3NH7A

Crystal structure of the neutralizing fab fragment abd1556 bound to the bmp type i receptor ia
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
85
structure length
85
Chain Sequence
PFLKCYCSGHCPDDAINNTCITNGHCFAIIEEDDQGETTLASGCMKYEGSDFQCKDSPKAQLRRTIECCRTNLCNQYLQPTLPPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Antibody fragment Fab AbD1556, heavy chain
publication title A selection fit mechanism in BMP receptor IA as a possible source for BMP ligand-receptor promiscuity
pubmed doi rcsb
source organism Homo sapiens
total genus 11
structure length 85
sequence length 85
chains with identical sequence B, C, D
ec nomenclature ec 2.7.11.30: Receptor protein serine/threonine kinase.
pdb deposition date 2010-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01064 Activin_recp Activin types I and II receptor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 3nh7A00
1REWC 1TXAA 3BT2U 1PLOA 1IJCA 1KL8A 2GOOC 4QTIU 2JQPA 5IMYC 3KFDE 1KC4A 2K3GA 2MFAA 1TFSA 2H8UA 1VB0A 1TXBA 1BTEA 1B41B 3FEVA 1NTXA 4HQPF 1ERGA 1JBDA 1XT3A 1IQ9A 4OM5A 1MAHF 2J8BA 2MJ4A 1G6MA 1ES7B 4LFTA 3NEQA 1HAJA 2H7ZB 3KFDI 1KBAA 1COEA 1FASA 1CTXA 1KXIA 3NH7A 5EBXA 1YWHA 1S4YA 2CRTA 1LXHA 4RUDA 4IYEA 1M9ZA 2PJYB 1FSSB 2QJBC 2GOOB 1UG4A 3U73U 1CREA 1JE9A 4BDTB 1IDHA 2H7ZA 2HLQA 1LX5B 1NTNA 1W6BA 1IKCA 1CCQA 1KBTA 1KBSA 1TGXA 1CDRA 1CXNA 4AEAA 1NXBA 2H62D 3EVSC 1LJZA 2VLWA 1IK8A 2CTXA 4BIKB 5DZ5A 4P7UA 2JVEA 2L5SA 1CXOA 1IDGA 1BXPA 1CDTA 1FSCA 1CDSA 1CVOA 1ZADA 1L4WA 2I9BE 2ERAA 1CB9A 1HC9B 2LA1A 2UX2A 2CCXA 3QB4B 1IDLA 1NYUA 2H64C 2HLRA 3HH7A 4EY8B 1CDQA 3LAQU 2LCRA 1V6PA 1ONJA 1NYSA 2X8BB 1KTZB 1JGKA 1MR6A 1ERAA 4FAOC 2BHIA 3BT1U 3VTSA 1ABTA 1NEAA 5IMTD 1HC9A 1HAAA 3U74U 4OM4A 3PLCA 1H0JA 1CHVS 2MUPA 1QKEA 2MJ0A 4UY2C 3ERAA 2MJYA 1FF4A 2NBTA 2PJYC 1QKDA 3EBXA 5DU1A 2ABXA 2OFSA 1IDIA 2UWRA 2H64B 1FRAA 1F94A 1FFJA 1F8UB 4FAOE 1HOYA 1DRSA 1CRFA 1KU6B 1RGJA 2BTXA 3NDSA 2H62C 2QC1A 2QJ9C 1QM7A 4ZQYA 1KS6A 1LXGA 2FD6U 2MHYA 1CODA 2H5FA 1NORA 2MUOA 4DO8A 2CDXA 2L03A 5DO6A 2CRSA 1RL5A 2N99A 6EBXA 4XJJA 1I02A 1KFHA 1LSIA 2QJAC
