3ERAA

Recombinant erabutoxin a (s8t mutant)
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
62
structure length
62
Chain Sequence
RICFNHQTSQPQTTKTCSPGESSCYNKQWSDFRGTIIERGCGCPTVKPGIKLSCCESEVCNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Neurotoxin
molecule keywords ERABUTOXIN A
publication title High resolution x-ray analysis of two mutants of a curaremimetic snake toxin
pubmed doi rcsb
source organism Laticauda semifasciata
total genus 12
structure length 62
sequence length 62
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 3eraA00
1I02A 4FAOC 2LCRA 1IDGA 1KXIA 3LAQU 4XJJA 3VTSA 3EBXA 2UX2A 2QJBC 3EVSC 1ABTA 1CDSA 1JGKA 1LX5B 1RGJA 2HLRA 2MJYA 1KBTA 4AEAA 1KBSA 3NEQA 1NEAA 4ZQYA 2QJ9C 2N99A 5IMTD 1CVOA 3NDSA 2H62D 1IDIA 2MFAA 1BTEA 1HOYA 2J8BA 1HAAA 3BT1U 3PLCA 1UG4A 2CRSA 1HC9A 2H64B 2HLQA 1IQ9A 1L4WA 1VB0A 2H64C 2FD6U 1IJCA 1CXOA 1LXGA 1CDTA 2H7ZA 5IMYC 1HAJA 5DU1A 1KL8A 1NXBA 4FAOE 2L03A 2MUPA 1IDHA 1G6MA 1CCQA 1F94A 2H62C 4HQPF 2X8BB 1FASA 1NYUA 1FSSB 2L5SA 1FFJA 1B41B 2BTXA 1MR6A 1CB9A 3BT2U 1LXHA 2MUOA 1TXAA 1COEA 2JVEA 3NH7A 5DO6A 1M9ZA 2I9BE 1CRFA 2CTXA 1CXNA 1ZADA 2QC1A 3U73U 1CHVS 3FEVA 1QKDA 2BHIA 1CREA 1FF4A 1KU6B 6EBXA 2QJAC 1KC4A 1YWHA 1IK8A 2MJ0A 1CTXA 4QTIU 1FSCA 4UY2C 1JBDA 1MAHF 3ERAA 2H5FA 4BDTB 2H8UA 4OM5A 4DO8A 2VLWA 1XT3A 1QKEA 2CDXA 1V6PA 1IKCA 4OM4A 1TGXA 1S4YA 1ONJA 1CODA 1FRAA 1KBAA 2GOOB 4IYEA 3HH7A 4BIKB 1LJZA 2GOOC 2LA1A 1BXPA 1JE9A 1CDRA 1DRSA 1IDLA 1KS6A 1NTNA 2MJ4A 1HC9B 4RUDA 2JQPA 2ABXA 1F8UB 2CCXA 1CDQA 1NTXA 2H7ZB 2K3GA 3QB4B 3KFDE 2OFSA 2UWRA 1KTZB 1H0JA 1PLOA 2MHYA 1TXBA 1QM7A 4LFTA 4EY8B 1NORA 3U74U 5EBXA 1TFSA 2NBTA 2ERAA 4P7UA 1ERGA 1KFHA 5DZ5A 2PJYB 1NYSA 3KFDI 1REWC 1LSIA 2PJYC 2CRTA 1ES7B 1ERAA 1W6BA 1RL5A
chains in the Genus database with same CATH superfamily
