3ERAA

Recombinant erabutoxin a (s8t mutant)
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
62
structure length
62
Chain Sequence
RICFNHQTSQPQTTKTCSPGESSCYNKQWSDFRGTIIERGCGCPTVKPGIKLSCCESEVCNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High resolution x-ray analysis of two mutants of a curaremimetic snake toxin
pubmed doi rcsb
source organism Laticauda semifasciata
molecule tags Neurotoxin
molecule keywords ERABUTOXIN A
total genus 12
structure length 62
sequence length 62
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 3eraA00
2CCXA 1NXBA 1COEA 1IDHA 4BIKB 2MHYA 5DO6A 1NTXA 1KBTA 1G6MA 2X8BB 4FAOC 1IDGA 3U73U 1IDIA 4XJJA 2LA1A 2MJ4A 4IYEA 1LXHA 1NYSA 2MFAA 2BTXA 1IKCA 2CRTA 4HQPF 1BXPA 2JVEA 4BDTB 1TGXA 2CRSA 1CRFA 2JQPA 2MJ0A 1CXNA 2H62D 1CXOA 3KFDI 5DU1A 4OM5A 2NBTA 2UX2A 2CDXA 2HLQA 3ERAA 4FAOE 1HAJA 2BHIA 2FD6U 4DO8A 1CTXA 1IJCA 3U74U 1L4WA 1S4YA 5EBXA 1PLOA 1F8UB 3KFDE 1UG4A 1KTZB 2GOOB 1ZADA 1NEAA 1KL8A 4OM4A 1W6BA 1V6PA 4QTIU 2J8BA 4ZQYA 2H5FA 2ABXA 1FFJA 1M9ZA 2OFSA 3FEVA 4AEAA 1IK8A 1TFSA 2QJBC 1REWC 3QB4B 1KC4A 2LCRA 2QJAC 1CDRA 5DZ5A 1KBSA 1JE9A 2MJYA 1QKDA 3HH7A 2H7ZB 2QC1A 2L5SA 1CCQA 2I9BE 4RUDA 1TXBA 1KU6B 1MAHF 5IMYC 1CREA 1F94A 3NEQA 4P7UA 5IMTD 1LXGA 1JGKA 1IQ9A 2H64B 1NORA 3NDSA 1DRSA 2N99A 2PJYC 3BT1U 1ERGA 1FSCA 2GOOC 1IDLA 2HLRA 2CTXA 1MR6A 1KFHA 1B41B 3EVSC 2H62C 1NYUA 2QJ9C 1I02A 1LX5B 1CDQA 4UY2C 6EBXA 1RL5A 1QM7A 2UWRA 1CDTA 1KXIA 2L03A 1KS6A 1LSIA 3PLCA 1CB9A 1LJZA 1HC9B 1CVOA 4EY8B 1QKEA 2K3GA 1CODA 1JBDA 1FRAA 1ABTA 2MUOA 3EBXA 1VB0A 3VTSA 2H8UA 2VLWA 1FSSB 1XT3A 1TXAA 3NH7A 1BTEA 1FASA 4LFTA 1CDSA 3BT2U 1ERAA 1ES7B 1H0JA 2H7ZA 1FF4A 1ONJA 1YWHA 1RGJA 1HAAA 2ERAA 1NTNA 1HOYA 2H64C 1CHVS 2PJYB 3LAQU 2MUPA 1HC9A 1KBAA
chains in the Genus database with same CATH superfamily
