1IDHA

The nmr solution structure of the complex formed between alpha-bungarotoxin and an 18mer cognate peptide
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
74
structure length
74
Chain Sequence
IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-BUNGAROTOXIN
publication title The solution structure of the complex formed between alpha-bungarotoxin and an 18-mer cognate peptide derived from the alpha 1 subunit of the nicotinic acetylcholine receptor from Torpedo californica.
pubmed doi rcsb
source organism Torpedo californica
molecule tags Toxin
total genus 5
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2001-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1idhA00
1KBTA 1CXOA 1CHVS 2QJ9C 1M9ZA 2MUOA 2LA1A 3LAQU 2X8BB 1CRFA 4HQPF 1CDTA 1JE9A 3ERAA 5IMYC 2H62C 1FFJA 1IDLA 4BDTB 1NTNA 2CCXA 2ABXA 1FSCA 1KS6A 1HC9A 1ES7B 1NTXA 4IYEA 4BIKB 1IKCA 1NXBA 2L5SA 2MJ0A 1G6MA 3QB4B 3KFDE 2MJYA 1CTXA 2FD6U 2J8BA 1REWC 3VTSA 4AEAA 2QJAC 4P7UA 1KXIA 1IDHA 2MHYA 1DRSA 4UY2C 3HH7A 1JGKA 1V6PA 1QM7A 1JBDA 1HAAA 2H7ZA 2H62D 1ERAA 4QTIU 5DU1A 1ABTA 1HAJA 1KFHA 1PLOA 1UG4A 1IQ9A 2GOOC 2HLQA 1VB0A 2H64B 2CDXA 5IMTD 4FAOE 1TXBA 1QKEA 3KFDI 2K3GA 1FRAA 3U74U 1CB9A 2MJ4A 1KBAA 1TFSA 2LCRA 1QKDA 2H64C 3EBXA 2QC1A 1NEAA 2OFSA 2H5FA 1F8UB 1MAHF 5DZ5A 1KBSA 2VLWA 2JQPA 2L03A 4RUDA 3FEVA 1NYSA 2PJYB 3EVSC 1IJCA 1ZADA 2BHIA 1H0JA 1NORA 2N99A 4ZQYA 1ONJA 3U73U 4XJJA 1IK8A 1YWHA 1COEA 1ERGA 2UX2A 2JVEA 1FF4A 4LFTA 5EBXA 2CRSA 1CDSA 1NYUA 1CDQA 1XT3A 1HOYA 3PLCA 1FSSB 2QJBC 3NEQA 1KL8A 1S4YA 3NDSA 2UWRA 2HLRA 1RL5A 2H8UA 2MUPA 1RGJA 1TGXA 3NH7A 4DO8A 6EBXA 1IDGA 1IDIA 2MFAA 1BXPA 2CTXA 1I02A 2PJYC 1LX5B 1FASA 5DO6A 1F94A 1MR6A 1BTEA 2I9BE 4FAOC 1HC9B 1CDRA 1CREA 1B41B 1LJZA 1CCQA 4EY8B 1LXHA 1KU6B 2CRTA 1LXGA 1LSIA 3BT1U 4OM4A 1W6BA 2ERAA 1CXNA 2BTXA 1TXAA 1KC4A 1L4WA 1KTZB 1CVOA 2GOOB 4OM5A 2NBTA 1CODA 2H7ZB 3BT2U
chains in the Genus database with same CATH superfamily
