2H62D

Crystal structure of a ternary ligand-receptor complex of bmp-2
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
93
structure length
93
Chain Sequence
AETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A silent H-bond can be mutationally activated for high-affinity interaction of BMP-2 and activin type IIB receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone/growth factor
molecule keywords Bone morphogenetic protein 2
total genus 21
structure length 93
sequence length 93
ec nomenclature ec 2.7.11.30: Receptor protein serine/threonine kinase.
pdb deposition date 2006-05-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2h62D00
4BIKB 2MUOA 3VTSA 1CDRA 2PJYC 1IDIA 1KS6A 3BT1U 1IQ9A 1ZADA 1V6PA 2H62C 1B41B 2JQPA 1KBAA 2H62D 4OM5A 2CRSA 5DO6A 1QM7A 4FAOC 1HC9A 5IMYC 1RL5A 1ES7B 3BT2U 1JBDA 1FF4A 1IDHA 2UWRA 1RGJA 1REWC 1NEAA 1CDSA 2MUPA 1IJCA 1H0JA 5DZ5A 5IMTD 1HAAA 1F8UB 1TGXA 2BTXA 2MFAA 2L03A 1ABTA 4FAOE 2H64C 1M9ZA 1NORA 1XT3A 1FFJA 1W6BA 1QKEA 5DU1A 4AEAA 2GOOB 1CHVS 1FSCA 4LFTA 1BXPA 2VLWA 2MJ0A 1ONJA 4HQPF 3EVSC 2JVEA 1JGKA 1F94A 1CCQA 2CDXA 3LAQU 1FRAA 1COEA 1NTNA 2QJ9C 3KFDI 3EBXA 3KFDE 1DRSA 1UG4A 1FSSB 2MJ4A 2QJBC 1KXIA 1MAHF 1CB9A 1FASA 2H64B 1TXAA 3HH7A 1CDTA 1ERAA 1CXOA 4ZQYA 1LXGA 3U73U 2HLRA 6EBXA 1IK8A 1JE9A 1PLOA 1LJZA 4P7UA 1S4YA 1KU6B 1KL8A 2H7ZA 1IDLA 2N99A 1G6MA 1QKDA 1VB0A 1KFHA 2UX2A 1KBTA 2HLQA 2I9BE 4EY8B 1LX5B 4QTIU 4BDTB 1CVOA 2QJAC 3FEVA 4DO8A 5EBXA 1MR6A 4OM4A 1CREA 2BHIA 1TFSA 1NYSA 1CTXA 1YWHA 2ERAA 3QB4B 3NH7A 2NBTA 1HAJA 2CCXA 1KTZB 1ERGA 1IKCA 2X8BB 1CRFA 3ERAA 1KBSA 1HOYA 2OFSA 3NDSA 3PLCA 2MJYA 1NTXA 1LSIA 2LA1A 2H5FA 2L5SA 4IYEA 1L4WA 1KC4A 4RUDA 2FD6U 3NEQA 4XJJA 1BTEA 2CRTA 2J8BA 1I02A 2K3GA 2H8UA 2MHYA 4UY2C 2CTXA 3U74U 2H7ZB 1IDGA 1NYUA 2ABXA 1NXBA 1TXBA 1HC9B 1CDQA 1CXNA 2GOOC 2QC1A 2PJYB 2LCRA 1LXHA 1CODA
chains in the Genus database with same CATH superfamily
