD A;  2MJ0 A;  3U73 U;  2L03 A;  2UWR A;  2BHI A;  5IMT D;  5IMY C;  3KFD E;  1KL8 A;  1ONJ A;  1KC4 A;  1LXG A;  4XJJ A;  4KSN A;  4ZQY A;  4RUD A;  3NDS A;  1IQ9 A;  2HLQ A;  1KS6 A;  1HAA A;  3PLC A;  2X8B B;  1S4Y A;  4DO8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...