1KBTA 1CXOA 1CHVS 2QJ9C 1M9ZA 2MUOA 2LA1A 3LAQU 2X8BB 1CRFA 4HQPF 1CDTA 1JE9A 3ERAA 5IMYC 2H62C 1FFJA 1IDLA 4BDTB 1NTNA 2CCXA 2ABXA 1FSCA 1KS6A 1HC9A 1ES7B 1NTXA 4IYEA 4BIKB 1IKCA 1NXBA 2L5SA 2MJ0A 1G6MA 3QB4B 3KFDE 2MJYA 1CTXA 2FD6U 2J8BA 1REWC 3VTSA 4AEAA 2QJAC 4P7UA 1KXIA 1IDHA 2MHYA 1DRSA 4UY2C 3HH7A 1JGKA 1V6PA 1QM7A 1JBDA 1HAAA 2H7ZA 2H62D 1ERAA 4QTIU 5DU1A 1ABTA 1HAJA 1KFHA 1PLOA 1UG4A 1IQ9A 2GOOC 2HLQA 1VB0A 2H64B 2CDXA 5IMTD 4FAOE 1TXBA 1QKEA 3KFDI 2K3GA 1FRAA 3U74U 1CB9A 2MJ4A 1KBAA 1TFSA 2LCRA 1QKDA 2H64C 3EBXA 2QC1A 1NEAA 2OFSA 2H5FA 1F8UB 1MAHF 5DZ5A 1KBSA 2VLWA 4KSNA 2JQPA 2L03A 4RUDA 3FEVA 1NYSA 2PJYB 3EVSC 1IJCA 1ZADA 2BHIA 1H0JA 1NORA 2N99A 4ZQYA 1ONJA 3U73U 4XJJA 1IK8A 1YWHA 1COEA 1ERGA 2UX2A 2JVEA 1FF4A 4LFTA 5EBXA 2CRSA 1CDSA 1NYUA 1CDQA 1XT3A 1HOYA 3PLCA 1FSSB 2QJBC 3NEQA 1KL8A 1S4YA 3NDSA 2UWRA 2HLRA 1RL5A 2H8UA 2MUPA 1RGJA 1TGXA 3NH7A 4DO8A 6EBXA 1IDGA 1IDIA 2MFAA 1BXPA 2CTXA 1I02A 2PJYC 1LX5B 1FASA 5DO6A 1F94A 1MR6A 1BTEA 2I9BE 4FAOC 1HC9B 1CDRA 1CREA 1B41B 1LJZA 1CCQA 4EY8B 1LXHA 1KU6B 2CRTA 1LXGA 1LSIA 3BT1U 4OM4A 1W6BA 2ERAA 1CXNA 2BTXA 1TXAA 1KC4A 1L4WA 1KTZB 1CVOA 2GOOB 4OM5A 2NBTA 1CODA 2H7ZB 3BT2U
chains in the Genus database with same CATH topology
1KBTA 1CXOA 1CHVS 2QJ9C 1M9ZA 2MUOA 2LA1A 3LAQU 2X8BB 1CRFA 4HQPF 1CDTA 1JE9A 3ERAA 5IMYC 2H62C 1FFJA 1IDLA 4BDTB 1NTNA 2CCXA 2ABXA 1FSCA 1KS6A 1HC9A 1ES7B 1NTXA 4IYEA 4BIKB 1IKCA 1NXBA 2L5SA 2MJ0A 1G6MA 3QB4B 3KFDE 2MJYA 1CTXA 2FD6U 2J8BA 1REWC 3VTSA 4AEAA 2QJAC 4P7UA 1KXIA 1IDHA 2MHYA 1DRSA 4UY2C 3HH7A 1JGKA 1V6PA 1QM7A 1JBDA 1HAAA 2H7ZA 2H62D 1ERAA 4QTIU 5DU1A 1ABTA 1HAJA 1KFHA 1PLOA 1UG4A 1IQ9A 2GOOC 2HLQA 1VB0A 2H64B 2CDXA 5IMTD 4FAOE 1TXBA 1QKEA 3KFDI 2K3GA 1FRAA 3U74U 1CB9A 2MJ4A 1KBAA 1TFSA 2LCRA 1QKDA 2H64C 3EBXA 2QC1A 1NEAA 2OFSA 2H5FA 1F8UB 1MAHF 5DZ5A 1KBSA 2VLWA 4KSNA 2JQPA 2L03A 4RUDA 3FEVA 1NYSA 2PJYB 3EVSC 1IJCA 1ZADA 2BHIA 1H0JA 1NORA 2N99A 4ZQYA 1ONJA 3U73U 4XJJA 1IK8A 1YWHA 1COEA 1ERGA 2UX2A 2JVEA 1FF4A 4LFTA 5EBXA 2CRSA 