1I02A 4FAOC 2LCRA 1IDGA 1KXIA 3LAQU 4XJJA 3VTSA 3EBXA 2UX2A 2QJBC 3EVSC 1ABTA 1CDSA 1JGKA 1LX5B 1RGJA 2HLRA 2MJYA 1KBTA 4AEAA 1KBSA 3NEQA 1NEAA 4ZQYA 2QJ9C 2N99A 5IMTD 1CVOA 3NDSA 2H62D 1IDIA 2MFAA 1BTEA 1HOYA 2J8BA 1HAAA 3BT1U 3PLCA 1UG4A 2CRSA 1HC9A 2H64B 2HLQA 1IQ9A 1L4WA 1VB0A 2H64C 2FD6U 1IJCA 1CXOA 1LXGA 1CDTA 2H7ZA 5IMYC 1HAJA 5DU1A 1KL8A 1NXBA 4FAOE 2L03A 2MUPA 1IDHA 1G6MA 1CCQA 1F94A 2H62C 4HQPF 2X8BB 1FASA 1NYUA 1FSSB 2L5SA 1FFJA 1B41B 2BTXA 1MR6A 1CB9A 3BT2U 1LXHA 2MUOA 1TXAA 1COEA 2JVEA 3NH7A 5DO6A 4KSNA 1M9ZA 2I9BE 1CRFA 2CTXA 1CXNA 1ZADA 2QC1A 3U73U 1CHVS 3FEVA 1QKDA 2BHIA 1CREA 1FF4A 1KU6B 6EBXA 2QJAC 1KC4A 1YWHA 1IK8A 2MJ0A 1CTXA 4QTIU 1FSCA 4UY2C 1JBDA 1MAHF 3ERAA 2H5FA 4BDTB 2H8UA 4OM5A 4DO8A 2VLWA 1XT3A 1QKEA 2CDXA 1V6PA 1IKCA 4OM4A 1TGXA 1S4YA 1ONJA 1CODA 1FRAA 1KBAA 2GOOB 4IYEA 3HH7A 4BIKB 1LJZA 2GOOC 2LA1A 1BXPA 1JE9A 1CDRA 1DRSA 1IDLA 1KS6A 1NTNA 2MJ4A 1HC9B 4RUDA 2JQPA 2ABXA 1F8UB 2CCXA 1CDQA 1NTXA 2H7ZB 2K3GA 3QB4B 3KFDE 2OFSA 2UWRA 1KTZB 1H0JA 1PLOA 2MHYA 1TXBA 1QM7A 4LFTA 4EY8B 1NORA 3U74U 5EBXA 1TFSA 2NBTA 2ERAA 4P7UA 1ERGA 1KFHA 5DZ5A 2PJYB 1NYSA 3KFDI 1REWC 1LSIA 2PJYC 2CRTA 1ES7B 1ERAA 1W6BA 1RL5A
chains in the Genus database with same CATH topology
1I02A 4FAOC 2LCRA 1IDGA 1KXIA 3LAQU 4XJJA 3VTSA 3EBXA 2UX2A 2QJBC 3EVSC 1ABTA 1CDSA 1JGKA 1LX5B 1RGJA 2HLRA 2MJYA 1KBTA 4AEAA 1KBSA 3NEQA 1NEAA 4ZQYA 2QJ9C 2N99A 5IMTD 1CVOA 3NDSA 2H62D 1IDIA 2MFAA 1BTEA 1HOYA 2J8BA 1HAAA 3BT1U 3PLCA 1UG4A 2CRSA 1HC9A 2H64B 2HLQA 1IQ9A 1L4WA 1VB0A 2H64C 2FD6U 1IJCA 1CXOA 1LXGA 1CDTA 2H7ZA 5IMYC 1HAJA 5DU1A 1KL8A 1NXBA 4FAOE 2L03A 2MUPA 1IDHA 1G6MA 1CCQA 1F94A 2H62C 4HQPF 2X8BB 1FASA 1NYUA 1FSSB 2L5SA 1FFJA 1B41B 2BTXA 1MR6A 1CB9A 3BT2U 1LXHA 2MUOA 1TXAA 1COEA 2JVEA 3NH7A 5DO6A 4KSNA 1M9ZA 2I9BE 1CRFA 2CTXA 1CXNA 1ZADA 2QC1A 3U73U 1CHVS 3FEVA 1QKDA 2BHIA 1CREA 1FF4A 1KU6B 6EBXA 2QJAC 1KC4A 1YWHA 1IK8A 2MJ0A 1CTXA 4QTIU 1FSCA 4UY2C 1JBDA 1MAHF 3ERAA 2H5FA 4BDTB 2H8UA 4OM5A 4DO8A 2VLWA 1XT3A 1QKEA 2CDXA 1V6PA 1IKCA 4OM4A 1TGXA 1S4YA 1ONJA 1CODA 1FRAA 1KBAA 2GOOB 4IYEA 3HH7A 4BIKB 1LJZA 