3NH7A

Crystal structure of the neutralizing fab fragment abd1556 bound to the bmp type i receptor ia
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
85
structure length
85
Chain Sequence
PFLKCYCSGHCPDDAINNTCITNGHCFAIIEEDDQGETTLASGCMKYEGSDFQCKDSPKAQLRRTIECCRTNLCNQYLQPTLPPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody fragment Fab AbD1556, heavy chain
publication title A selection fit mechanism in BMP receptor IA as a possible source for BMP ligand-receptor promiscuity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 11
structure length 85
sequence length 85
chains with identical sequence B, C, D
ec nomenclature ec 2.7.11.30: Receptor protein serine/threonine kinase.
pdb deposition date 2010-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01064 Activin_recp Activin types I and II receptor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 3nh7A00
2L5SA 4XJJA 5IMYC 1MAHF 1COEA 1UG4A 2J8BA 2H7ZA 1ES7B 1IKCA 1KL8A 4HQPF 2PJYC 2MFAA 4OM4A 1IK8A 1MR6A 4QTIU 1CTXA 1W6BA 2ABXA 1YWHA 2H5FA 1KFHA 1BXPA 1TGXA 3NEQA 1NTNA 3PLCA 4LFTA 1G6MA 1I02A 4FAOE 1CCQA 5DZ5A 6EBXA 4FAOC 4BIKB 1TFSA 1DRSA 2NBTA 2JVEA 2OFSA 2L03A 3U74U 2QJ9C 3BT1U 1IQ9A 3BT2U 1NXBA 2MJYA 1LJZA 2GOOB 2I9BE 1HC9A 1QKDA 3NH7A 2QJAC 3KFDI 2MJ4A 1FRAA 4RUDA 4AEAA 1FFJA 1CXNA 1KS6A 2CDXA 3LAQU 1PLOA 2FD6U 2K3GA 2GOOC 1CHVS 1KXIA 1LX5B 2H7ZB 1CB9A 2CRTA 4DO8A 4IYEA 2LA1A 1TXBA 3FEVA 1CDRA 1V6PA 2CRSA 4BDTB 3NDSA 2H62C 2HLRA 1JBDA 2MUPA 1RGJA 1JGKA 1FASA 2UWRA 1NYUA 1QM7A 1FF4A 1KU6B 1NORA 1HAAA 1ERAA 4UY2C 3EBXA 1TXAA 1KBTA 3U73U 3ERAA 2QC1A 2UX2A 1FSSB 3HH7A 1KBAA 2H8UA 2MHYA 1FSCA 1HC9B 1LSIA 3VTSA 2MJ0A 1KTZB 1RL5A 1HOYA 2BHIA 5DU1A 1CDQA 5IMTD 1VB0A 1CXOA 1CDSA 1CRFA 1F94A 5DO6A 3QB4B 1BTEA 1CODA 1IDIA 1F8UB 2HLQA 1L4WA 1ABTA 1IDHA 1M9ZA 1KBSA 3KFDE 1QKEA 1LXGA 4OM5A 4EY8B 4ZQYA 1CREA 5EBXA 1IDLA 2X8BB 1KC4A 1IDGA 1S4YA 1ONJA 1NEAA 3EVSC 2BTXA 1JE9A 2H64B 2H64C 2CCXA 2QJBC 2ERAA 1IJCA 2LCRA 1CDTA 2PJYB 4P7UA 1REWC 2JQPA 1XT3A 2N99A 1CVOA 1H0JA 1HAJA 2H62D 1NTXA 1NYSA 2CTXA 1ZADA 2VLWA 1ERGA 2MUOA 1LXHA 1B41B