1CDSA 1NYUA 1CDQA 1XT3A 1HOYA 3PLCA 1FSSB 2QJBC 3NEQA 1KL8A 1S4YA 3NDSA 2UWRA 2HLRA 1RL5A 2H8UA 2MUPA 1RGJA 1TGXA 3NH7A 4DO8A 6EBXA 1IDGA 1IDIA 2MFAA 1BXPA 2CTXA 1I02A 2PJYC 1LX5B 1FASA 5DO6A 1F94A 1MR6A 1BTEA 2I9BE 4FAOC 1HC9B 1CDRA 1CREA 1B41B 1LJZA 1CCQA 4EY8B 1LXHA 1KU6B 2CRTA 1LXGA 1LSIA 3BT1U 4OM4A 1W6BA 2ERAA 1CXNA 2BTXA 1TXAA 1KC4A 1L4WA 1KTZB 1CVOA 2GOOB 4OM5A 2NBTA 1CODA 2H7ZB 3BT2U
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KBT A;  1CXO A;  1CHV S;  2QJ9 C;  1M9Z A;  2MUO A;  2LA1 A;  3LAQ U;  2X8B B;  1CRF A;  4HQP F;  1CDT A;  1JE9 A;  3ERA A;  5IMY C;  2H62 C;  1FFJ A;  1IDL A;  4BDT B;  1NTN A;  2CCX A;  2ABX A;  1FSC A;  1KS6 A;  1HC9 A;  1ES7 B;  1NTX A;  4IYE A;  4BIK B;  1IKC A;  1NXB A;  2L5S A;  2MJ0 A;  1G6M A;  3QB4 B;  3KFD E;  2MJY A;  1CTX A;  2FD6 U;  2J8B A;  1REW C;  3VTS A;  4AEA A;  2QJA C;  4P7U A;  1KXI A;  1IDH A;  2MHY A;  1DRS A;  4UY2 C;  3HH7 A;  1JGK A;  1V6P A;  1QM7 A;  1JBD A;  1HAA A;  2H7Z A;  2H62 D;  1ERA A;  4QTI U;  5DU1 A;  1ABT A;  1HAJ A;  1KFH A;  1PLO A;  1UG4 A;  1IQ9 A;  2GOO C;  2HLQ A;  1VB0 A;  2H64 B;  2CDX A;  5IMT D;  4FAO E;  1TXB A;  1QKE A;  3KFD I;  2K3G A;  1FRA A;  3U74 U;  1CB9 A;  2MJ4 A;  1KBA A;  1TFS A;  2LCR A;  1QKD A;  2H64 C;  3EBX A;  2QC1 A;  1NEA A;  2OFS A;  2H5F A;  1F8U B;  1MAH F;  5DZ5 A;  1KBS A;  2VLW A;  2JQP A;  2L03 A;  4RUD A;  3FEV A;  1NYS A;  2PJY B;  3EVS C;  1IJC A;  1ZAD A;  2BHI A;  1H0J A;  1NOR A;  2N99 A;  4ZQY A;  1ONJ A;  3U73 U;  4XJJ A;  1IK8 A;  1YWH A;  1COE A;  1ERG A;  2UX2 A;  2JVE A;  1FF4 A;  4LFT A;  5EBX A;  2CRS A;  1CDS A;  1NYU A;  1CDQ A;  1XT3 A;  1HOY A;  3PLC A;  1FSS B;  2QJB C;  3NEQ A;  1KL8 A;  1S4Y A;  3NDS A;  2UWR A;  2HLR A;  1RL5 A;  2H8U A;  2MUP A;  1RGJ A;  1TGX A;  3NH7 A;  4DO8 A;  6EBX A;  1IDG A;  1IDI A;  2MFA A;  1BXP A;  2CTX A;  1I02 A;  2PJY C;  1LX5 B;  1FAS A;  5DO6 A;  1F94 A;  1MR6 A;  1BTE A;  2I9B E;  4FAO C;  1HC9 B;  1CDR A;  1CRE A;  1B41 B;  1LJZ A;  1CCQ A;  4EY8 B;  1LXH A;  1KU6 B;  2CRT A;  1LXG A;  1LSI A;  3BT1 U;  4OM4 A;  1W6B A;  2ERA A;  1CXN A;  2BTX A;  1TXA A;  1KC4 A;  1L4W A;  1KTZ B;  1CVO A;  2GOO B;  4OM5 A;  2NBT A;  1COD A;  2H7Z B;  3BT2 U; 
