1IDHA

The nmr solution structure of the complex formed between alpha-bungarotoxin and an 18mer cognate peptide
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
74
structure length
74
Chain Sequence
IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords ALPHA-BUNGAROTOXIN
publication title The solution structure of the complex formed between alpha-bungarotoxin and an 18-mer cognate peptide derived from the alpha 1 subunit of the nicotinic acetylcholine receptor from Torpedo californica.
pubmed doi rcsb
source organism Torpedo californica
total genus 5
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2001-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1idhA00
1ABTA 1H0JA 1KBAA 1B41B 1FSCA 2CCXA 4AEAA 1CVOA 1S4YA 1CDTA 1DRSA 1IDHA 2MUPA 1IDIA 1IKCA 1CODA 1LXHA 3LAQU 1IJCA 2MJYA 4BIKB 5IMYC 1NTNA 2UX2A 1CHVS 4ZQYA 1JE9A 1LJZA 4FAOC 1CRFA 1RL5A 1JGKA 2H5FA 2L03A 1M9ZA 1YWHA 2LA1A 1NEAA 2K3GA 4OM5A 2CTXA 3U74U 1F94A 2PJYC 1HC9A 1QM7A 1TXAA 1ONJA 1VB0A 2HLQA 1FSSB 2LCRA 4LFTA 3U73U 1ES7B 3NDSA 1CB9A 1LSIA 3KFDI 3ERAA 2JVEA 1QKEA 2H7ZB 1MR6A 1NTXA 1CXOA 2H64B 1JBDA 2L5SA 3NH7A 1CDSA 2H64C 2BHIA 1MAHF 1KL8A 1NYSA 1IK8A 2CRSA 1IQ9A 2QJBC 4QTIU 2MJ4A 1I02A 2BTXA 1KC4A 1NXBA 2N99A 1KFHA 1CDRA 2GOOB 2H62C 1PLOA 2VLWA 3BT1U 2CRTA 1CCQA 1CTXA 2J8BA 2ERAA 2ABXA 3FEVA 2H8UA 1W6BA 2MFAA 3HH7A 2QC1A 3VTSA 1LX5B 2FD6U 4HQPF 3QB4B 1G6MA 1RGJA 1ERGA 1REWC 2HLRA 3EVSC 1HAJA 1F8UB 5IMTD 1TGXA 1TXBA 1ZADA 2MHYA 1BXPA 1V6PA 1FASA 1ERAA 3PLCA 2UWRA 1KS6A 2GOOC 1QKDA 2MJ0A 2MUOA 2NBTA 1KTZB 2H7ZA 1UG4A 4UY2C 5EBXA 5DU1A 2X8BB 3EBXA 1FF4A 1KBSA 1HC9B 5DZ5A 4BDTB 4OM4A 1HAAA 4XJJA 4DO8A 1KBTA 1XT3A 1IDGA 1LXGA 2QJAC 2CDXA 3BT2U 4P7UA 1FRAA 1BTEA 2I9BE 1FFJA 2OFSA 1KXIA 5DO6A 1TFSA 1L4WA 3KFDE 2PJYB 3NEQA 1CDQA 1NORA 1IDLA 6EBXA 1COEA 4RUDA 2JQPA 1NYUA 1CREA 1KU6B 4EY8B 1CXNA 2H62D 4IYEA 1HOYA 2QJ9C 4FAOE
chains in the Genus database with same CATH superfamily
