3ERAA

Recombinant erabutoxin a (s8t mutant)
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
62
structure length
62
Chain Sequence
RICFNHQTSQPQTTKTCSPGESSCYNKQWSDFRGTIIERGCGCPTVKPGIKLSCCESEVCNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ERABUTOXIN A
publication title High resolution x-ray analysis of two mutants of a curaremimetic snake toxin
pubmed doi rcsb
source organism Laticauda semifasciata
molecule tags Neurotoxin
total genus 12
structure length 62
sequence length 62
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 3eraA00
2GOOB 1CDQA 4IYEA 1V6PA 1F8UB 1ES7B 1BTEA 2BTXA 2H64C 1UG4A 1CVOA 1YWHA 1CCQA 1ERAA 6EBXA 1CXNA 2H7ZA 5DO6A 4BIKB 2BHIA 1NORA 1MR6A 3NEQA 1IJCA 1LXGA 2QC1A 5DZ5A 3KFDE 2K3GA 1L4WA 3KFDI 1JE9A 4LFTA 2MFAA 2MJYA 2MUPA 1COEA 1NXBA 1RGJA 2QJAC 1IDIA 1FFJA 2MUOA 2L03A 2UWRA 1CRFA 2VLWA 1IDLA 1ERGA 1HC9A 1HC9B 3EBXA 2J8BA 1VB0A 4ZQYA 1CTXA 1FSSB 1CDRA 1FSCA 2FD6U 3ERAA 1DRSA 2L5SA 1G6MA 1KL8A 2N99A 1QM7A 1CREA 4OM4A 1KU6B 1QKEA 2NBTA 1KBAA 5DU1A 2MHYA 2MJ0A 2QJBC 2UX2A 1RL5A 3FEVA 1HAAA 1B41B 3EVSC 2CRSA 1KFHA 1FF4A 1NYSA 1TFSA 1CXOA 1KXIA 1FRAA 1XT3A 3NH7A 4RUDA 4DO8A 1TXAA 1IQ9A 1HOYA 2HLRA 1NTNA 4AEAA 3HH7A 2QJ9C 2JVEA 2X8BB 4OM5A 1KBSA 2HLQA 4EY8B 2CTXA 2H62D 3LAQU 1NYUA 3U74U 3U73U 1LSIA 1IDGA 1QKDA 2ERAA 3VTSA 3PLCA 1FASA 1MAHF 4UY2C 2CDXA 4XJJA 4FAOC 1BXPA 1CHVS 2CCXA 1NEAA 4P7UA 1CDTA 1IKCA 4BDTB 1M9ZA 1KS6A 5EBXA 1PLOA 1IDHA 1JGKA 1CODA 2LCRA 1CDSA 1LX5B 2H64B 1JBDA 2I9BE 2PJYC 1REWC 1KC4A 2H7ZB 2H5FA 3QB4B 2CRTA 2H62C 1H0JA 1W6BA 1ONJA 2PJYB 5IMTD 1TXBA 2JQPA 1HAJA 1I02A 1S4YA 1KTZB 2H8UA 2LA1A 1ZADA 3BT1U 2MJ4A 1NTXA 4QTIU 1LJZA 3NDSA 2OFSA 1TGXA 1KBTA 1IK8A 3BT2U 2ABXA 4FAOE 1LXHA 5IMYC 1F94A 1ABTA 4HQPF 2GOOC 1CB9A
chains in the Genus database with same CATH superfamily