#chains in the Genus database with same CATH topology
 1KBT A;  1CXO A;  1CHV S;  2QJ9 C;  1M9Z A;  2MUO A;  2LA1 A;  3LAQ U;  2X8B B;  1CRF A;  4HQP F;  1CDT A;  1JE9 A;  3ERA A;  5IMY C;  2H62 C;  1FFJ A;  1IDL A;  4BDT B;  1NTN A;  2CCX A;  2ABX A;  1FSC A;  1KS6 A;  1HC9 A;  1ES7 B;  1NTX A;  4IYE A;  4BIK B;  1IKC A;  1NXB A;  2L5S A;  2MJ0 A;  1G6M A;  3QB4 B;  3KFD E;  2MJY A;  1CTX A;  2FD6 U;  2J8B A;  1REW C;  3VTS A;  4AEA A;  2QJA C;  4P7U A;  1KXI A;  1IDH A;  2MHY A;  1DRS A;  4UY2 C;  3HH7 A;  1JGK A;  1V6P A;  1QM7 A;  1JBD A;  1HAA A;  2H7Z A;  2H62 D;  1ERA A;  4QTI U;  5DU1 A;  1ABT A;  1HAJ A;  1KFH A;  1PLO A;  1UG4 A;  1IQ9 A;  2GOO C;  2HLQ A;  1VB0 A;  2H64 B;  2CDX A;  5IMT D;  4FAO E;  1TXB A;  1QKE A;  3KFD I;  2K3G A;  1FRA A;  3U74 U;  1CB9 A;  2MJ4 A;  1KBA A;  1TFS A;  2LCR A;  1QKD A;  2H64 C;  3EBX A;  2QC1 A;  1NEA A;  2OFS A;  2H5F A;  1F8U B;  1MAH F;  5DZ5 A;  1KBS A;  2VLW A;  4KSN A;  2JQP A;  2L03 A;  4RUD A;  3FEV A;  1NYS A;  2PJY B;  3EVS C;  1IJC A;  1ZAD A;  2BHI A;  1H0J A;  1NOR A;  2N99 A;  4ZQY A;  1ONJ A;  3U73 U;  4XJJ A;  1IK8 A;  1YWH A;  1COE A;  1ERG A;  2UX2 A;  2JVE A;  1FF4 A;  4LFT A;  5EBX A;  2CRS A;  1CDS A;  1NYU A;  1CDQ A;  1XT3 A;  1HOY A;  3PLC A;  1FSS B;  2QJB C;  3NEQ A;  1KL8 A;  1S4Y A;  3NDS A;  2UWR A;  2HLR A;  1RL5 A;  2H8U A;  2MUP A;  1RGJ A;  1TGX A;  3NH7 A;  4DO8 A;  6EBX A;  1IDG A;  1IDI A;  2MFA A;  1BXP A;  2CTX A;  1I02 A;  2PJY C;  1LX5 B;  1FAS A;  5DO6 A;  1F94 A;  1MR6 A;  1BTE A;  2I9B E;  4FAO C;  1HC9 B;  1CDR A;  1CRE A;  1B41 B;  1LJZ A;  1CCQ A;  4EY8 B;  1LXH A;  1KU6 B;  2CRT A;  1LXG A;  1LSI A;  3BT1 U;  4OM4 A;  1W6B A;  2ERA A;  1CXN A;  2BTX A;  1TXA A;  1KC4 A;  1L4W A;  1KTZ B;  1CVO A;  2GOO B;  4OM5 A;  2NBT A;  1COD A;  2H7Z B;  3BT2 U; 