chains in the Genus database with same CATH superfamily
2L5SA 4XJJA 5IMYC 1MAHF 1COEA 1UG4A 2J8BA 2H7ZA 1ES7B 1IKCA 1KL8A 4HQPF 2PJYC 2MFAA 4OM4A 1IK8A 1MR6A 4QTIU 1CTXA 1W6BA 2ABXA 1YWHA 2H5FA 1KFHA 1BXPA 1TGXA 3NEQA 1NTNA 3PLCA 4LFTA 1G6MA 1I02A 4FAOE 1CCQA 5DZ5A 6EBXA 4FAOC 4BIKB 1TFSA 1DRSA 2NBTA 2JVEA 2OFSA 2L03A 3U74U 2QJ9C 3BT1U 1IQ9A 3BT2U 1NXBA 2MJYA 1LJZA 2GOOB 2I9BE 1HC9A 4KSNA 1QKDA 3NH7A 2QJAC 3KFDI 2MJ4A 1FRAA 4RUDA 4AEAA 1FFJA 1CXNA 1KS6A 2CDXA 3LAQU 1PLOA 2FD6U 2K3GA 2GOOC 1CHVS 1KXIA 1LX5B 2H7ZB 1CB9A 2CRTA 4DO8A 4IYEA 2LA1A 1TXBA 3FEVA 1CDRA 1V6PA 2CRSA 4BDTB 3NDSA 2H62C 2HLRA 1JBDA 2MUPA 1RGJA 1JGKA 1FASA 2UWRA 1NYUA 1QM7A 1FF4A 1KU6B 1NORA 1HAAA 1ERAA 4UY2C 3EBXA 1TXAA 1KBTA 3U73U 3ERAA 2QC1A 2UX2A 1FSSB 3HH7A 1KBAA 2H8UA 2MHYA 1FSCA 1HC9B 1LSIA 3VTSA 2MJ0A 1KTZB 1RL5A 1HOYA 2BHIA 5DU1A 1CDQA 5IMTD 1VB0A 1CXOA 1CDSA 1CRFA 1F94A 5DO6A 3QB4B 1BTEA 1CODA 1IDIA 1F8UB 2HLQA 1L4WA 1ABTA 1IDHA 1M9ZA 1KBSA 3KFDE 1QKEA 1LXGA 4OM5A 4EY8B 4ZQYA 1CREA 5EBXA 1IDLA 2X8BB 1KC4A 1IDGA 1S4YA 1ONJA 1NEAA 3EVSC 2BTXA 1JE9A 2H64B 2H64C 2CCXA 2QJBC 2ERAA 1IJCA 2LCRA 1CDTA 2PJYB 4P7UA 1REWC 2JQPA 1XT3A 2N99A 1CVOA 1H0JA 1HAJA 2H62D 1NTXA 1NYSA 2CTXA 1ZADA 2VLWA 1ERGA 2MUOA 1LXHA 1B41B
chains in the Genus database with same CATH topology
2L5SA 4XJJA 5IMYC 1MAHF 1COEA 1UG4A 2J8BA 2H7ZA 1ES7B 1IKCA 1KL8A 4HQPF 2PJYC 2MFAA 4OM4A 1IK8A 1MR6A 4QTIU 1CTXA 1W6BA 2ABXA 1YWHA 2H5FA 1KFHA 1BXPA 1TGXA 3NEQA 1NTNA 3PLCA 4LFTA 1G6MA 1I02A 4FAOE 1CCQA 5DZ5A 6EBXA 4FAOC 4BIKB 1TFSA 1DRSA 2NBTA 2JVEA 2OFSA 2L03A 3U74U 2QJ9C 3BT1U 1IQ9A 3BT2U 1NXBA 2MJYA 1LJZA 2GOOB 2I9BE 1HC9A 4KSNA 1QKDA 3NH7A 2QJAC 3KFDI 2MJ4A 1FRAA 4RUDA 4AEAA 1FFJA 1CXNA 1KS6A 2CDXA 3LAQU 1PLOA 2FD6U 2K3GA 2GOOC 1CHVS 1KXIA 1LX5B 2H7ZB 1CB9A 2CRTA 4DO8A 4IYEA 2LA1A 1TXBA 3FEVA 1CDRA 1V6PA 2CRSA 4BDTB 3NDSA 2H62C 2HLRA 1JBDA 2MUPA 1RGJA 1JGKA 1FASA 2UWRA 1NYUA 1QM7A 1FF4A 1KU6B 1NORA 1HAAA 1ERAA 4UY2C 3EBXA 