1QKEA

Erabutoxin
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
62
structure length
62
Chain Sequence
RICFNHQSSQPQTTKTCSPGESSCYNKQWSDFRGTIIERGCGCPTVKPGIKLSCCESEVCNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of dimeric and monomeric erabutoxin a refined at 1.5 A resolution.
pubmed doi rcsb
molecule keywords ERABUTOXIN A
molecule tags Neurotoxin
total genus 14
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 1998-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1qkeA00
2I9BE 1FF4A 1LXGA 2H62D 1LSIA 4ZQYA 1KBAA 1I02A 2H62C 1CREA 1LX5B 3LAQU 3KFDE 2CRTA 1W6BA 1YWHA 4OM5A 4HQPF 3FEVA 5EBXA 1TGXA 1KXIA 1M9ZA 2CTXA 4FAOE 1B41B 1ERAA 1V6PA 1KFHA 1L4WA 1HC9A 1PLOA 1QKEA 3HH7A 1CXOA 2L03A 1VB0A 2HLQA 2MJYA 2LA1A 1FSCA 2MUPA 2BHIA 4IYEA 4OM4A 1DRSA 2LCRA 1LXHA 1F94A 2JVEA 4XJJA 1RL5A 3QB4B 1NTNA 2UX2A 1IDLA 1NTXA 1BTEA 1CDQA 2VLWA 1IKCA 1NYUA 4LFTA 1KBTA 1REWC 2H5FA 1CDRA 2N99A 4AEAA 4BIKB 1G6MA 1HOYA 1FASA 1RGJA 3BT1U 1JBDA 3U73U 1H0JA 3EVSC 3BT2U 1QM7A 2NBTA 1F8UB 1KS6A 2K3GA 1BXPA 1FSSB 1IJCA 1FRAA 2PJYB 2QJBC 1ES7B 2H7ZA 3EBXA 1IDHA 1JGKA 3NH7A 1NYSA 1MAHF 3NEQA 1CDSA 1ABTA 1LJZA 3VTSA 2CDXA 3ERAA 1CB9A 2HLRA 5DZ5A 4DO8A 4BDTB 1IDIA 1CDTA 1CODA 4UY2C 4EY8B 1S4YA 5IMTD 6EBXA 1ONJA 1CVOA 2GOOB 2MUOA 1MR6A 2PJYC 4P7UA 2QJAC 1KBSA 2BTXA 1NORA 1CCQA 1CTXA 1IQ9A 5IMYC 2QC1A 1HC9B 3NDSA 1FFJA 1CXNA 2MJ4A 1TXBA 4RUDA 2H7ZB 1NXBA 2FD6U 1UG4A 2JQPA 2X8BB 1KC4A 1TFSA 3KFDI 2GOOC 2J8BA 5DO6A 2H64B 2QJ9C 2OFSA 2MJ0A 2ABXA 1CHVS 1KTZB 2CCXA 1IK8A 1ERGA 1KL8A 3U74U 1COEA 4FAOC 1TXAA 5DU1A 1HAAA 1IDGA 1NEAA 1ZADA 2MFAA 2UWRA 4QTIU 1JE9A 1QKDA 1CRFA 2H8UA 2MHYA 1XT3A 3PLCA 1KU6B 2L5SA 2ERAA 2CRSA 1HAJA 2H64C
chains in the Genus database with same CATH superfamily