1ABTA 1H0JA 1KBAA 1B41B 1FSCA 2CCXA 4AEAA 1CVOA 1S4YA 1CDTA 1DRSA 1IDHA 2MUPA 1IDIA 1IKCA 1CODA 1LXHA 3LAQU 1IJCA 2MJYA 4BIKB 5IMYC 1NTNA 2UX2A 1CHVS 4ZQYA 1JE9A 1LJZA 4FAOC 1CRFA 1RL5A 1JGKA 2H5FA 2L03A 1M9ZA 1YWHA 2LA1A 1NEAA 2K3GA 4OM5A 2CTXA 3U74U 1F94A 2PJYC 1HC9A 1QM7A 1TXAA 1ONJA 1VB0A 2HLQA 1FSSB 2LCRA 4LFTA 3U73U 1ES7B 3NDSA 1CB9A 1LSIA 3KFDI 3ERAA 2JVEA 1QKEA 2H7ZB 1MR6A 1NTXA 1CXOA 2H64B 1JBDA 2L5SA 3NH7A 1CDSA 2H64C 2BHIA 1MAHF 1KL8A 1NYSA 1IK8A 2CRSA 1IQ9A 2QJBC 4QTIU 2MJ4A 1I02A 2BTXA 1KC4A 1NXBA 2N99A 1KFHA 1CDRA 2GOOB 2H62C 1PLOA 2VLWA 3BT1U 2CRTA 1CCQA 1CTXA 2J8BA 2ERAA 2ABXA 3FEVA 4KSNA 2H8UA 1W6BA 2MFAA 3HH7A 2QC1A 3VTSA 1LX5B 2FD6U 4HQPF 3QB4B 1G6MA 1RGJA 1ERGA 1REWC 2HLRA 3EVSC 1HAJA 1F8UB 5IMTD 1TGXA 1TXBA 1ZADA 2MHYA 1BXPA 1V6PA 1FASA 1ERAA 3PLCA 2UWRA 1KS6A 2GOOC 1QKDA 2MJ0A 2MUOA 2NBTA 1KTZB 2H7ZA 1UG4A 4UY2C 5EBXA 5DU1A 2X8BB 3EBXA 1FF4A 1KBSA 1HC9B 5DZ5A 4BDTB 4OM4A 1HAAA 4XJJA 4DO8A 1KBTA 1XT3A 1IDGA 1LXGA 2QJAC 2CDXA 3BT2U 4P7UA 1FRAA 1BTEA 2I9BE 1FFJA 2OFSA 1KXIA 5DO6A 1TFSA 1L4WA 3KFDE 2PJYB 3NEQA 1CDQA 1NORA 1IDLA 6EBXA 1COEA 4RUDA 2JQPA 1NYUA 1CREA 1KU6B 4EY8B 1CXNA 2H62D 4IYEA 1HOYA 2QJ9C 4FAOE
chains in the Genus database with same CATH topology
1ABTA 1H0JA 1KBAA 1B41B 1FSCA 2CCXA 4AEAA 1CVOA 1S4YA 1CDTA 1DRSA 1IDHA 2MUPA 1IDIA 1IKCA 1CODA 1LXHA 3LAQU 1IJCA 2MJYA 4BIKB 5IMYC 1NTNA 2UX2A 1CHVS 4ZQYA 1JE9A 1LJZA 4FAOC 1CRFA 1RL5A 1JGKA 2H5FA 2L03A 1M9ZA 1YWHA 2LA1A 1NEAA 2K3GA 4OM5A 2CTXA 3U74U 1F94A 2PJYC 1HC9A 1QM7A 1TXAA 1ONJA 1VB0A 2HLQA 1FSSB 2LCRA 4LFTA 3U73U 1ES7B 3NDSA 1CB9A 1LSIA 3KFDI 3ERAA 2JVEA 1QKEA 2H7ZB 1MR6A 1NTXA 1CXOA 2H64B 1JBDA 2L5SA 3NH7A 1CDSA 2H64C 2BHIA 1MAHF 1KL8A 1NYSA 1IK8A 2CRSA 1IQ9A 2QJBC 4QTIU 2MJ4A 1I02A 2BTXA 1KC4A 1NXBA 2N99A 1KFHA 1CDRA 2GOOB 2H62C 1PLOA 2VLWA 3BT1U 2CRTA 1CCQA 1CTXA 2J8BA 2ERAA 2ABXA 3FEVA 4KSNA 2H8UA 1W6BA 2MFAA 3HH7A 2QC1A 3VTSA 1LX5B 2FD6U 4HQPF 3QB4B 1G6MA 1RGJA 1ERGA 1REWC 2HLRA 3EVSC 1HAJA 1F8UB 5IMTD 1TGXA 1TXBA 1ZADA 2MHYA 1BXPA 