2GOOB 1CDQA 4IYEA 1V6PA 1F8UB 1ES7B 1BTEA 2BTXA 2H64C 1UG4A 1CVOA 1YWHA 1CCQA 1ERAA 6EBXA 1CXNA 2H7ZA 5DO6A 4BIKB 2BHIA 1NORA 1MR6A 3NEQA 1IJCA 1LXGA 2QC1A 5DZ5A 3KFDE 2K3GA 1L4WA 3KFDI 1JE9A 4LFTA 2MFAA 2MJYA 2MUPA 1COEA 1NXBA 1RGJA 2QJAC 1IDIA 1FFJA 2MUOA 2L03A 2UWRA 1CRFA 2VLWA 1IDLA 1ERGA 1HC9A 1HC9B 3EBXA 2J8BA 1VB0A 4ZQYA 1CTXA 1FSSB 1CDRA 1FSCA 2FD6U 3ERAA 1DRSA 2L5SA 1G6MA 1KL8A 2N99A 1QM7A 1CREA 4OM4A 1KU6B 1QKEA 2NBTA 1KBAA 5DU1A 2MHYA 2MJ0A 2QJBC 2UX2A 1RL5A 3FEVA 1HAAA 1B41B 3EVSC 2CRSA 1KFHA 1FF4A 1NYSA 1TFSA 1CXOA 1KXIA 1FRAA 1XT3A 3NH7A 4RUDA 4DO8A 1TXAA 1IQ9A 1HOYA 2HLRA 1NTNA 4AEAA 3HH7A 2QJ9C 2JVEA 2X8BB 4OM5A 1KBSA 2HLQA 4EY8B 2CTXA 2H62D 3LAQU 1NYUA 3U74U 3U73U 1LSIA 4KSNA 1IDGA 1QKDA 2ERAA 3VTSA 3PLCA 1FASA 1MAHF 4UY2C 2CDXA 4XJJA 4FAOC 1BXPA 1CHVS 2CCXA 1NEAA 4P7UA 1CDTA 1IKCA 4BDTB 1M9ZA 1KS6A 5EBXA 1PLOA 1IDHA 1JGKA 1CODA 2LCRA 1CDSA 1LX5B 2H64B 1JBDA 2I9BE 2PJYC 1REWC 1KC4A 2H7ZB 2H5FA 3QB4B 2CRTA 2H62C 1H0JA 1W6BA 1ONJA 2PJYB 5IMTD 1TXBA 2JQPA 1HAJA 1I02A 1S4YA 1KTZB 2H8UA 2LA1A 1ZADA 3BT1U 2MJ4A 1NTXA 4QTIU 1LJZA 3NDSA 2OFSA 1TGXA 1KBTA 1IK8A 3BT2U 2ABXA 4FAOE 1LXHA 5IMYC 1F94A 1ABTA 4HQPF 2GOOC 1CB9A
chains in the Genus database with same CATH topology
2GOOB 1CDQA 4IYEA 1V6PA 1F8UB 1ES7B 1BTEA 2BTXA 2H64C 1UG4A 1CVOA 1YWHA 1CCQA 1ERAA 6EBXA 1CXNA 2H7ZA 5DO6A 4BIKB 2BHIA 1NORA 1MR6A 3NEQA 1IJCA 1LXGA 2QC1A 5DZ5A 3KFDE 2K3GA 1L4WA 3KFDI 1JE9A 4LFTA 2MFAA 2MJYA 2MUPA 1COEA 1NXBA 1RGJA 2QJAC 1IDIA 1FFJA 2MUOA 2L03A 2UWRA 1CRFA 2VLWA 1IDLA 1ERGA 1HC9A 1HC9B 3EBXA 2J8BA 1VB0A 4ZQYA 1CTXA 1FSSB 1CDRA 1FSCA 2FD6U 3ERAA 1DRSA 2L5SA 1G6MA 1KL8A 2N99A 1QM7A 1CREA 4OM4A 1KU6B 1QKEA 2NBTA 1KBAA 5DU1A 2MHYA 2MJ0A 2QJBC 2UX2A 1RL5A 3FEVA 1HAAA 1B41B 3EVSC 2CRSA 1KFHA 1FF4A 1NYSA 1TFSA 1CXOA 1KXIA 1FRAA 1XT3A 3NH7A 4RUDA 4DO8A 1TXAA 1IQ9A 1HOYA 2HLRA 1NTNA 4AEAA 3HH7A 2QJ9C 2JVEA 2X8BB 4OM5A 1KBSA 2HLQA 4EY8B 2CTXA 2H62D 3LAQU 1NYUA 3U74U 3U73U 1LSIA 4KSNA 1IDGA 1QKDA 2ERAA 3VTSA 3PLCA 1FASA 1MAHF 4UY2C 2CDXA 4XJJA 4FAOC 1BXPA 1CHVS 2CCXA 1NEAA 4P7UA 1CDTA 1IKCA 4BDTB 1M9ZA 1KS6A 5EBXA 