#chains in the Genus database with same CATH homology
 1KBT A;  1CXO A;  1CHV S;  2QJ9 C;  1M9Z A;  2MUO A;  2LA1 A;  3LAQ U;  2X8B B;  1CRF A;  4HQP F;  1CDT A;  1JE9 A;  3ERA A;  5IMY C;  2H62 C;  1FFJ A;  1IDL A;  4BDT B;  1NTN A;  2CCX A;  2ABX A;  1FSC A;  1KS6 A;  1HC9 A;  1ES7 B;  1NTX A;  4IYE A;  4BIK B;  1IKC A;  1NXB A;  2L5S A;  2MJ0 A;  1G6M A;  3QB4 B;  3KFD E;  2MJY A;  1CTX A;  2FD6 U;  2J8B A;  1REW C;  3VTS A;  4AEA A;  2QJA C;  4P7U A;  1KXI A;  1IDH A;  2MHY A;  1DRS A;  4UY2 C;  3HH7 A;  1JGK A;  1V6P A;  1QM7 A;  1JBD A;  1HAA A;  2H7Z A;  2H62 D;  1ERA A;  4QTI U;  5DU1 A;  1ABT A;  1HAJ A;  1KFH A;  1PLO A;  1UG4 A;  1IQ9 A;  2GOO C;  2HLQ A;  1VB0 A;  2H64 B;  2CDX A;  5IMT D;  4FAO E;  1TXB A;  1QKE A;  3KFD I;  2K3G A;  1FRA A;  3U74 U;  1CB9 A;  2MJ4 A;  1KBA A;  1TFS A;  2LCR A;  1QKD A;  2H64 C;  3EBX A;  2QC1 A;  1NEA A;  2OFS A;  2H5F A;  1F8U B;  1MAH F;  5DZ5 A;  1KBS A;  2VLW A;  4KSN A;  2JQP A;  2L03 A;  4RUD A;  3FEV A;  1NYS A;  2PJY B;  3EVS C;  1IJC A;  1ZAD A;  2BHI A;  1H0J A;  1NOR A;  2N99 A;  4ZQY A;  1ONJ A;  3U73 U;  4XJJ A;  1IK8 A;  1YWH A;  1COE A;  1ERG A;  2UX2 A;  2JVE A;  1FF4 A;  4LFT A;  5EBX A;  2CRS A;  1CDS A;  1NYU A;  1CDQ A;  1XT3 A;  1HOY A;  3PLC A;  1FSS B;  2QJB C;  3NEQ A;  1KL8 A;  1S4Y A;  3NDS A;  2UWR A;  2HLR A;  1RL5 A;  2H8U A;  2MUP A;  1RGJ A;  1TGX A;  3NH7 A;  4DO8 A;  6EBX A;  1IDG A;  1IDI A;  2MFA A;  1BXP A;  2CTX A;  1I02 A;  2PJY C;  1LX5 B;  1FAS A;  5DO6 A;  1F94 A;  1MR6 A;  1BTE A;  2I9B E;  4FAO C;  1HC9 B;  1CDR A;  1CRE A;  1B41 B;  1LJZ A;  1CCQ A;  4EY8 B;  1LXH A;  1KU6 B;  2CRT A;  1LXG A;  1LSI A;  3BT1 U;  4OM4 A;  1W6B A;  2ERA A;  1CXN A;  2BTX A;  1TXA A;  1KC4 A;  1L4W A;  1KTZ B;  1CVO A;  2GOO B;  4OM5 A;  2NBT A;  1COD A;  2H7Z B;  3BT2 U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...