4BIKB 2MUOA 3VTSA 1CDRA 2PJYC 1IDIA 1KS6A 3BT1U 1IQ9A 1ZADA 1V6PA 2H62C 1B41B 2JQPA 1KBAA 2H62D 4OM5A 2CRSA 5DO6A 1QM7A 4FAOC 1HC9A 5IMYC 1RL5A 1ES7B 3BT2U 1JBDA 1FF4A 1IDHA 2UWRA 1RGJA 1REWC 1NEAA 1CDSA 2MUPA 1IJCA 1H0JA 5DZ5A 5IMTD 1HAAA 1F8UB 1TGXA 2BTXA 2MFAA 2L03A 1ABTA 4FAOE 2H64C 1M9ZA 1NORA 1XT3A 1FFJA 1W6BA 1QKEA 5DU1A 4AEAA 2GOOB 1CHVS 1FSCA 4LFTA 1BXPA 2VLWA 2MJ0A 1ONJA 4HQPF 3EVSC 2JVEA 1JGKA 1F94A 1CCQA 2CDXA 3LAQU 1FRAA 1COEA 1NTNA 2QJ9C 3KFDI 3EBXA 3KFDE 1DRSA 4KSNA 1UG4A 1FSSB 2MJ4A 2QJBC 1KXIA 1MAHF 1CB9A 1FASA 2H64B 1TXAA 3HH7A 1CDTA 1ERAA 1CXOA 4ZQYA 1LXGA 3U73U 2HLRA 6EBXA 1IK8A 1JE9A 1PLOA 1LJZA 4P7UA 1S4YA 1KU6B 1KL8A 2H7ZA 1IDLA 2N99A 1G6MA 1QKDA 1VB0A 1KFHA 2UX2A 1KBTA 2HLQA 2I9BE 4EY8B 1LX5B 4QTIU 4BDTB 1CVOA 2QJAC 3FEVA 4DO8A 5EBXA 1MR6A 4OM4A 1CREA 2BHIA 1TFSA 1NYSA 1CTXA 1YWHA 2ERAA 3QB4B 3NH7A 2NBTA 1HAJA 2CCXA 1KTZB 1ERGA 1IKCA 2X8BB 1CRFA 3ERAA 1KBSA 1HOYA 2OFSA 3NDSA 3PLCA 2MJYA 1NTXA 1LSIA 2LA1A 2H5FA 2L5SA 4IYEA 1L4WA 1KC4A 4RUDA 2FD6U 3NEQA 4XJJA 1BTEA 2CRTA 2J8BA 1I02A 2K3GA 2H8UA 2MHYA 4UY2C 2CTXA 3U74U 2H7ZB 1IDGA 1NYUA 2ABXA 1NXBA 1TXBA 1HC9B 1CDQA 1CXNA 2GOOC 2QC1A 2PJYB 2LCRA 1LXHA 1CODA
chains in the Genus database with same CATH topology
4BIKB 2MUOA 3VTSA 1CDRA 2PJYC 1IDIA 1KS6A 3BT1U 1IQ9A 1ZADA 1V6PA 2H62C 1B41B 2JQPA 1KBAA 2H62D 4OM5A 2CRSA 5DO6A 1QM7A 4FAOC 1HC9A 5IMYC 1RL5A 1ES7B 3BT2U 1JBDA 1FF4A 1IDHA 2UWRA 1RGJA 1REWC 1NEAA 1CDSA 2MUPA 1IJCA 1H0JA 5DZ5A 5IMTD 1HAAA 1F8UB 1TGXA 2BTXA 2MFAA 2L03A 1ABTA 4FAOE 2H64C 1M9ZA 1NORA 1XT3A 1FFJA 1W6BA 1QKEA 5DU1A 4AEAA 2GOOB 1CHVS 1FSCA 4LFTA 1BXPA 2VLWA 2MJ0A 1ONJA 4HQPF 3EVSC 2JVEA 1JGKA 1F94A 1CCQA 2CDXA 3LAQU 1FRAA 1COEA 1NTNA 2QJ9C 3KFDI 3EBXA 3KFDE 1DRSA 4KSNA 1UG4A 1FSSB 2MJ4A 2QJBC 1KXIA 1MAHF 1CB9A 1FASA 2H64B 1TXAA 3HH7A 1CDTA 1ERAA 1CXOA 4ZQYA 1LXGA 3U73U 2HLRA 6EBXA 1IK8A 1JE9A 1PLOA 1LJZA 4P7UA 1S4YA 1KU6B 1KL8A 2H7ZA 1IDLA 2N99A 1G6MA 1QKDA 1VB0A 1KFHA 2UX2A 1KBTA 2HLQA 2I9BE 4EY8B 1LX5B 4QTIU 4BDTB 1CVOA 2QJAC 3FEVA 4DO8A 5EBXA 