2GOOC 2LA1A 1BXPA 1JE9A 1CDRA 1DRSA 1IDLA 1KS6A 1NTNA 2MJ4A 1HC9B 4RUDA 2JQPA 2ABXA 1F8UB 2CCXA 1CDQA 1NTXA 2H7ZB 2K3GA 3QB4B 3KFDE 2OFSA 2UWRA 1KTZB 1H0JA 1PLOA 2MHYA 1TXBA 1QM7A 4LFTA 4EY8B 1NORA 3U74U 5EBXA 1TFSA 2NBTA 2ERAA 4P7UA 1ERGA 1KFHA 5DZ5A 2PJYB 1NYSA 3KFDI 1REWC 1LSIA 2PJYC 2CRTA 1ES7B 1ERAA 1W6BA 1RL5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I02 A;  4FAO C;  2LCR A;  1IDG A;  1KXI A;  3LAQ U;  4XJJ A;  3VTS A;  3EBX A;  2UX2 A;  2QJB C;  3EVS C;  1ABT A;  1CDS A;  1JGK A;  1LX5 B;  1RGJ A;  2HLR A;  2MJY A;  1KBT A;  4AEA A;  1KBS A;  3NEQ A;  1NEA A;  4ZQY A;  2QJ9 C;  2N99 A;  5IMT D;  1CVO A;  3NDS A;  2H62 D;  1IDI A;  2MFA A;  1BTE A;  1HOY A;  2J8B A;  1HAA A;  3BT1 U;  3PLC A;  1UG4 A;  2CRS A;  1HC9 A;  2H64 B;  2HLQ A;  1IQ9 A;  1L4W A;  1VB0 A;  2H64 C;  2FD6 U;  1IJC A;  1CXO A;  1LXG A;  1CDT A;  2H7Z A;  5IMY C;  1HAJ A;  5DU1 A;  1KL8 A;  1NXB A;  4FAO E;  2L03 A;  2MUP A;  1IDH A;  1G6M A;  1CCQ A;  1F94 A;  2H62 C;  4HQP F;  2X8B B;  1FAS A;  1NYU A;  1FSS B;  2L5S A;  1FFJ A;  1B41 B;  2BTX A;  1MR6 A;  1CB9 A;  3BT2 U;  1LXH A;  2MUO A;  1TXA A;  1COE A;  2JVE A;  3NH7 A;  5DO6 A;  1M9Z A;  2I9B E;  1CRF A;  2CTX A;  1CXN A;  1ZAD A;  2QC1 A;  3U73 U;  1CHV S;  3FEV A;  1QKD A;  2BHI A;  1CRE A;  1FF4 A;  1KU6 B;  6EBX A;  2QJA C;  1KC4 A;  1YWH A;  1IK8 A;  2MJ0 A;  1CTX A;  4QTI U;  1FSC A;  4UY2 C;  1JBD A;  1MAH F;  3ERA A;  2H5F A;  4BDT B;  2H8U A;  4OM5 A;  4DO8 A;  2VLW A;  1XT3 A;  1QKE A;  2CDX A;  1V6P A;  1IKC A;  4OM4 A;  1TGX A;  1S4Y A;  1ONJ A;  1COD A;  1FRA A;  1KBA A;  2GOO B;  4IYE A;  3HH7 A;  4BIK B;  1LJZ A;  2GOO C;  2LA1 A;  1BXP A;  1JE9 A;  1CDR A;  1DRS A;  1IDL A;  1KS6 A;  1NTN A;  2MJ4 A;  1HC9 B;  4RUD A;  2JQP A;  2ABX A;  1F8U B;  2CCX A;  1CDQ A;  1NTX A;  2H7Z B;  2K3G A;  3QB4 B;  3KFD E;  2OFS A;  2UWR A;  1KTZ B;  1H0J A;  1PLO A;  2MHY A;  1TXB A;  1QM7 A;  4LFT A;  4EY8 B;  1NOR A;  3U74 U;  5EBX A;  1TFS A;  2NBT A;  2ERA A;  4P7U A;  1ERG A;  1KFH A;  5DZ5 A;  2PJY B;  1NYS A;  3KFD I;  1REW C;  1LSI A;  2PJY C;  2CRT A;  1ES7 B;  1ERA A;  1W6B A;  1RL5 A; 