2I9BE 1FF4A 1LXGA 2H62D 1LSIA 4ZQYA 1KBAA 1I02A 2H62C 1CREA 1LX5B 3LAQU 3KFDE 2CRTA 1W6BA 1YWHA 4OM5A 4HQPF 3FEVA 5EBXA 1TGXA 1KXIA 1M9ZA 2CTXA 4FAOE 1B41B 1ERAA 1V6PA 1KFHA 1L4WA 1HC9A 1PLOA 1QKEA 3HH7A 1CXOA 2L03A 1VB0A 2HLQA 2MJYA 2LA1A 1FSCA 2MUPA 2BHIA 4IYEA 4OM4A 1DRSA 2LCRA 1LXHA 1F94A 2JVEA 4XJJA 1RL5A 3QB4B 1NTNA 2UX2A 1IDLA 1NTXA 1BTEA 1CDQA 2VLWA 1IKCA 1NYUA 4LFTA 1KBTA 1REWC 2H5FA 1CDRA 2N99A 4AEAA 4BIKB 1G6MA 1HOYA 1FASA 1RGJA 3BT1U 1JBDA 3U73U 1H0JA 3EVSC 3BT2U 1QM7A 2NBTA 1F8UB 1KS6A 2K3GA 1BXPA 1FSSB 1IJCA 1FRAA 2PJYB 2QJBC 1ES7B 2H7ZA 3EBXA 1IDHA 1JGKA 3NH7A 1NYSA 1MAHF 3NEQA 1CDSA 1ABTA 1LJZA 3VTSA 2CDXA 3ERAA 1CB9A 2HLRA 5DZ5A 4DO8A 4BDTB 1IDIA 1CDTA 1CODA 4UY2C 4EY8B 1S4YA 5IMTD 6EBXA 1ONJA 1CVOA 2GOOB 2MUOA 1MR6A 2PJYC 4P7UA 2QJAC 1KBSA 2BTXA 1NORA 1CCQA 1CTXA 1IQ9A 5IMYC 2QC1A 1HC9B 3NDSA 1FFJA 1CXNA 2MJ4A 1TXBA 4RUDA 2H7ZB 1NXBA 2FD6U 1UG4A 2JQPA 2X8BB 1KC4A 1TFSA 3KFDI 2GOOC 2J8BA 5DO6A 2H64B 2QJ9C 2OFSA 2MJ0A 2ABXA 1CHVS 1KTZB 2CCXA 1IK8A 1ERGA 1KL8A 3U74U 1COEA 4FAOC 1TXAA 5DU1A 1HAAA 1IDGA 1NEAA 1ZADA 2MFAA 2UWRA 4QTIU 1JE9A 1QKDA 1CRFA 2H8UA 2MHYA 1XT3A 3PLCA 1KU6B 2L5SA 2ERAA 2CRSA 1HAJA 4KSNA 2H64C
chains in the Genus database with same CATH topology
2I9BE 1FF4A 1LXGA 2H62D 1LSIA 4ZQYA 1KBAA 1I02A 2H62C 1CREA 1LX5B 3LAQU 3KFDE 2CRTA 1W6BA 1YWHA 4OM5A 4HQPF 3FEVA 5EBXA 1TGXA 1KXIA 1M9ZA 2CTXA 4FAOE 1B41B 1ERAA 1V6PA 1KFHA 1L4WA 1HC9A 1PLOA 1QKEA 3HH7A 1CXOA 2L03A 1VB0A 2HLQA 2MJYA 2LA1A 1FSCA 2MUPA 2BHIA 4IYEA 4OM4A 1DRSA 2LCRA 1LXHA 1F94A 2JVEA 4XJJA 1RL5A 3QB4B 1NTNA 2UX2A 1IDLA 1NTXA 1BTEA 1CDQA 2VLWA 1IKCA 1NYUA 4LFTA 1KBTA 1REWC 2H5FA 1CDRA 2N99A 4AEAA 4BIKB 1G6MA 1HOYA 1FASA 1RGJA 3BT1U 1JBDA 3U73U 1H0JA 3EVSC 3BT2U 1QM7A 2NBTA 1F8UB 1KS6A 2K3GA 1BXPA 1FSSB 1IJCA 1FRAA 2PJYB 2QJBC 1ES7B 2H7ZA 3EBXA 1IDHA 1JGKA 3NH7A 1NYSA 1MAHF 3NEQA 1CDSA 1ABTA 1LJZA 3VTSA 2CDXA 3ERAA 1CB9A 2HLRA 5DZ5A 4DO8A 4BDTB 1IDIA 1CDTA 1CODA 4UY2C 4EY8B 1S4YA 5IMTD 6EBXA 1ONJA 1CVOA 2GOOB 2MUOA 1MR6A 2PJYC 4P7UA 2QJAC 1KBSA 2BTXA 1NORA 1CCQA 1CTXA 