1V6PA 1FASA 1ERAA 3PLCA 2UWRA 1KS6A 2GOOC 1QKDA 2MJ0A 2MUOA 2NBTA 1KTZB 2H7ZA 1UG4A 4UY2C 5EBXA 5DU1A 2X8BB 3EBXA 1FF4A 1KBSA 1HC9B 5DZ5A 4BDTB 4OM4A 1HAAA 4XJJA 4DO8A 1KBTA 1XT3A 1IDGA 1LXGA 2QJAC 2CDXA 3BT2U 4P7UA 1FRAA 1BTEA 2I9BE 1FFJA 2OFSA 1KXIA 5DO6A 1TFSA 1L4WA 3KFDE 2PJYB 3NEQA 1CDQA 1NORA 1IDLA 6EBXA 1COEA 4RUDA 2JQPA 1NYUA 1CREA 1KU6B 4EY8B 1CXNA 2H62D 4IYEA 1HOYA 2QJ9C 4FAOE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ABT A;  1H0J A;  1KBA A;  1B41 B;  1FSC A;  2CCX A;  4AEA A;  1CVO A;  1S4Y A;  1CDT A;  1DRS A;  1IDH A;  2MUP A;  1IDI A;  1IKC A;  1COD A;  1LXH A;  3LAQ U;  1IJC A;  2MJY A;  4BIK B;  5IMY C;  1NTN A;  2UX2 A;  1CHV S;  4ZQY A;  1JE9 A;  1LJZ A;  4FAO C;  1CRF A;  1RL5 A;  1JGK A;  2H5F A;  2L03 A;  1M9Z A;  1YWH A;  2LA1 A;  1NEA A;  2K3G A;  4OM5 A;  2CTX A;  3U74 U;  1F94 A;  2PJY C;  1HC9 A;  1QM7 A;  1TXA A;  1ONJ A;  1VB0 A;  2HLQ A;  1FSS B;  2LCR A;  4LFT A;  3U73 U;  1ES7 B;  3NDS A;  1CB9 A;  1LSI A;  3KFD I;  3ERA A;  2JVE A;  1QKE A;  2H7Z B;  1MR6 A;  1NTX A;  1CXO A;  2H64 B;  1JBD A;  2L5S A;  3NH7 A;  1CDS A;  2H64 C;  2BHI A;  1MAH F;  1KL8 A;  1NYS A;  1IK8 A;  2CRS A;  1IQ9 A;  2QJB C;  4QTI U;  2MJ4 A;  1I02 A;  2BTX A;  1KC4 A;  1NXB A;  2N99 A;  1KFH A;  1CDR A;  2GOO B;  2H62 C;  1PLO A;  2VLW A;  3BT1 U;  2CRT A;  1CCQ A;  1CTX A;  2J8B A;  2ERA A;  2ABX A;  3FEV A;  2H8U A;  1W6B A;  2MFA A;  3HH7 A;  2QC1 A;  3VTS A;  1LX5 B;  2FD6 U;  4HQP F;  3QB4 B;  1G6M A;  1RGJ A;  1ERG A;  1REW C;  2HLR A;  3EVS C;  1HAJ A;  1F8U B;  5IMT D;  1TGX A;  1TXB A;  1ZAD A;  2MHY A;  1BXP A;  1V6P A;  1FAS A;  1ERA A;  3PLC A;  2UWR A;  1KS6 A;  2GOO C;  1QKD A;  2MJ0 A;  2MUO A;  2NBT A;  1KTZ B;  2H7Z A;  1UG4 A;  4UY2 C;  5EBX A;  5DU1 A;  2X8B B;  3EBX A;  1FF4 A;  1KBS A;  1HC9 B;  5DZ5 A;  4BDT B;  4OM4 A;  1HAA A;  4XJJ A;  4DO8 A;  1KBT A;  1XT3 A;  1IDG A;  1LXG A;  2QJA C;  2CDX A;  3BT2 U;  4P7U A;  1FRA A;  1BTE A;  2I9B E;  1FFJ A;  2OFS A;  1KXI A;  5DO6 A;  1TFS A;  1L4W A;  3KFD E;  2PJY B;  3NEQ A;  1CDQ A;  1NOR A;  1IDL A;  6EBX A;  1COE A;  4RUD A;  2JQP A;  1NYU A;  1CRE A;  1KU6 B;  4EY8 B;  1CXN A;  2H62 D;  4IYE A;  1HOY A;  2QJ9 C;  4FAO E; 