1PLOA 1IDHA 1JGKA 1CODA 2LCRA 1CDSA 1LX5B 2H64B 1JBDA 2I9BE 2PJYC 1REWC 1KC4A 2H7ZB 2H5FA 3QB4B 2CRTA 2H62C 1H0JA 1W6BA 1ONJA 2PJYB 5IMTD 1TXBA 2JQPA 1HAJA 1I02A 1S4YA 1KTZB 2H8UA 2LA1A 1ZADA 3BT1U 2MJ4A 1NTXA 4QTIU 1LJZA 3NDSA 2OFSA 1TGXA 1KBTA 1IK8A 3BT2U 2ABXA 4FAOE 1LXHA 5IMYC 1F94A 1ABTA 4HQPF 2GOOC 1CB9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GOO B;  1CDQ A;  4IYE A;  1V6P A;  1F8U B;  1ES7 B;  1BTE A;  2BTX A;  2H64 C;  1UG4 A;  1CVO A;  1YWH A;  1CCQ A;  1ERA A;  6EBX A;  1CXN A;  2H7Z A;  5DO6 A;  4BIK B;  2BHI A;  1NOR A;  1MR6 A;  3NEQ A;  1IJC A;  1LXG A;  2QC1 A;  5DZ5 A;  3KFD E;  2K3G A;  1L4W A;  3KFD I;  1JE9 A;  4LFT A;  2MFA A;  2MJY A;  2MUP A;  1COE A;  1NXB A;  1RGJ A;  2QJA C;  1IDI A;  1FFJ A;  2MUO A;  2L03 A;  2UWR A;  1CRF A;  2VLW A;  1IDL A;  1ERG A;  1HC9 A;  1HC9 B;  3EBX A;  2J8B A;  1VB0 A;  4ZQY A;  1CTX A;  1FSS B;  1CDR A;  1FSC A;  2FD6 U;  3ERA A;  1DRS A;  2L5S A;  1G6M A;  1KL8 A;  2N99 A;  1QM7 A;  1CRE A;  4OM4 A;  1KU6 B;  1QKE A;  2NBT A;  1KBA A;  5DU1 A;  2MHY A;  2MJ0 A;  2QJB C;  2UX2 A;  1RL5 A;  3FEV A;  1HAA A;  1B41 B;  3EVS C;  2CRS A;  1KFH A;  1FF4 A;  1NYS A;  1TFS A;  1CXO A;  1KXI A;  1FRA A;  1XT3 A;  3NH7 A;  4RUD A;  4DO8 A;  1TXA A;  1IQ9 A;  1HOY A;  2HLR A;  1NTN A;  4AEA A;  3HH7 A;  2QJ9 C;  2JVE A;  2X8B B;  4OM5 A;  1KBS A;  2HLQ A;  4EY8 B;  2CTX A;  2H62 D;  3LAQ U;  1NYU A;  3U74 U;  3U73 U;  1LSI A;  1IDG A;  1QKD A;  2ERA A;  3VTS A;  3PLC A;  1FAS A;  1MAH F;  4UY2 C;  2CDX A;  4XJJ A;  4FAO C;  1BXP A;  1CHV S;  2CCX A;  1NEA A;  4P7U A;  1CDT A;  1IKC A;  4BDT B;  1M9Z A;  1KS6 A;  5EBX A;  1PLO A;  1IDH A;  1JGK A;  1COD A;  2LCR A;  1CDS A;  1LX5 B;  2H64 B;  1JBD A;  2I9B E;  2PJY C;  1REW C;  1KC4 A;  2H7Z B;  2H5F A;  3QB4 B;  2CRT A;  2H62 C;  1H0J A;  1W6B A;  1ONJ A;  2PJY B;  5IMT D;  1TXB A;  2JQP A;  1HAJ A;  1I02 A;  1S4Y A;  1KTZ B;  2H8U A;  2LA1 A;  1ZAD A;  3BT1 U;  2MJ4 A;  1NTX A;  4QTI U;  1LJZ A;  3NDS A;  2OFS A;  1TGX A;  1KBT A;  1IK8 A;  3BT2 U;  2ABX A;  4FAO E;  1LXH A;  5IMY C;  1F94 A;  1ABT A;  4HQP F;  2GOO C;  1CB9 A; 