1TXAA 1KBTA 3U73U 3ERAA 2QC1A 2UX2A 1FSSB 3HH7A 1KBAA 2H8UA 2MHYA 1FSCA 1HC9B 1LSIA 3VTSA 2MJ0A 1KTZB 1RL5A 1HOYA 2BHIA 5DU1A 1CDQA 5IMTD 1VB0A 1CXOA 1CDSA 1CRFA 1F94A 5DO6A 3QB4B 1BTEA 1CODA 1IDIA 1F8UB 2HLQA 1L4WA 1ABTA 1IDHA 1M9ZA 1KBSA 3KFDE 1QKEA 1LXGA 4OM5A 4EY8B 4ZQYA 1CREA 5EBXA 1IDLA 2X8BB 1KC4A 1IDGA 1S4YA 1ONJA 1NEAA 3EVSC 2BTXA 1JE9A 2H64B 2H64C 2CCXA 2QJBC 2ERAA 1IJCA 2LCRA 1CDTA 2PJYB 4P7UA 1REWC 2JQPA 1XT3A 2N99A 1CVOA 1H0JA 1HAJA 2H62D 1NTXA 1NYSA 2CTXA 1ZADA 2VLWA 1ERGA 2MUOA 1LXHA 1B41B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L5S A;  4XJJ A;  5IMY C;  1MAH F;  1COE A;  1UG4 A;  2J8B A;  2H7Z A;  1ES7 B;  1IKC A;  1KL8 A;  4HQP F;  2PJY C;  2MFA A;  4OM4 A;  1IK8 A;  1MR6 A;  4QTI U;  1CTX A;  1W6B A;  2ABX A;  1YWH A;  2H5F A;  1KFH A;  1BXP A;  1TGX A;  3NEQ A;  1NTN A;  3PLC A;  4LFT A;  1G6M A;  1I02 A;  4FAO E;  1CCQ A;  5DZ5 A;  6EBX A;  4FAO C;  4BIK B;  1TFS A;  1DRS A;  2NBT A;  2JVE A;  2OFS A;  2L03 A;  3U74 U;  2QJ9 C;  3BT1 U;  1IQ9 A;  3BT2 U;  1NXB A;  2MJY A;  1LJZ A;  2GOO B;  2I9B E;  1HC9 A;  1QKD A;  3NH7 A;  2QJA C;  3KFD I;  2MJ4 A;  1FRA A;  4RUD A;  4AEA A;  1FFJ A;  1CXN A;  1KS6 A;  2CDX A;  3LAQ U;  1PLO A;  2FD6 U;  2K3G A;  2GOO C;  1CHV S;  1KXI A;  1LX5 B;  2H7Z B;  1CB9 A;  2CRT A;  4DO8 A;  4IYE A;  2LA1 A;  1TXB A;  3FEV A;  1CDR A;  1V6P A;  2CRS A;  4BDT B;  3NDS A;  2H62 C;  2HLR A;  1JBD A;  2MUP A;  1RGJ A;  1JGK A;  1FAS A;  2UWR A;  1NYU A;  1QM7 A;  1FF4 A;  1KU6 B;  1NOR A;  1HAA A;  1ERA A;  4UY2 C;  3EBX A;  1TXA A;  1KBT A;  3U73 U;  3ERA A;  2QC1 A;  2UX2 A;  1FSS B;  3HH7 A;  1KBA A;  2H8U A;  2MHY A;  1FSC A;  1HC9 B;  1LSI A;  3VTS A;  2MJ0 A;  1KTZ B;  1RL5 A;  1HOY A;  2BHI A;  5DU1 A;  1CDQ A;  5IMT D;  1VB0 A;  1CXO A;  1CDS A;  1CRF A;  1F94 A;  5DO6 A;  3QB4 B;  1BTE A;  1COD A;  1IDI A;  1F8U B;  2HLQ A;  1L4W A;  1ABT A;  1IDH A;  1M9Z A;  1KBS A;  3KFD E;  1QKE A;  1LXG A;  4OM5 A;  4EY8 B;  4ZQY A;  1CRE A;  5EBX A;  1IDL A;  2X8B B;  