2CCXA 1NXBA 1COEA 1IDHA 4BIKB 2MHYA 5DO6A 1NTXA 1KBTA 1G6MA 2X8BB 4FAOC 1IDGA 3U73U 1IDIA 4XJJA 2LA1A 2MJ4A 4IYEA 1LXHA 1NYSA 2MFAA 2BTXA 1IKCA 2CRTA 4HQPF 1BXPA 2JVEA 4BDTB 1TGXA 2CRSA 1CRFA 2JQPA 2MJ0A 1CXNA 2H62D 1CXOA 3KFDI 5DU1A 4OM5A 2NBTA 2UX2A 2CDXA 2HLQA 3ERAA 4FAOE 1HAJA 2BHIA 2FD6U 4DO8A 1CTXA 1IJCA 3U74U 1L4WA 1S4YA 5EBXA 1PLOA 1F8UB 3KFDE 1UG4A 1KTZB 2GOOB 1ZADA 1NEAA 1KL8A 4OM4A 1W6BA 1V6PA 4QTIU 2J8BA 4ZQYA 2H5FA 2ABXA 1FFJA 1M9ZA 2OFSA 3FEVA 4AEAA 1IK8A 1TFSA 2QJBC 1REWC 3QB4B 1KC4A 2LCRA 2QJAC 1CDRA 5DZ5A 1KBSA 1JE9A 2MJYA 1QKDA 3HH7A 2H7ZB 2QC1A 2L5SA 1CCQA 2I9BE 4RUDA 1TXBA 1KU6B 1MAHF 5IMYC 1CREA 1F94A 3NEQA 4P7UA 5IMTD 1LXGA 1JGKA 1IQ9A 2H64B 1NORA 3NDSA 1DRSA 2N99A 2PJYC 3BT1U 1ERGA 1FSCA 2GOOC 1IDLA 2HLRA 2CTXA 1MR6A 1KFHA 1B41B 3EVSC 2H62C 1NYUA 2QJ9C 1I02A 1LX5B 1CDQA 4UY2C 6EBXA 1RL5A 1QM7A 2UWRA 1CDTA 1KXIA 2L03A 1KS6A 1LSIA 3PLCA 1CB9A 1LJZA 1HC9B 1CVOA 4EY8B 1QKEA 2K3GA 1CODA 1JBDA 1FRAA 1ABTA 2MUOA 3EBXA 1VB0A 3VTSA 4KSNA 2H8UA 2VLWA 1FSSB 1XT3A 1TXAA 3NH7A 1BTEA 1FASA 4LFTA 1CDSA 3BT2U 1ERAA 1ES7B 1H0JA 2H7ZA 1FF4A 1ONJA 1YWHA 1RGJA 1HAAA 2ERAA 1NTNA 1HOYA 2H64C 1CHVS 2PJYB 3LAQU 2MUPA 1HC9A 1KBAA
chains in the Genus database with same CATH topology
2CCXA 1NXBA 1COEA 1IDHA 4BIKB 2MHYA 5DO6A 1NTXA 1KBTA 1G6MA 2X8BB 4FAOC 1IDGA 3U73U 1IDIA 4XJJA 2LA1A 2MJ4A 4IYEA 1LXHA 1NYSA 2MFAA 2BTXA 1IKCA 2CRTA 4HQPF 1BXPA 2JVEA 4BDTB 1TGXA 2CRSA 1CRFA 2JQPA 2MJ0A 1CXNA 2H62D 1CXOA 3KFDI 5DU1A 4OM5A 2NBTA 2UX2A 2CDXA 2HLQA 3ERAA 4FAOE 1HAJA 2BHIA 2FD6U 4DO8A 1CTXA 1IJCA 3U74U 1L4WA 1S4YA 5EBXA 1PLOA 1F8UB 3KFDE 1UG4A 1KTZB 2GOOB 1ZADA 1NEAA 1KL8A 4OM4A 1W6BA 1V6PA 4QTIU 2J8BA 4ZQYA 2H5FA 2ABXA 1FFJA 1M9ZA 2OFSA 3FEVA 4AEAA 1IK8A 1TFSA 2QJBC 1REWC 3QB4B 1KC4A 2LCRA 2QJAC 1CDRA 5DZ5A 1KBSA 1JE9A 2MJYA 1QKDA 3HH7A 2H7ZB 2QC1A 2L5SA 1CCQA 2I9BE 4RUDA 1TXBA 1KU6B 1MAHF 5IMYC 1CREA 1F94A 3NEQA 4P7UA 5IMTD 1LXGA 1JGKA 1IQ9A 2H64B 1NORA 3NDSA 1DRSA 2N99A 2PJYC 3BT1U 1ERGA 1FSCA 2GOOC 1IDLA 2HLRA 2CTXA 1MR6A 1KFHA 1B41B 3EVSC 2H62C 1NYUA 2QJ9C 1I02A 1LX5B 1CDQA 4UY2C 6EBXA 1RL5A 1QM7A 2UWRA 