#chains in the Genus database with same CATH topology
 2GOO B;  1CDQ A;  4IYE A;  1V6P A;  1F8U B;  1ES7 B;  1BTE A;  2BTX A;  2H64 C;  1UG4 A;  1CVO A;  1YWH A;  1CCQ A;  1ERA A;  6EBX A;  1CXN A;  2H7Z A;  5DO6 A;  4BIK B;  2BHI A;  1NOR A;  1MR6 A;  3NEQ A;  1IJC A;  1LXG A;  2QC1 A;  5DZ5 A;  3KFD E;  2K3G A;  1L4W A;  3KFD I;  1JE9 A;  4LFT A;  2MFA A;  2MJY A;  2MUP A;  1COE A;  1NXB A;  1RGJ A;  2QJA C;  1IDI A;  1FFJ A;  2MUO A;  2L03 A;  2UWR A;  1CRF A;  2VLW A;  1IDL A;  1ERG A;  1HC9 A;  1HC9 B;  3EBX A;  2J8B A;  1VB0 A;  4ZQY A;  1CTX A;  1FSS B;  1CDR A;  1FSC A;  2FD6 U;  3ERA A;  1DRS A;  2L5S A;  1G6M A;  1KL8 A;  2N99 A;  1QM7 A;  1CRE A;  4OM4 A;  1KU6 B;  1QKE A;  2NBT A;  1KBA A;  5DU1 A;  2MHY A;  2MJ0 A;  2QJB C;  2UX2 A;  1RL5 A;  3FEV A;  1HAA A;  1B41 B;  3EVS C;  2CRS A;  1KFH A;  1FF4 A;  1NYS A;  1TFS A;  1CXO A;  1KXI A;  1FRA A;  1XT3 A;  3NH7 A;  4RUD A;  4DO8 A;  1TXA A;  1IQ9 A;  1HOY A;  2HLR A;  1NTN A;  4AEA A;  3HH7 A;  2QJ9 C;  2JVE A;  2X8B B;  4OM5 A;  1KBS A;  2HLQ A;  4EY8 B;  2CTX A;  2H62 D;  3LAQ U;  1NYU A;  3U74 U;  3U73 U;  1LSI A;  4KSN A;  1IDG A;  1QKD A;  2ERA A;  3VTS A;  3PLC A;  1FAS A;  1MAH F;  4UY2 C;  2CDX A;  4XJJ A;  4FAO C;  1BXP A;  1CHV S;  2CCX A;  1NEA A;  4P7U A;  1CDT A;  1IKC A;  4BDT B;  1M9Z A;  1KS6 A;  5EBX A;  1PLO A;  1IDH A;  1JGK A;  1COD A;  2LCR A;  1CDS A;  1LX5 B;  2H64 B;  1JBD A;  2I9B E;  2PJY C;  1REW C;  1KC4 A;  2H7Z B;  2H5F A;  3QB4 B;  2CRT A;  2H62 C;  1H0J A;  1W6B A;  1ONJ A;  2PJY B;  5IMT D;  1TXB A;  2JQP A;  1HAJ A;  1I02 A;  1S4Y A;  1KTZ B;  2H8U A;  2LA1 A;  1ZAD A;  3BT1 U;  2MJ4 A;  1NTX A;  4QTI U;  1LJZ A;  3NDS A;  2OFS A;  1TGX A;  1KBT A;  1IK8 A;  3BT2 U;  2ABX A;  4FAO E;  1LXH A;  5IMY C;  1F94 A;  1ABT A;  4HQP F;  2GOO C;  1CB9 A; 