1MR6A 4OM4A 1CREA 2BHIA 1TFSA 1NYSA 1CTXA 1YWHA 2ERAA 3QB4B 3NH7A 2NBTA 1HAJA 2CCXA 1KTZB 1ERGA 1IKCA 2X8BB 1CRFA 3ERAA 1KBSA 1HOYA 2OFSA 3NDSA 3PLCA 2MJYA 1NTXA 1LSIA 2LA1A 2H5FA 2L5SA 4IYEA 1L4WA 1KC4A 4RUDA 2FD6U 3NEQA 4XJJA 1BTEA 2CRTA 2J8BA 1I02A 2K3GA 2H8UA 2MHYA 4UY2C 2CTXA 3U74U 2H7ZB 1IDGA 1NYUA 2ABXA 1NXBA 1TXBA 1HC9B 1CDQA 1CXNA 2GOOC 2QC1A 2PJYB 2LCRA 1LXHA 1CODA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BIK B;  2MUO A;  3VTS A;  1CDR A;  2PJY C;  1IDI A;  1KS6 A;  3BT1 U;  1IQ9 A;  1ZAD A;  1V6P A;  2H62 C;  1B41 B;  2JQP A;  1KBA A;  2H62 D;  4OM5 A;  2CRS A;  5DO6 A;  1QM7 A;  4FAO C;  1HC9 A;  5IMY C;  1RL5 A;  1ES7 B;  3BT2 U;  1JBD A;  1FF4 A;  1IDH A;  2UWR A;  1RGJ A;  1REW C;  1NEA A;  1CDS A;  2MUP A;  1IJC A;  1H0J A;  5DZ5 A;  5IMT D;  1HAA A;  1F8U B;  1TGX A;  2BTX A;  2MFA A;  2L03 A;  1ABT A;  4FAO E;  2H64 C;  1M9Z A;  1NOR A;  1XT3 A;  1FFJ A;  1W6B A;  1QKE A;  5DU1 A;  4AEA A;  2GOO B;  1CHV S;  1FSC A;  4LFT A;  1BXP A;  2VLW A;  2MJ0 A;  1ONJ A;  4HQP F;  3EVS C;  2JVE A;  1JGK A;  1F94 A;  1CCQ A;  2CDX A;  3LAQ U;  1FRA A;  1COE A;  1NTN A;  2QJ9 C;  3KFD I;  3EBX A;  3KFD E;  1DRS A;  1UG4 A;  1FSS B;  2MJ4 A;  2QJB C;  1KXI A;  1MAH F;  1CB9 A;  1FAS A;  2H64 B;  1TXA A;  3HH7 A;  1CDT A;  1ERA A;  1CXO A;  4ZQY A;  1LXG A;  3U73 U;  2HLR A;  6EBX A;  1IK8 A;  1JE9 A;  1PLO A;  1LJZ A;  4P7U A;  1S4Y A;  1KU6 B;  1KL8 A;  2H7Z A;  1IDL A;  2N99 A;  1G6M A;  1QKD A;  1VB0 A;  1KFH A;  2UX2 A;  1KBT A;  2HLQ A;  2I9B E;  4EY8 B;  1LX5 B;  4QTI U;  4BDT B;  1CVO A;  2QJA C;  3FEV A;  4DO8 A;  5EBX A;  1MR6 A;  4OM4 A;  1CRE A;  2BHI A;  1TFS A;  1NYS A;  1CTX A;  1YWH A;  2ERA A;  3QB4 B;  3NH7 A;  2NBT A;  1HAJ A;  2CCX A;  1KTZ B;  1ERG A;  1IKC A;  2X8B B;  1CRF A;  3ERA A;  1KBS A;  1HOY A;  2OFS A;  3NDS A;  3PLC A;  2MJY A;  1NTX A;  1LSI A;  2LA1 A;  2H5F A;  2L5S A;  4IYE A;  1L4W A;  1KC4 A;  4RUD A;  2FD6 U;  3NEQ A;  4XJJ A;  1BTE A;  2CRT A;  2J8B A;  1I02 A;  2K3G A;  2H8U A;  2MHY A;  4UY2 C;  2CTX A;  3U74 U;  2H7Z B;  1IDG A;  1NYU A;  2ABX A;  1NXB A;  1TXB A;  1HC9 B;  1CDQ A;  1CXN A;  2GOO C;  2QC1 A;  2PJY B;  2LCR A;  1LXH A;  1COD A; 