1IQ9A 5IMYC 2QC1A 1HC9B 3NDSA 1FFJA 1CXNA 2MJ4A 1TXBA 4RUDA 2H7ZB 1NXBA 2FD6U 1UG4A 2JQPA 2X8BB 1KC4A 1TFSA 3KFDI 2GOOC 2J8BA 5DO6A 2H64B 2QJ9C 2OFSA 2MJ0A 2ABXA 1CHVS 1KTZB 2CCXA 1IK8A 1ERGA 1KL8A 3U74U 1COEA 4FAOC 1TXAA 5DU1A 1HAAA 1IDGA 1NEAA 1ZADA 2MFAA 2UWRA 4QTIU 1JE9A 1QKDA 1CRFA 2H8UA 2MHYA 1XT3A 3PLCA 1KU6B 2L5SA 2ERAA 2CRSA 1HAJA 4KSNA 2H64C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I9B E;  1FF4 A;  1LXG A;  2H62 D;  1LSI A;  4ZQY A;  1KBA A;  1I02 A;  2H62 C;  1CRE A;  1LX5 B;  3LAQ U;  3KFD E;  2CRT A;  1W6B A;  1YWH A;  4OM5 A;  4HQP F;  3FEV A;  5EBX A;  1TGX A;  1KXI A;  1M9Z A;  2CTX A;  4FAO E;  1B41 B;  1ERA A;  1V6P A;  1KFH A;  1L4W A;  1HC9 A;  1PLO A;  1QKE A;  3HH7 A;  1CXO A;  2L03 A;  1VB0 A;  2HLQ A;  2MJY A;  2LA1 A;  1FSC A;  2MUP A;  2BHI A;  4IYE A;  4OM4 A;  1DRS A;  2LCR A;  1LXH A;  1F94 A;  2JVE A;  4XJJ A;  1RL5 A;  3QB4 B;  1NTN A;  2UX2 A;  1IDL A;  1NTX A;  1BTE A;  1CDQ A;  2VLW A;  1IKC A;  1NYU A;  4LFT A;  1KBT A;  1REW C;  2H5F A;  1CDR A;  2N99 A;  4AEA A;  4BIK B;  1G6M A;  1HOY A;  1FAS A;  1RGJ A;  3BT1 U;  1JBD A;  3U73 U;  1H0J A;  3EVS C;  3BT2 U;  1QM7 A;  2NBT A;  1F8U B;  1KS6 A;  2K3G A;  1BXP A;  1FSS B;  1IJC A;  1FRA A;  2PJY B;  2QJB C;  1ES7 B;  2H7Z A;  3EBX A;  1IDH A;  1JGK A;  3NH7 A;  1NYS A;  1MAH F;  3NEQ A;  1CDS A;  1ABT A;  1LJZ A;  3VTS A;  2CDX A;  3ERA A;  1CB9 A;  2HLR A;  5DZ5 A;  4DO8 A;  4BDT B;  1IDI A;  1CDT A;  1COD A;  4UY2 C;  4EY8 B;  1S4Y A;  5IMT D;  6EBX A;  1ONJ A;  1CVO A;  2GOO B;  2MUO A;  1MR6 A;  2PJY C;  4P7U A;  2QJA C;  1KBS A;  2BTX A;  1NOR A;  1CCQ A;  1CTX A;  1IQ9 A;  5IMY C;  2QC1 A;  1HC9 B;  3NDS A;  1FFJ A;  1CXN A;  2MJ4 A;  1TXB A;  4RUD A;  2H7Z B;  1NXB A;  2FD6 U;  1UG4 A;  2JQP A;  2X8B B;  1KC4 A;  1TFS A;  3KFD I;  2GOO C;  2J8B A;  5DO6 A;  2H64 B;  2QJ9 C;  2OFS A;  2MJ0 A;  2ABX A;  1CHV S;  1KTZ B;  2CCX A;  1IK8 A;  1ERG A;  1KL8 A;  3U74 U;  1COE A;  4FAO C;  1TXA A;  5DU1 A;  1HAA A;  1IDG A;  1NEA A;  1ZAD A;  2MFA A;  2UWR A;  4QTI U;  1JE9 A;  1QKD A;  1CRF A;  2H8U A;  2MHY A;  1XT3 A;  3PLC A;  1KU6 B;  2L5S A;  2ERA A;  2CRS A;  1HAJ A;  2H64 C; 