1CDTA 1KXIA 2L03A 1KS6A 1LSIA 3PLCA 1CB9A 1LJZA 1HC9B 1CVOA 4EY8B 1QKEA 2K3GA 1CODA 1JBDA 1FRAA 1ABTA 2MUOA 3EBXA 1VB0A 3VTSA 4KSNA 2H8UA 2VLWA 1FSSB 1XT3A 1TXAA 3NH7A 1BTEA 1FASA 4LFTA 1CDSA 3BT2U 1ERAA 1ES7B 1H0JA 2H7ZA 1FF4A 1ONJA 1YWHA 1RGJA 1HAAA 2ERAA 1NTNA 1HOYA 2H64C 1CHVS 2PJYB 3LAQU 2MUPA 1HC9A 1KBAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CCX A;  1NXB A;  1COE A;  1IDH A;  4BIK B;  2MHY A;  5DO6 A;  1NTX A;  1KBT A;  1G6M A;  2X8B B;  4FAO C;  1IDG A;  3U73 U;  1IDI A;  4XJJ A;  2LA1 A;  2MJ4 A;  4IYE A;  1LXH A;  1NYS A;  2MFA A;  2BTX A;  1IKC A;  2CRT A;  4HQP F;  1BXP A;  2JVE A;  4BDT B;  1TGX A;  2CRS A;  1CRF A;  2JQP A;  2MJ0 A;  1CXN A;  2H62 D;  1CXO A;  3KFD I;  5DU1 A;  4OM5 A;  2NBT A;  2UX2 A;  2CDX A;  2HLQ A;  3ERA A;  4FAO E;  1HAJ A;  2BHI A;  2FD6 U;  4DO8 A;  1CTX A;  1IJC A;  3U74 U;  1L4W A;  1S4Y A;  5EBX A;  1PLO A;  1F8U B;  3KFD E;  1UG4 A;  1KTZ B;  2GOO B;  1ZAD A;  1NEA A;  1KL8 A;  4OM4 A;  1W6B A;  1V6P A;  4QTI U;  2J8B A;  4ZQY A;  2H5F A;  2ABX A;  1FFJ A;  1M9Z A;  2OFS A;  3FEV A;  4AEA A;  1IK8 A;  1TFS A;  2QJB C;  1REW C;  3QB4 B;  1KC4 A;  2LCR A;  2QJA C;  1CDR A;  5DZ5 A;  1KBS A;  1JE9 A;  2MJY A;  1QKD A;  3HH7 A;  2H7Z B;  2QC1 A;  2L5S A;  1CCQ A;  2I9B E;  4RUD A;  1TXB A;  1KU6 B;  1MAH F;  5IMY C;  1CRE A;  1F94 A;  3NEQ A;  4P7U A;  5IMT D;  1LXG A;  1JGK A;  1IQ9 A;  2H64 B;  1NOR A;  3NDS A;  1DRS A;  2N99 A;  2PJY C;  3BT1 U;  1ERG A;  1FSC A;  2GOO C;  1IDL A;  2HLR A;  2CTX A;  1MR6 A;  1KFH A;  1B41 B;  3EVS C;  2H62 C;  1NYU A;  2QJ9 C;  1I02 A;  1LX5 B;  1CDQ A;  4UY2 C;  6EBX A;  1RL5 A;  1QM7 A;  2UWR A;  1CDT A;  1KXI A;  2L03 A;  1KS6 A;  1LSI A;  3PLC A;  1CB9 A;  1LJZ A;  1HC9 B;  1CVO A;  4EY8 B;  1QKE A;  2K3G A;  1COD A;  1JBD A;  1FRA A;  1ABT A;  2MUO A;  3EBX A;  1VB0 A;  3VTS A;  2H8U A;  2VLW A;  1FSS B;  1XT3 A;  1TXA A;  3NH7 A;  1BTE A;  1FAS A;  4LFT A;  1CDS A;  3BT2 U;  1ERA A;  1ES7 B;  1H0J A;  2H7Z A;  1FF4 A;  1ONJ A;  1YWH A;  1RGJ A;  1HAA A;  2ERA A;  1NTN A;  1HOY A;  2H64 C;  1CHV S;  2PJY B;  3LAQ U;  2MUP A;  1HC9 A;  1KBA A; 