#chains in the Genus database with same CATH homology
 2GOO B;  1CDQ A;  4IYE A;  1V6P A;  1F8U B;  1ES7 B;  1BTE A;  2BTX A;  2H64 C;  1UG4 A;  1CVO A;  1YWH A;  1CCQ A;  1ERA A;  6EBX A;  1CXN A;  2H7Z A;  5DO6 A;  4BIK B;  2BHI A;  1NOR A;  1MR6 A;  3NEQ A;  1IJC A;  1LXG A;  2QC1 A;  5DZ5 A;  3KFD E;  2K3G A;  1L4W A;  3KFD I;  1JE9 A;  4LFT A;  2MFA A;  2MJY A;  2MUP A;  1COE A;  1NXB A;  1RGJ A;  2QJA C;  1IDI A;  1FFJ A;  2MUO A;  2L03 A;  2UWR A;  1CRF A;  2VLW A;  1IDL A;  1ERG A;  1HC9 A;  1HC9 B;  3EBX A;  2J8B A;  1VB0 A;  4ZQY A;  1CTX A;  1FSS B;  1CDR A;  1FSC A;  2FD6 U;  3ERA A;  1DRS A;  2L5S A;  1G6M A;  1KL8 A;  2N99 A;  1QM7 A;  1CRE A;  4OM4 A;  1KU6 B;  1QKE A;  2NBT A;  1KBA A;  5DU1 A;  2MHY A;  2MJ0 A;  2QJB C;  2UX2 A;  1RL5 A;  3FEV A;  1HAA A;  1B41 B;  3EVS C;  2CRS A;  1KFH A;  1FF4 A;  1NYS A;  1TFS A;  1CXO A;  1KXI A;  1FRA A;  1XT3 A;  3NH7 A;  4RUD A;  4DO8 A;  1TXA A;  1IQ9 A;  1HOY A;  2HLR A;  1NTN A;  4AEA A;  3HH7 A;  2QJ9 C;  2JVE A;  2X8B B;  4OM5 A;  1KBS A;  2HLQ A;  4EY8 B;  2CTX A;  2H62 D;  3LAQ U;  1NYU A;  3U74 U;  3U73 U;  1LSI A;  4KSN A;  1IDG A;  1QKD A;  2ERA A;  3VTS A;  3PLC A;  1FAS A;  1MAH F;  4UY2 C;  2CDX A;  4XJJ A;  4FAO C;  1BXP A;  1CHV S;  2CCX A;  1NEA A;  4P7U A;  1CDT A;  1IKC A;  4BDT B;  1M9Z A;  1KS6 A;  5EBX A;  1PLO A;  1IDH A;  1JGK A;  1COD A;  2LCR A;  1CDS A;  1LX5 B;  2H64 B;  1JBD A;  2I9B E;  2PJY C;  1REW C;  1KC4 A;  2H7Z B;  2H5F A;  3QB4 B;  2CRT A;  2H62 C;  1H0J A;  1W6B A;  1ONJ A;  2PJY B;  5IMT D;  1TXB A;  2JQP A;  1HAJ A;  1I02 A;  1S4Y A;  1KTZ B;  2H8U A;  2LA1 A;  1ZAD A;  3BT1 U;  2MJ4 A;  1NTX A;  4QTI U;  1LJZ A;  3NDS A;  2OFS A;  1TGX A;  1KBT A;  1IK8 A;  3BT2 U;  2ABX A;  4FAO E;  1LXH A;  5IMY C;  1F94 A;  1ABT A;  4HQP F;  2GOO C;  1CB9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...