#chains in the Genus database with same CATH topology
 2I9B E;  1FF4 A;  1LXG A;  2H62 D;  1LSI A;  4ZQY A;  1KBA A;  1I02 A;  2H62 C;  1CRE A;  1LX5 B;  3LAQ U;  3KFD E;  2CRT A;  1W6B A;  1YWH A;  4OM5 A;  4HQP F;  3FEV A;  5EBX A;  1TGX A;  1KXI A;  1M9Z A;  2CTX A;  4FAO E;  1B41 B;  1ERA A;  1V6P A;  1KFH A;  1L4W A;  1HC9 A;  1PLO A;  1QKE A;  3HH7 A;  1CXO A;  2L03 A;  1VB0 A;  2HLQ A;  2MJY A;  2LA1 A;  1FSC A;  2MUP A;  2BHI A;  4IYE A;  4OM4 A;  1DRS A;  2LCR A;  1LXH A;  1F94 A;  2JVE A;  4XJJ A;  1RL5 A;  3QB4 B;  1NTN A;  2UX2 A;  1IDL A;  1NTX A;  1BTE A;  1CDQ A;  2VLW A;  1IKC A;  1NYU A;  4LFT A;  1KBT A;  1REW C;  2H5F A;  1CDR A;  2N99 A;  4AEA A;  4BIK B;  1G6M A;  1HOY A;  1FAS A;  1RGJ A;  3BT1 U;  1JBD A;  3U73 U;  1H0J A;  3EVS C;  3BT2 U;  1QM7 A;  2NBT A;  1F8U B;  1KS6 A;  2K3G A;  1BXP A;  1FSS B;  1IJC A;  1FRA A;  2PJY B;  2QJB C;  1ES7 B;  2H7Z A;  3EBX A;  1IDH A;  1JGK A;  3NH7 A;  1NYS A;  1MAH F;  3NEQ A;  1CDS A;  1ABT A;  1LJZ A;  3VTS A;  2CDX A;  3ERA A;  1CB9 A;  2HLR A;  5DZ5 A;  4DO8 A;  4BDT B;  1IDI A;  1CDT A;  1COD A;  4UY2 C;  4EY8 B;  1S4Y A;  5IMT D;  6EBX A;  1ONJ A;  1CVO A;  2GOO B;  2MUO A;  1MR6 A;  2PJY C;  4P7U A;  2QJA C;  1KBS A;  2BTX A;  1NOR A;  1CCQ A;  1CTX A;  1IQ9 A;  5IMY C;  2QC1 A;  1HC9 B;  3NDS A;  1FFJ A;  1CXN A;  2MJ4 A;  1TXB A;  4RUD A;  2H7Z B;  1NXB A;  2FD6 U;  1UG4 A;  2JQP A;  2X8B B;  1KC4 A;  1TFS A;  3KFD I;  2GOO C;  2J8B A;  5DO6 A;  2H64 B;  2QJ9 C;  2OFS A;  2MJ0 A;  2ABX A;  1CHV S;  1KTZ B;  2CCX A;  1IK8 A;  1ERG A;  1KL8 A;  3U74 U;  1COE A;  4FAO C;  1TXA A;  5DU1 A;  1HAA A;  1IDG A;  1NEA A;  1ZAD A;  2MFA A;  2UWR A;  4QTI U;  1JE9 A;  1QKD A;  1CRF A;  2H8U A;  2MHY A;  1XT3 A;  3PLC A;  1KU6 B;  2L5S A;  2ERA A;  2CRS A;  1HAJ A;  4KSN A;  2H64 C; 