#chains in the Genus database with same CATH topology
 1I02 A;  4FAO C;  2LCR A;  1IDG A;  1KXI A;  3LAQ U;  4XJJ A;  3VTS A;  3EBX A;  2UX2 A;  2QJB C;  3EVS C;  1ABT A;  1CDS A;  1JGK A;  1LX5 B;  1RGJ A;  2HLR A;  2MJY A;  1KBT A;  4AEA A;  1KBS A;  3NEQ A;  1NEA A;  4ZQY A;  2QJ9 C;  2N99 A;  5IMT D;  1CVO A;  3NDS A;  2H62 D;  1IDI A;  2MFA A;  1BTE A;  1HOY A;  2J8B A;  1HAA A;  3BT1 U;  3PLC A;  1UG4 A;  2CRS A;  1HC9 A;  2H64 B;  2HLQ A;  1IQ9 A;  1L4W A;  1VB0 A;  2H64 C;  2FD6 U;  1IJC A;  1CXO A;  1LXG A;  1CDT A;  2H7Z A;  5IMY C;  1HAJ A;  5DU1 A;  1KL8 A;  1NXB A;  4FAO E;  2L03 A;  2MUP A;  1IDH A;  1G6M A;  1CCQ A;  1F94 A;  2H62 C;  4HQP F;  2X8B B;  1FAS A;  1NYU A;  1FSS B;  2L5S A;  1FFJ A;  1B41 B;  2BTX A;  1MR6 A;  1CB9 A;  3BT2 U;  1LXH A;  2MUO A;  1TXA A;  1COE A;  2JVE A;  3NH7 A;  5DO6 A;  4KSN A;  1M9Z A;  2I9B E;  1CRF A;  2CTX A;  1CXN A;  1ZAD A;  2QC1 A;  3U73 U;  1CHV S;  3FEV A;  1QKD A;  2BHI A;  1CRE A;  1FF4 A;  1KU6 B;  6EBX A;  2QJA C;  1KC4 A;  1YWH A;  1IK8 A;  2MJ0 A;  1CTX A;  4QTI U;  1FSC A;  4UY2 C;  1JBD A;  1MAH F;  3ERA A;  2H5F A;  4BDT B;  2H8U A;  4OM5 A;  4DO8 A;  2VLW A;  1XT3 A;  1QKE A;  2CDX A;  1V6P A;  1IKC A;  4OM4 A;  1TGX A;  1S4Y A;  1ONJ A;  1COD A;  1FRA A;  1KBA A;  2GOO B;  4IYE A;  3HH7 A;  4BIK B;  1LJZ A;  2GOO C;  2LA1 A;  1BXP A;  1JE9 A;  1CDR A;  1DRS A;  1IDL A;  1KS6 A;  1NTN A;  2MJ4 A;  1HC9 B;  4RUD A;  2JQP A;  2ABX A;  1F8U B;  2CCX A;  1CDQ A;  1NTX A;  2H7Z B;  2K3G A;  3QB4 B;  3KFD E;  2OFS A;  2UWR A;  1KTZ B;  1H0J A;  1PLO A;  2MHY A;  1TXB A;  1QM7 A;  4LFT A;  4EY8 B;  1NOR A;  3U74 U;  5EBX A;  1TFS A;  2NBT A;  2ERA A;  4P7U A;  1ERG A;  1KFH A;  5DZ5 A;  2PJY B;  1NYS A;  3KFD I;  1REW C;  1LSI A;  2PJY C;  2CRT A;  1ES7 B;  1ERA A;  1W6B A;  1RL5 A; 