#chains in the Genus database with same CATH topology
 1ABT A;  1H0J A;  1KBA A;  1B41 B;  1FSC A;  2CCX A;  4AEA A;  1CVO A;  1S4Y A;  1CDT A;  1DRS A;  1IDH A;  2MUP A;  1IDI A;  1IKC A;  1COD A;  1LXH A;  3LAQ U;  1IJC A;  2MJY A;  4BIK B;  5IMY C;  1NTN A;  2UX2 A;  1CHV S;  4ZQY A;  1JE9 A;  1LJZ A;  4FAO C;  1CRF A;  1RL5 A;  1JGK A;  2H5F A;  2L03 A;  1M9Z A;  1YWH A;  2LA1 A;  1NEA A;  2K3G A;  4OM5 A;  2CTX A;  3U74 U;  1F94 A;  2PJY C;  1HC9 A;  1QM7 A;  1TXA A;  1ONJ A;  1VB0 A;  2HLQ A;  1FSS B;  2LCR A;  4LFT A;  3U73 U;  1ES7 B;  3NDS A;  1CB9 A;  1LSI A;  3KFD I;  3ERA A;  2JVE A;  1QKE A;  2H7Z B;  1MR6 A;  1NTX A;  1CXO A;  2H64 B;  1JBD A;  2L5S A;  3NH7 A;  1CDS A;  2H64 C;  2BHI A;  1MAH F;  1KL8 A;  1NYS A;  1IK8 A;  2CRS A;  1IQ9 A;  2QJB C;  4QTI U;  2MJ4 A;  1I02 A;  2BTX A;  1KC4 A;  1NXB A;  2N99 A;  1KFH A;  1CDR A;  2GOO B;  2H62 C;  1PLO A;  2VLW A;  3BT1 U;  2CRT A;  1CCQ A;  1CTX A;  2J8B A;  2ERA A;  2ABX A;  3FEV A;  4KSN A;  2H8U A;  1W6B A;  2MFA A;  3HH7 A;  2QC1 A;  3VTS A;  1LX5 B;  2FD6 U;  4HQP F;  3QB4 B;  1G6M A;  1RGJ A;  1ERG A;  1REW C;  2HLR A;  3EVS C;  1HAJ A;  1F8U B;  5IMT D;  1TGX A;  1TXB A;  1ZAD A;  2MHY A;  1BXP A;  1V6P A;  1FAS A;  1ERA A;  3PLC A;  2UWR A;  1KS6 A;  2GOO C;  1QKD A;  2MJ0 A;  2MUO A;  2NBT A;  1KTZ B;  2H7Z A;  1UG4 A;  4UY2 C;  5EBX A;  5DU1 A;  2X8B B;  3EBX A;  1FF4 A;  1KBS A;  1HC9 B;  5DZ5 A;  4BDT B;  4OM4 A;  1HAA A;  4XJJ A;  4DO8 A;  1KBT A;  1XT3 A;  1IDG A;  1LXG A;  2QJA C;  2CDX A;  3BT2 U;  4P7U A;  1FRA A;  1BTE A;  2I9B E;  1FFJ A;  2OFS A;  1KXI A;  5DO6 A;  1TFS A;  1L4W A;  3KFD E;  2PJY B;  3NEQ A;  1CDQ A;  1NOR A;  1IDL A;  6EBX A;  1COE A;  4RUD A;  2JQP A;  1NYU A;  1CRE A;  1KU6 B;  4EY8 B;  1CXN A;  2H62 D;  4IYE A;  1HOY A;  2QJ9 C;  4FAO E; 