#chains in the Genus database with same CATH topology
 4BIK B;  2MUO A;  3VTS A;  1CDR A;  2PJY C;  1IDI A;  1KS6 A;  3BT1 U;  1IQ9 A;  1ZAD A;  1V6P A;  2H62 C;  1B41 B;  2JQP A;  1KBA A;  2H62 D;  4OM5 A;  2CRS A;  5DO6 A;  1QM7 A;  4FAO C;  1HC9 A;  5IMY C;  1RL5 A;  1ES7 B;  3BT2 U;  1JBD A;  1FF4 A;  1IDH A;  2UWR A;  1RGJ A;  1REW C;  1NEA A;  1CDS A;  2MUP A;  1IJC A;  1H0J A;  5DZ5 A;  5IMT D;  1HAA A;  1F8U B;  1TGX A;  2BTX A;  2MFA A;  2L03 A;  1ABT A;  4FAO E;  2H64 C;  1M9Z A;  1NOR A;  1XT3 A;  1FFJ A;  1W6B A;  1QKE A;  5DU1 A;  4AEA A;  2GOO B;  1CHV S;  1FSC A;  4LFT A;  1BXP A;  2VLW A;  2MJ0 A;  1ONJ A;  4HQP F;  3EVS C;  2JVE A;  1JGK A;  1F94 A;  1CCQ A;  2CDX A;  3LAQ U;  1FRA A;  1COE A;  1NTN A;  2QJ9 C;  3KFD I;  3EBX A;  3KFD E;  1DRS A;  4KSN A;  1UG4 A;  1FSS B;  2MJ4 A;  2QJB C;  1KXI A;  1MAH F;  1CB9 A;  1FAS A;  2H64 B;  1TXA A;  3HH7 A;  1CDT A;  1ERA A;  1CXO A;  4ZQY A;  1LXG A;  3U73 U;  2HLR A;  6EBX A;  1IK8 A;  1JE9 A;  1PLO A;  1LJZ A;  4P7U A;  1S4Y A;  1KU6 B;  1KL8 A;  2H7Z A;  1IDL A;  2N99 A;  1G6M A;  1QKD A;  1VB0 A;  1KFH A;  2UX2 A;  1KBT A;  2HLQ A;  2I9B E;  4EY8 B;  1LX5 B;  4QTI U;  4BDT B;  1CVO A;  2QJA C;  3FEV A;  4DO8 A;  5EBX A;  1MR6 A;  4OM4 A;  1CRE A;  2BHI A;  1TFS A;  1NYS A;  1CTX A;  1YWH A;  2ERA A;  3QB4 B;  3NH7 A;  2NBT A;  1HAJ A;  2CCX A;  1KTZ B;  1ERG A;  1IKC A;  2X8B B;  1CRF A;  3ERA A;  1KBS A;  1HOY A;  2OFS A;  3NDS A;  3PLC A;  2MJY A;  1NTX A;  1LSI A;  2LA1 A;  2H5F A;  2L5S A;  4IYE A;  1L4W A;  1KC4 A;  4RUD A;  2FD6 U;  3NEQ A;  4XJJ A;  1BTE A;  2CRT A;  2J8B A;  1I02 A;  2K3G A;  2H8U A;  2MHY A;  4UY2 C;  2CTX A;  3U74 U;  2H7Z B;  1IDG A;  1NYU A;  2ABX A;  1NXB A;  1TXB A;  1HC9 B;  1CDQ A;  1CXN A;  2GOO C;  2QC1 A;  2PJY B;  2LCR A;  1LXH A;  1COD A; 