1KC4 A;  1IDG A;  1S4Y A;  1ONJ A;  1NEA A;  3EVS C;  2BTX A;  1JE9 A;  2H64 B;  2H64 C;  2CCX A;  2QJB C;  2ERA A;  1IJC A;  2LCR A;  1CDT A;  2PJY B;  4P7U A;  1REW C;  2JQP A;  1XT3 A;  2N99 A;  1CVO A;  1H0J A;  1HAJ A;  2H62 D;  1NTX A;  1NYS A;  2CTX A;  1ZAD A;  2VLW A;  1ERG A;  2MUO A;  1LXH A;  1B41 B; 
#chains in the Genus database with same CATH topology
 2L5S A;  4XJJ A;  5IMY C;  1MAH F;  1COE A;  1UG4 A;  2J8B A;  2H7Z A;  1ES7 B;  1IKC A;  1KL8 A;  4HQP F;  2PJY C;  2MFA A;  4OM4 A;  1IK8 A;  1MR6 A;  4QTI U;  1CTX A;  1W6B A;  2ABX A;  1YWH A;  2H5F A;  1KFH A;  1BXP A;  1TGX A;  3NEQ A;  1NTN A;  3PLC A;  4LFT A;  1G6M A;  1I02 A;  4FAO E;  1CCQ A;  5DZ5 A;  6EBX A;  4FAO C;  4BIK B;  1TFS A;  1DRS A;  2NBT A;  2JVE A;  2OFS A;  2L03 A;  3U74 U;  2QJ9 C;  3BT1 U;  1IQ9 A;  3BT2 U;  1NXB A;  2MJY A;  1LJZ A;  2GOO B;  2I9B E;  1HC9 A;  4KSN A;  1QKD A;  3NH7 A;  2QJA C;  3KFD I;  2MJ4 A;  1FRA A;  4RUD A;  4AEA A;  1FFJ A;  1CXN A;  1KS6 A;  2CDX A;  3LAQ U;  1PLO A;  2FD6 U;  2K3G A;  2GOO C;  1CHV S;  1KXI A;  1LX5 B;  2H7Z B;  1CB9 A;  2CRT A;  4DO8 A;  4IYE A;  2LA1 A;  1TXB A;  3FEV A;  1CDR A;  1V6P A;  2CRS A;  4BDT B;  3NDS A;  2H62 C;  2HLR A;  1JBD A;  2MUP A;  1RGJ A;  1JGK A;  1FAS A;  2UWR A;  1NYU A;  1QM7 A;  1FF4 A;  1KU6 B;  1NOR A;  1HAA A;  1ERA A;  4UY2 C;  3EBX A;  1TXA A;  1KBT A;  3U73 U;  3ERA A;  2QC1 A;  2UX2 A;  1FSS B;  3HH7 A;  1KBA A;  2H8U A;  2MHY A;  1FSC A;  1HC9 B;  1LSI A;  3VTS A;  2MJ0 A;  1KTZ B;  1RL5 A;  1HOY A;  2BHI A;  5DU1 A;  1CDQ A;  5IMT D;  1VB0 A;  1CXO A;  1CDS A;  1CRF A;  1F94 A;  5DO6 A;  3QB4 B;  1BTE A;  1COD A;  1IDI A;  1F8U B;  2HLQ A;  1L4W A;  1ABT A;  1IDH A;  1M9Z A;  1KBS A;  3KFD E;  1QKE A;  1LXG A;  4OM5 A;  4EY8 B;  4ZQY A;  1CRE A;  5EBX A;  1IDL A;  2X8B B;  1KC4 A;  1IDG A;  1S4Y A;  1ONJ A;  1NEA A;  3EVS C;  2BTX A;  1JE9 A;  2H64 B;  2H64 C;  2CCX A;  2QJB C;  2ERA A;  1IJC A;  2LCR A;  1CDT A;  2PJY B;  4P7U A;  1REW C;  2JQP A;  1XT3 A;  2N99 A;  1CVO A;  1H0J A;  1HAJ A;  2H62 D;  1NTX A;  1NYS A;  2CTX A;  1ZAD A;  2VLW A;  1ERG A;  2MUO A;  1LXH A;  1B41 B; 