#chains in the Genus database with same CATH homology
 1ABT A;  1H0J A;  1KBA A;  1B41 B;  1FSC A;  2CCX A;  4AEA A;  1CVO A;  1S4Y A;  1CDT A;  1DRS A;  1IDH A;  2MUP A;  1IDI A;  1IKC A;  1COD A;  1LXH A;  3LAQ U;  1IJC A;  2MJY A;  4BIK B;  5IMY C;  1NTN A;  2UX2 A;  1CHV S;  4ZQY A;  1JE9 A;  1LJZ A;  4FAO C;  1CRF A;  1RL5 A;  1JGK A;  2H5F A;  2L03 A;  1M9Z A;  1YWH A;  2LA1 A;  1NEA A;  2K3G A;  4OM5 A;  2CTX A;  3U74 U;  1F94 A;  2PJY C;  1HC9 A;  1QM7 A;  1TXA A;  1ONJ A;  1VB0 A;  2HLQ A;  1FSS B;  2LCR A;  4LFT A;  3U73 U;  1ES7 B;  3NDS A;  1CB9 A;  1LSI A;  3KFD I;  3ERA A;  2JVE A;  1QKE A;  2H7Z B;  1MR6 A;  1NTX A;  1CXO A;  2H64 B;  1JBD A;  2L5S A;  3NH7 A;  1CDS A;  2H64 C;  2BHI A;  1MAH F;  1KL8 A;  1NYS A;  1IK8 A;  2CRS A;  1IQ9 A;  2QJB C;  4QTI U;  2MJ4 A;  1I02 A;  2BTX A;  1KC4 A;  1NXB A;  2N99 A;  1KFH A;  1CDR A;  2GOO B;  2H62 C;  1PLO A;  2VLW A;  3BT1 U;  2CRT A;  1CCQ A;  1CTX A;  2J8B A;  2ERA A;  2ABX A;  3FEV A;  4KSN A;  2H8U A;  1W6B A;  2MFA A;  3HH7 A;  2QC1 A;  3VTS A;  1LX5 B;  2FD6 U;  4HQP F;  3QB4 B;  1G6M A;  1RGJ A;  1ERG A;  1REW C;  2HLR A;  3EVS C;  1HAJ A;  1F8U B;  5IMT D;  1TGX A;  1TXB A;  1ZAD A;  2MHY A;  1BXP A;  1V6P A;  1FAS A;  1ERA A;  3PLC A;  2UWR A;  1KS6 A;  2GOO C;  1QKD A;  2MJ0 A;  2MUO A;  2NBT A;  1KTZ B;  2H7Z A;  1UG4 A;  4UY2 C;  5EBX A;  5DU1 A;  2X8B B;  3EBX A;  1FF4 A;  1KBS A;  1HC9 B;  5DZ5 A;  4BDT B;  4OM4 A;  1HAA A;  4XJJ A;  4DO8 A;  1KBT A;  1XT3 A;  1IDG A;  1LXG A;  2QJA C;  2CDX A;  3BT2 U;  4P7U A;  1FRA A;  1BTE A;  2I9B E;  1FFJ A;  2OFS A;  1KXI A;  5DO6 A;  1TFS A;  1L4W A;  3KFD E;  2PJY B;  3NEQ A;  1CDQ A;  1NOR A;  1IDL A;  6EBX A;  1COE A;  4RUD A;  2JQP A;  1NYU A;  1CRE A;  1KU6 B;  4EY8 B;  1CXN A;  2H62 D;  4IYE A;  1HOY A;  2QJ9 C;  4FAO E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...