chains in the Genus database with same CATH superfamily
1REWC 1TXAA 3BT2U 1PLOA 1IJCA 1KL8A 2GOOC 4QTIU 2JQPA 5IMYC 3KFDE 1KC4A 2K3GA 2MFAA 1TFSA 2H8UA 1VB0A 1TXBA 1BTEA 1B41B 3FEVA 1NTXA 4HQPF 1ERGA 1JBDA 1XT3A 1IQ9A 4OM5A 1MAHF 2J8BA 2MJ4A 1G6MA 1ES7B 4LFTA 3NEQA 1HAJA 2H7ZB 3KFDI 1KBAA 1COEA 1FASA 1CTXA 1KXIA 3NH7A 5EBXA 1YWHA 1S4YA 2CRTA 1LXHA 4RUDA 4IYEA 1M9ZA 2PJYB 1FSSB 2QJBC 2GOOB 1UG4A 3U73U 1CREA 1JE9A 4BDTB 1IDHA 2H7ZA 2HLQA 1LX5B 1NTNA 1W6BA 1IKCA 1CCQA 1KBTA 1KBSA 1TGXA 1CDRA 1CXNA 4AEAA 1NXBA 2H62D 3EVSC 1LJZA 2VLWA 1IK8A 2CTXA 4BIKB 5DZ5A 4P7UA 2JVEA 2L5SA 1CXOA 1IDGA 1BXPA 1CDTA 1FSCA 1CDSA 1CVOA 1ZADA 1L4WA 2I9BE 2ERAA 1CB9A 1HC9B 4KSNA 2LA1A 2UX2A 2CCXA 3QB4B 1IDLA 1NYUA 2H64C 2HLRA 3HH7A 4EY8B 1CDQA 3LAQU 2LCRA 1V6PA 1ONJA 1NYSA 2X8BB 1KTZB 1JGKA 1MR6A 1ERAA 4FAOC 2BHIA 3BT1U 3VTSA 1ABTA 1NEAA 5IMTD 1HC9A 1HAAA 3U74U 4OM4A 3PLCA 1H0JA 1CHVS 2MUPA 1QKEA 2MJ0A 4UY2C 3ERAA 2MJYA 1FF4A 2NBTA 2PJYC 1QKDA 3EBXA 5DU1A 2ABXA 2OFSA 1IDIA 2UWRA 2H64B 1FRAA 1F94A 1FFJA 1F8UB 4FAOE 1HOYA 1DRSA 1CRFA 1KU6B 1RGJA 2BTXA 3NDSA 2H62C 2QC1A 2QJ9C 1QM7A 4ZQYA 1KS6A 1LXGA 2FD6U 2MHYA 1CODA 2H5FA 1NORA 2MUOA 4DO8A 2CDXA 2L03A 5DO6A 2CRSA 1RL5A 2N99A 6EBXA 4XJJA 1I02A 1KFHA 1LSIA 2QJAC
chains in the Genus database with same CATH topology
1REWC 1TXAA 3BT2U 1PLOA 1IJCA 1KL8A 2GOOC 4QTIU 2JQPA 5IMYC 3KFDE 1KC4A 2K3GA 2MFAA 1TFSA 2H8UA 1VB0A 1TXBA 1BTEA 1B41B 3FEVA 1NTXA 4HQPF 1ERGA 1JBDA 1XT3A 1IQ9A 4OM5A 1MAHF 2J8BA 2MJ4A 1G6MA 1ES7B 4LFTA 3NEQA 1HAJA 2H7ZB 3KFDI 1KBAA 1COEA 1FASA 1CTXA 1KXIA 3NH7A 5EBXA 1YWHA 1S4YA 2CRTA 1LXHA 4RUDA 4IYEA 1M9ZA 2PJYB 1FSSB 2QJBC 2GOOB 1UG4A 3U73U 1CREA 1JE9A 4BDTB 1IDHA 2H7ZA 2HLQA 1LX5B 1NTNA 1W6BA 1IKCA 1CCQA 1KBTA 1KBSA 1TGXA 1CDRA 1CXNA 4AEAA 1NXBA 2H62D 3EVSC 1LJZA 2VLWA 1IK8A 2CTXA 4BIKB 5DZ5A 4P7UA 2JVEA 2L5SA 1CXOA 1IDGA 1BXPA 1CDTA 1FSCA 1CDSA 1CVOA 1ZADA 1L4WA 2I9BE 2ERAA 1CB9A 1HC9B 4KSNA 2LA1A 2UX2A 2CCXA 3QB4B 