#chains in the Genus database with same CATH homology
 2L5S A;  4XJJ A;  5IMY C;  1MAH F;  1COE A;  1UG4 A;  2J8B A;  2H7Z A;  1ES7 B;  1IKC A;  1KL8 A;  4HQP F;  2PJY C;  2MFA A;  4OM4 A;  1IK8 A;  1MR6 A;  4QTI U;  1CTX A;  1W6B A;  2ABX A;  1YWH A;  2H5F A;  1KFH A;  1BXP A;  1TGX A;  3NEQ A;  1NTN A;  3PLC A;  4LFT A;  1G6M A;  1I02 A;  4FAO E;  1CCQ A;  5DZ5 A;  6EBX A;  4FAO C;  4BIK B;  1TFS A;  1DRS A;  2NBT A;  2JVE A;  2OFS A;  2L03 A;  3U74 U;  2QJ9 C;  3BT1 U;  1IQ9 A;  3BT2 U;  1NXB A;  2MJY A;  1LJZ A;  2GOO B;  2I9B E;  1HC9 A;  4KSN A;  1QKD A;  3NH7 A;  2QJA C;  3KFD I;  2MJ4 A;  1FRA A;  4RUD A;  4AEA A;  1FFJ A;  1CXN A;  1KS6 A;  2CDX A;  3LAQ U;  1PLO A;  2FD6 U;  2K3G A;  2GOO C;  1CHV S;  1KXI A;  1LX5 B;  2H7Z B;  1CB9 A;  2CRT A;  4DO8 A;  4IYE A;  2LA1 A;  1TXB A;  3FEV A;  1CDR A;  1V6P A;  2CRS A;  4BDT B;  3NDS A;  2H62 C;  2HLR A;  1JBD A;  2MUP A;  1RGJ A;  1JGK A;  1FAS A;  2UWR A;  1NYU A;  1QM7 A;  1FF4 A;  1KU6 B;  1NOR A;  1HAA A;  1ERA A;  4UY2 C;  3EBX A;  1TXA A;  1KBT A;  3U73 U;  3ERA A;  2QC1 A;  2UX2 A;  1FSS B;  3HH7 A;  1KBA A;  2H8U A;  2MHY A;  1FSC A;  1HC9 B;  1LSI A;  3VTS A;  2MJ0 A;  1KTZ B;  1RL5 A;  1HOY A;  2BHI A;  5DU1 A;  1CDQ A;  5IMT D;  1VB0 A;  1CXO A;  1CDS A;  1CRF A;  1F94 A;  5DO6 A;  3QB4 B;  1BTE A;  1COD A;  1IDI A;  1F8U B;  2HLQ A;  1L4W A;  1ABT A;  1IDH A;  1M9Z A;  1KBS A;  3KFD E;  1QKE A;  1LXG A;  4OM5 A;  4EY8 B;  4ZQY A;  1CRE A;  5EBX A;  1IDL A;  2X8B B;  1KC4 A;  1IDG A;  1S4Y A;  1ONJ A;  1NEA A;  3EVS C;  2BTX A;  1JE9 A;  2H64 B;  2H64 C;  2CCX A;  2QJB C;  2ERA A;  1IJC A;  2LCR A;  1CDT A;  2PJY B;  4P7U A;  1REW C;  2JQP A;  1XT3 A;  2N99 A;  1CVO A;  1H0J A;  1HAJ A;  2H62 D;  1NTX A;  1NYS A;  2CTX A;  1ZAD A;  2VLW A;  1ERG A;  2MUO A;  1LXH A;  1B41 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...