#chains in the Genus database with same CATH topology
 2CCX A;  1NXB A;  1COE A;  1IDH A;  4BIK B;  2MHY A;  5DO6 A;  1NTX A;  1KBT A;  1G6M A;  2X8B B;  4FAO C;  1IDG A;  3U73 U;  1IDI A;  4XJJ A;  2LA1 A;  2MJ4 A;  4IYE A;  1LXH A;  1NYS A;  2MFA A;  2BTX A;  1IKC A;  2CRT A;  4HQP F;  1BXP A;  2JVE A;  4BDT B;  1TGX A;  2CRS A;  1CRF A;  2JQP A;  2MJ0 A;  1CXN A;  2H62 D;  1CXO A;  3KFD I;  5DU1 A;  4OM5 A;  2NBT A;  2UX2 A;  2CDX A;  2HLQ A;  3ERA A;  4FAO E;  1HAJ A;  2BHI A;  2FD6 U;  4DO8 A;  1CTX A;  1IJC A;  3U74 U;  1L4W A;  1S4Y A;  5EBX A;  1PLO A;  1F8U B;  3KFD E;  1UG4 A;  1KTZ B;  2GOO B;  1ZAD A;  1NEA A;  1KL8 A;  4OM4 A;  1W6B A;  1V6P A;  4QTI U;  2J8B A;  4ZQY A;  2H5F A;  2ABX A;  1FFJ A;  1M9Z A;  2OFS A;  3FEV A;  4AEA A;  1IK8 A;  1TFS A;  2QJB C;  1REW C;  3QB4 B;  1KC4 A;  2LCR A;  2QJA C;  1CDR A;  5DZ5 A;  1KBS A;  1JE9 A;  2MJY A;  1QKD A;  3HH7 A;  2H7Z B;  2QC1 A;  2L5S A;  1CCQ A;  2I9B E;  4RUD A;  1TXB A;  1KU6 B;  1MAH F;  5IMY C;  1CRE A;  1F94 A;  3NEQ A;  4P7U A;  5IMT D;  1LXG A;  1JGK A;  1IQ9 A;  2H64 B;  1NOR A;  3NDS A;  1DRS A;  2N99 A;  2PJY C;  3BT1 U;  1ERG A;  1FSC A;  2GOO C;  1IDL A;  2HLR A;  2CTX A;  1MR6 A;  1KFH A;  1B41 B;  3EVS C;  2H62 C;  1NYU A;  2QJ9 C;  1I02 A;  1LX5 B;  1CDQ A;  4UY2 C;  6EBX A;  1RL5 A;  1QM7 A;  2UWR A;  1CDT A;  1KXI A;  2L03 A;  1KS6 A;  1LSI A;  3PLC A;  1CB9 A;  1LJZ A;  1HC9 B;  1CVO A;  4EY8 B;  1QKE A;  2K3G A;  1COD A;  1JBD A;  1FRA A;  1ABT A;  2MUO A;  3EBX A;  1VB0 A;  3VTS A;  4KSN A;  2H8U A;  2VLW A;  1FSS B;  1XT3 A;  1TXA A;  3NH7 A;  1BTE A;  1FAS A;  4LFT A;  1CDS A;  3BT2 U;  1ERA A;  1ES7 B;  1H0J A;  2H7Z A;  1FF4 A;  1ONJ A;  1YWH A;  1RGJ A;  1HAA A;  2ERA A;  1NTN A;  1HOY A;  2H64 C;  1CHV S;  2PJY B;  3LAQ U;  2MUP A;  1HC9 A;  1KBA A; 