#chains in the Genus database with same CATH homology
 4BIK B;  2MUO A;  3VTS A;  1CDR A;  2PJY C;  1IDI A;  1KS6 A;  3BT1 U;  1IQ9 A;  1ZAD A;  1V6P A;  2H62 C;  1B41 B;  2JQP A;  1KBA A;  2H62 D;  4OM5 A;  2CRS A;  5DO6 A;  1QM7 A;  4FAO C;  1HC9 A;  5IMY C;  1RL5 A;  1ES7 B;  3BT2 U;  1JBD A;  1FF4 A;  1IDH A;  2UWR A;  1RGJ A;  1REW C;  1NEA A;  1CDS A;  2MUP A;  1IJC A;  1H0J A;  5DZ5 A;  5IMT D;  1HAA A;  1F8U B;  1TGX A;  2BTX A;  2MFA A;  2L03 A;  1ABT A;  4FAO E;  2H64 C;  1M9Z A;  1NOR A;  1XT3 A;  1FFJ A;  1W6B A;  1QKE A;  5DU1 A;  4AEA A;  2GOO B;  1CHV S;  1FSC A;  4LFT A;  1BXP A;  2VLW A;  2MJ0 A;  1ONJ A;  4HQP F;  3EVS C;  2JVE A;  1JGK A;  1F94 A;  1CCQ A;  2CDX A;  3LAQ U;  1FRA A;  1COE A;  1NTN A;  2QJ9 C;  3KFD I;  3EBX A;  3KFD E;  1DRS A;  4KSN A;  1UG4 A;  1FSS B;  2MJ4 A;  2QJB C;  1KXI A;  1MAH F;  1CB9 A;  1FAS A;  2H64 B;  1TXA A;  3HH7 A;  1CDT A;  1ERA A;  1CXO A;  4ZQY A;  1LXG A;  3U73 U;  2HLR A;  6EBX A;  1IK8 A;  1JE9 A;  1PLO A;  1LJZ A;  4P7U A;  1S4Y A;  1KU6 B;  1KL8 A;  2H7Z A;  1IDL A;  2N99 A;  1G6M A;  1QKD A;  1VB0 A;  1KFH A;  2UX2 A;  1KBT A;  2HLQ A;  2I9B E;  4EY8 B;  1LX5 B;  4QTI U;  4BDT B;  1CVO A;  2QJA C;  3FEV A;  4DO8 A;  5EBX A;  1MR6 A;  4OM4 A;  1CRE A;  2BHI A;  1TFS A;  1NYS A;  1CTX A;  1YWH A;  2ERA A;  3QB4 B;  3NH7 A;  2NBT A;  1HAJ A;  2CCX A;  1KTZ B;  1ERG A;  1IKC A;  2X8B B;  1CRF A;  3ERA A;  1KBS A;  1HOY A;  2OFS A;  3NDS A;  3PLC A;  2MJY A;  1NTX A;  1LSI A;  2LA1 A;  2H5F A;  2L5S A;  4IYE A;  1L4W A;  1KC4 A;  4RUD A;  2FD6 U;  3NEQ A;  4XJJ A;  1BTE A;  2CRT A;  2J8B A;  1I02 A;  2K3G A;  2H8U A;  2MHY A;  4UY2 C;  2CTX A;  3U74 U;  2H7Z B;  1IDG A;  1NYU A;  2ABX A;  1NXB A;  1TXB A;  1HC9 B;  1CDQ A;  1CXN A;  2GOO C;  2QC1 A;  2PJY B;  2LCR A;  1LXH A;  1COD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...