#chains in the Genus database with same CATH homology
 1I02 A;  4FAO C;  2LCR A;  1IDG A;  1KXI A;  3LAQ U;  4XJJ A;  3VTS A;  3EBX A;  2UX2 A;  2QJB C;  3EVS C;  1ABT A;  1CDS A;  1JGK A;  1LX5 B;  1RGJ A;  2HLR A;  2MJY A;  1KBT A;  4AEA A;  1KBS A;  3NEQ A;  1NEA A;  4ZQY A;  2QJ9 C;  2N99 A;  5IMT D;  1CVO A;  3NDS A;  2H62 D;  1IDI A;  2MFA A;  1BTE A;  1HOY A;  2J8B A;  1HAA A;  3BT1 U;  3PLC A;  1UG4 A;  2CRS A;  1HC9 A;  2H64 B;  2HLQ A;  1IQ9 A;  1L4W A;  1VB0 A;  2H64 C;  2FD6 U;  1IJC A;  1CXO A;  1LXG A;  1CDT A;  2H7Z A;  5IMY C;  1HAJ A;  5DU1 A;  1KL8 A;  1NXB A;  4FAO E;  2L03 A;  2MUP A;  1IDH A;  1G6M A;  1CCQ A;  1F94 A;  2H62 C;  4HQP F;  2X8B B;  1FAS A;  1NYU A;  1FSS B;  2L5S A;  1FFJ A;  1B41 B;  2BTX A;  1MR6 A;  1CB9 A;  3BT2 U;  1LXH A;  2MUO A;  1TXA A;  1COE A;  2JVE A;  3NH7 A;  5DO6 A;  4KSN A;  1M9Z A;  2I9B E;  1CRF A;  2CTX A;  1CXN A;  1ZAD A;  2QC1 A;  3U73 U;  1CHV S;  3FEV A;  1QKD A;  2BHI A;  1CRE A;  1FF4 A;  1KU6 B;  6EBX A;  2QJA C;  1KC4 A;  1YWH A;  1IK8 A;  2MJ0 A;  1CTX A;  4QTI U;  1FSC A;  4UY2 C;  1JBD A;  1MAH F;  3ERA A;  2H5F A;  4BDT B;  2H8U A;  4OM5 A;  4DO8 A;  2VLW A;  1XT3 A;  1QKE A;  2CDX A;  1V6P A;  1IKC A;  4OM4 A;  1TGX A;  1S4Y A;  1ONJ A;  1COD A;  1FRA A;  1KBA A;  2GOO B;  4IYE A;  3HH7 A;  4BIK B;  1LJZ A;  2GOO C;  2LA1 A;  1BXP A;  1JE9 A;  1CDR A;  1DRS A;  1IDL A;  1KS6 A;  1NTN A;  2MJ4 A;  1HC9 B;  4RUD A;  2JQP A;  2ABX A;  1F8U B;  2CCX A;  1CDQ A;  1NTX A;  2H7Z B;  2K3G A;  3QB4 B;  3KFD E;  2OFS A;  2UWR A;  1KTZ B;  1H0J A;  1PLO A;  2MHY A;  1TXB A;  1QM7 A;  4LFT A;  4EY8 B;  1NOR A;  3U74 U;  5EBX A;  1TFS A;  2NBT A;  2ERA A;  4P7U A;  1ERG A;  1KFH A;  5DZ5 A;  2PJY B;  1NYS A;  3KFD I;  1REW C;  1LSI A;  2PJY C;  2CRT A;  1ES7 B;  1ERA A;  1W6B A;  1RL5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...