#chains in the Genus database with same CATH homology
 2CCX A;  1NXB A;  1COE A;  1IDH A;  4BIK B;  2MHY A;  5DO6 A;  1NTX A;  1KBT A;  1G6M A;  2X8B B;  4FAO C;  1IDG A;  3U73 U;  1IDI A;  4XJJ A;  2LA1 A;  2MJ4 A;  4IYE A;  1LXH A;  1NYS A;  2MFA A;  2BTX A;  1IKC A;  2CRT A;  4HQP F;  1BXP A;  2JVE A;  4BDT B;  1TGX A;  2CRS A;  1CRF A;  2JQP A;  2MJ0 A;  1CXN A;  2H62 D;  1CXO A;  3KFD I;  5DU1 A;  4OM5 A;  2NBT A;  2UX2 A;  2CDX A;  2HLQ A;  3ERA A;  4FAO E;  1HAJ A;  2BHI A;  2FD6 U;  4DO8 A;  1CTX A;  1IJC A;  3U74 U;  1L4W A;  1S4Y A;  5EBX A;  1PLO A;  1F8U B;  3KFD E;  1UG4 A;  1KTZ B;  2GOO B;  1ZAD A;  1NEA A;  1KL8 A;  4OM4 A;  1W6B A;  1V6P A;  4QTI U;  2J8B A;  4ZQY A;  2H5F A;  2ABX A;  1FFJ A;  1M9Z A;  2OFS A;  3FEV A;  4AEA A;  1IK8 A;  1TFS A;  2QJB C;  1REW C;  3QB4 B;  1KC4 A;  2LCR A;  2QJA C;  1CDR A;  5DZ5 A;  1KBS A;  1JE9 A;  2MJY A;  1QKD A;  3HH7 A;  2H7Z B;  2QC1 A;  2L5S A;  1CCQ A;  2I9B E;  4RUD A;  1TXB A;  1KU6 B;  1MAH F;  5IMY C;  1CRE A;  1F94 A;  3NEQ A;  4P7U A;  5IMT D;  1LXG A;  1JGK A;  1IQ9 A;  2H64 B;  1NOR A;  3NDS A;  1DRS A;  2N99 A;  2PJY C;  3BT1 U;  1ERG A;  1FSC A;  2GOO C;  1IDL A;  2HLR A;  2CTX A;  1MR6 A;  1KFH A;  1B41 B;  3EVS C;  2H62 C;  1NYU A;  2QJ9 C;  1I02 A;  1LX5 B;  1CDQ A;  4UY2 C;  6EBX A;  1RL5 A;  1QM7 A;  2UWR A;  1CDT A;  1KXI A;  2L03 A;  1KS6 A;  1LSI A;  3PLC A;  1CB9 A;  1LJZ A;  1HC9 B;  1CVO A;  4EY8 B;  1QKE A;  2K3G A;  1COD A;  1JBD A;  1FRA A;  1ABT A;  2MUO A;  3EBX A;  1VB0 A;  3VTS A;  4KSN A;  2H8U A;  2VLW A;  1FSS B;  1XT3 A;  1TXA A;  3NH7 A;  1BTE A;  1FAS A;  4LFT A;  1CDS A;  3BT2 U;  1ERA A;  1ES7 B;  1H0J A;  2H7Z A;  1FF4 A;  1ONJ A;  1YWH A;  1RGJ A;  1HAA A;  2ERA A;  1NTN A;  1HOY A;  2H64 C;  1CHV S;  2PJY B;  3LAQ U;  2MUP A;  1HC9 A;  1KBA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...