1IDLA 1NYUA 2H64C 2HLRA 3HH7A 4EY8B 1CDQA 3LAQU 2LCRA 1V6PA 1ONJA 1NYSA 2X8BB 1KTZB 1JGKA 1MR6A 1ERAA 4FAOC 2BHIA 3BT1U 3VTSA 1ABTA 1NEAA 5IMTD 1HC9A 1HAAA 3U74U 4OM4A 3PLCA 1H0JA 1CHVS 2MUPA 1QKEA 2MJ0A 4UY2C 3ERAA 2MJYA 1FF4A 2NBTA 2PJYC 1QKDA 3EBXA 5DU1A 2ABXA 2OFSA 1IDIA 2UWRA 2H64B 1FRAA 1F94A 1FFJA 1F8UB 4FAOE 1HOYA 1DRSA 1CRFA 1KU6B 1RGJA 2BTXA 3NDSA 2H62C 2QC1A 2QJ9C 1QM7A 4ZQYA 1KS6A 1LXGA 2FD6U 2MHYA 1CODA 2H5FA 1NORA 2MUOA 4DO8A 2CDXA 2L03A 5DO6A 2CRSA 1RL5A 2N99A 6EBXA 4XJJA 1I02A 1KFHA 1LSIA 2QJAC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1REW C;  1TXA A;  3BT2 U;  1PLO A;  1IJC A;  1KL8 A;  2GOO C;  4QTI U;  2JQP A;  5IMY C;  3KFD E;  1KC4 A;  2K3G A;  2MFA A;  1TFS A;  2H8U A;  1VB0 A;  1TXB A;  1BTE A;  1B41 B;  3FEV A;  1NTX A;  4HQP F;  1ERG A;  1JBD A;  1XT3 A;  1IQ9 A;  4OM5 A;  1MAH F;  2J8B A;  2MJ4 A;  1G6M A;  1ES7 B;  4LFT A;  3NEQ A;  1HAJ A;  2H7Z B;  3KFD I;  1KBA A;  1COE A;  1FAS A;  1CTX A;  1KXI A;  3NH7 A;  5EBX A;  1YWH A;  1S4Y A;  2CRT A;  1LXH A;  4RUD A;  4IYE A;  1M9Z A;  2PJY B;  1FSS B;  2QJB C;  2GOO B;  1UG4 A;  3U73 U;  1CRE A;  1JE9 A;  4BDT B;  1IDH A;  2H7Z A;  2HLQ A;  1LX5 B;  1NTN A;  1W6B A;  1IKC A;  1CCQ A;  1KBT A;  1KBS A;  1TGX A;  1CDR A;  1CXN A;  4AEA A;  1NXB A;  2H62 D;  3EVS C;  1LJZ A;  2VLW A;  1IK8 A;  2CTX A;  4BIK B;  5DZ5 A;  4P7U A;  2JVE A;  2L5S A;  1CXO A;  1IDG A;  1BXP A;  1CDT A;  1FSC A;  1CDS A;  1CVO A;  1ZAD A;  1L4W A;  2I9B E;  2ERA A;  1CB9 A;  1HC9 B;  2LA1 A;  2UX2 A;  2CCX A;  3QB4 B;  1IDL A;  1NYU A;  2H64 C;  2HLR A;  3HH7 A;  4EY8 B;  1CDQ A;  3LAQ U;  2LCR A;  1V6P A;  1ONJ A;  1NYS A;  2X8B B;  1KTZ B;  1JGK A;  1MR6 A;  1ERA A;  4FAO C;  2BHI A;  3BT1 U;  3VTS A;  1ABT A;  1NEA A;  5IMT D;  1HC9 A;  1HAA A;  3U74 U;  4OM4 A;  3PLC A;  1H0J A;  1CHV S;  2MUP A;  1QKE A;  2MJ0 A;  4UY2 C;  3ERA A;  2MJY A;  1FF4 A;  2NBT A;  2PJY C;  1QKD A;  3EBX A;  5DU1 A;  2ABX A;  2OFS A;  1IDI A;  2UWR A;  2H64 B;  1FRA A;  1F94 A;  1FFJ A;  1F8U B;  4FAO E;  1HOY A;  1DRS A;  1CRF A;  1KU6 B;  1RGJ A;  2BTX A;  3NDS A;  2H62 C;  2QC1 A;  2QJ9 C;  1QM7 A;  4ZQY A;  1KS6 A;  1LXG A;  2FD6 U;  2MHY A;  1COD A;  2H5F A;  1NOR A;  2MUO A;  4DO8 A;  2CDX A;  2L03 A;  5DO6 A;  2CRS A;  1RL5 A;  2N99 A;  6EBX A;  4XJJ A;  1I02 A;  1KFH A;  1LSI A;  2QJA C; 
#chains in the Genus database with same CATH topology
 1REW C;  1TXA A;  3BT2 U;  1PLO A;  1IJC A;  1KL8 A;  2GOO C;  4QTI U;  2JQP A;  5IMY C;  3KFD E;  1KC4 A;  2K3G A;  2MFA A;  1TFS A;  2H8U A;  1VB0 A;  1TXB A;  1BTE A;  1B41 B;  3FEV A;  1NTX A;  4HQP F;  1ERG A;  1JBD A;  1XT3 A;  1IQ9 A;  4OM5 A;  1MAH F;  2J8B A;  2MJ4 A;  1G6M A;  1ES7 B;  4LFT A;  3NEQ A;  1HAJ A;  2H7Z B;  3KFD I;  1KBA A;  1COE A;  1FAS A;  1CTX A;  1KXI A;  3NH7 A;  5EBX A;  1YWH A;  1S4Y A;  2CRT A;  1LXH A;  4RUD A;  4IYE A;  1M9Z A;  2PJY B;  1FSS B;  2QJB C;  2GOO B;  1UG4 A;  3U73 U;  1CRE A;  1JE9 A;  4BDT B;  1IDH A;  2H7Z A;  2HLQ A;  1LX5 B;  1NTN A;  1W6B A;  1IKC A;  1CCQ A;  1KBT A;  1KBS A;  1TGX A;  1CDR A;  1CXN A;  4AEA A;  1NXB A;  2H62 D;  3EVS C;  1LJZ A;  2VLW A;  1IK8 A;  2CTX A;  4BIK B;  5DZ5 A;  4P7U A;  2JVE A;  2L5S A;  1CXO A;  1IDG A;  1BXP A;  1CDT A;  1FSC A;  1CDS A;  1CVO A;  1ZAD A;  1L4W A;  2I9B E;  2ERA A;  1CB9 A;  1HC9 B;  4KSN A;  2LA1 A;  2UX2 A;  2CCX A;  3QB4 B;  1IDL A;  1NYU A;  2H64 C;  2HLR A;  3HH7 A;  4EY8 B;  1CDQ A;  3LAQ U;  2LCR A;  1V6P A;  1ONJ A;  1NYS A;  2X8B B;  1KTZ B;  1JGK A;  1MR6 A;  1ERA A;  4FAO C;  2BHI A;  3BT1 U;  3VTS A;  1ABT A;  1NEA A;  5IMT D;  1HC9 A;  1HAA A;  3U74 U;  4OM4 A;  3PLC A;  1H0J A;  1CHV S;  2MUP A;  1QKE A;  2MJ0 A;  4UY2 C;  3ERA A;  2MJY A;  1FF4 A;  2NBT A;  2PJY C;  1QKD A;  3EBX A;  5DU1 A;  2ABX A;  2OFS A;  1IDI A;  2UWR A;  2H64 B;  1FRA A;  1F94 A;  1FFJ A;  1F8U B;  4FAO E;  1HOY A;  1DRS A;  1CRF A;  1KU6 B;  1RGJ A;  2BTX A;  3NDS A;  2H62 C;  2QC1 A;  2QJ9 C;  1QM7 A;  4ZQY A;  1KS6 A;  1LXG A;  2FD6 U;  2MHY A;  1COD A;  2H5F A;  1NOR A;  2MUO A;  4DO8 A;  2CDX A;  2L03 A;  5DO6 A;  2CRS A;  1RL5 A;  2N99 A;  6EBX A;  4XJJ A;  1I02 A;  1KFH A;  1LSI A;  2QJA C; 
#chains in the Genus database with same CATH homology
 1REW C;  1TXA A;  3BT2 U;  1PLO A;  1IJC A;  1KL8 A;  2GOO C;  4QTI U;  2JQP A;  5IMY C;  3KFD E;  1KC4 A;  2K3G A;  2MFA A;  1TFS A;  2H8U A;  1VB0 A;  1TXB A;  1BTE A;  1B41 B;  3FEV A;  1NTX A;  4HQP F;  1ERG A;  1JBD A;  1XT3 A;  1IQ9 A;  4OM5 A;  1MAH F;  2J8B A;  2MJ4 A;  1G6M A;  1ES7 B;  4LFT A;  3NEQ A;  1HAJ A;  2H7Z B;  3KFD I;  1KBA A;  1COE A;  1FAS A;  1CTX A;  1KXI A;  3NH7 A;  5EBX A;  1YWH A;  1S4Y A;  2CRT A;  1LXH A;  4RUD A;  4IYE A;  1M9Z A;  2PJY B;  1FSS B;  2QJB C;  2GOO B;  1UG4 A;  3U73 U;  1CRE A;  1JE9 A;  4BDT B;  1IDH A;  2H7Z A;  2HLQ A;  1LX5 B;  1NTN A;  1W6B A;  1IKC A;  1CCQ A;  1KBT A;  1KBS A;  1TGX A;  1CDR A;  1CXN A;  4AEA A;  1NXB A;  2H62 D;  3EVS C;  1LJZ A;  2VLW A;  1IK8 A;  2CTX A;  4BIK B;  5DZ5 A;  4P7U A;  2JVE A;  2L5S A;  1CXO A;  1IDG A;  1BXP A;  1CDT A;  1FSC A;  1CDS A;  1CVO A;  1ZAD A;  1L4W A;  2I9B E;  2ERA A;  1CB9 A;  1HC9 B;  4KSN A;  2LA1 A;  2UX2 A;  2CCX A;  3QB4 B;  1IDL A;  1NYU A;  2H64 C;  2HLR A;  3HH7 A;  4EY8 B;  1CDQ A;  3LAQ U;  2LCR A;  1V6P A;  1ONJ A;  1NYS A;  2X8B B;  1KTZ B;  1JGK A;  1MR6 A;  1ERA A;  4FAO C;  2BHI A;  3BT1 U;  3VTS A;  1ABT A;  1NEA A;  5IMT D;  1HC9 A;  1HAA A;  3U74 U;  4OM4 A;  3PLC A;  1H0J A;  1CHV S;  2MUP A;  1QKE A;  2MJ0 A;  4UY2 C;  3ERA A;  2MJY A;  1FF4 A;  2NBT A;  2PJY C;  1QKD A;  3EBX A;  5DU1 A;  2ABX A;  2OFS A;  1IDI A;  2UWR A;  2H64 B;  1FRA A;  1F94 A;  1FFJ A;  1F8U B;  4FAO E;  1HOY A;  1DRS A;  1CRF A;  1KU6 B;  1RGJ A;  2BTX A;  3NDS A;  2H62 C;  2QC1 A;  2QJ9 C;  1QM7 A;  4ZQY A;  1KS6 A;  1LXG A;  2FD6 U;  2MHY A;  1COD A;  2H5F A;  1NOR A;  2MUO A;  4DO8 A;  2CDX A;  2L03 A;  5DO6 A;  2CRS A;  1RL5 A;  2N99 A;  6EBX A;  4XJJ A;  1I02 A;  1KFH A;  1LSI A;  2QJA C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...