#chains in the Genus database with same CATH homology
 2I9B E;  1FF4 A;  1LXG A;  2H62 D;  1LSI A;  4ZQY A;  1KBA A;  1I02 A;  2H62 C;  1CRE A;  1LX5 B;  3LAQ U;  3KFD E;  2CRT A;  1W6B A;  1YWH A;  4OM5 A;  4HQP F;  3FEV A;  5EBX A;  1TGX A;  1KXI A;  1M9Z A;  2CTX A;  4FAO E;  1B41 B;  1ERA A;  1V6P A;  1KFH A;  1L4W A;  1HC9 A;  1PLO A;  1QKE A;  3HH7 A;  1CXO A;  2L03 A;  1VB0 A;  2HLQ A;  2MJY A;  2LA1 A;  1FSC A;  2MUP A;  2BHI A;  4IYE A;  4OM4 A;  1DRS A;  2LCR A;  1LXH A;  1F94 A;  2JVE A;  4XJJ A;  1RL5 A;  3QB4 B;  1NTN A;  2UX2 A;  1IDL A;  1NTX A;  1BTE A;  1CDQ A;  2VLW A;  1IKC A;  1NYU A;  4LFT A;  1KBT A;  1REW C;  2H5F A;  1CDR A;  2N99 A;  4AEA A;  4BIK B;  1G6M A;  1HOY A;  1FAS A;  1RGJ A;  3BT1 U;  1JBD A;  3U73 U;  1H0J A;  3EVS C;  3BT2 U;  1QM7 A;  2NBT A;  1F8U B;  1KS6 A;  2K3G A;  1BXP A;  1FSS B;  1IJC A;  1FRA A;  2PJY B;  2QJB C;  1ES7 B;  2H7Z A;  3EBX A;  1IDH A;  1JGK A;  3NH7 A;  1NYS A;  1MAH F;  3NEQ A;  1CDS A;  1ABT A;  1LJZ A;  3VTS A;  2CDX A;  3ERA A;  1CB9 A;  2HLR A;  5DZ5 A;  4DO8 A;  4BDT B;  1IDI A;  1CDT A;  1COD A;  4UY2 C;  4EY8 B;  1S4Y A;  5IMT D;  6EBX A;  1ONJ A;  1CVO A;  2GOO B;  2MUO A;  1MR6 A;  2PJY C;  4P7U A;  2QJA C;  1KBS A;  2BTX A;  1NOR A;  1CCQ A;  1CTX A;  1IQ9 A;  5IMY C;  2QC1 A;  1HC9 B;  3NDS A;  1FFJ A;  1CXN A;  2MJ4 A;  1TXB A;  4RUD A;  2H7Z B;  1NXB A;  2FD6 U;  1UG4 A;  2JQP A;  2X8B B;  1KC4 A;  1TFS A;  3KFD I;  2GOO C;  2J8B A;  5DO6 A;  2H64 B;  2QJ9 C;  2OFS A;  2MJ0 A;  2ABX A;  1CHV S;  1KTZ B;  2CCX A;  1IK8 A;  1ERG A;  1KL8 A;  3U74 U;  1COE A;  4FAO C;  1TXA A;  5DU1 A;  1HAA A;  1IDG A;  1NEA A;  1ZAD A;  2MFA A;  2UWR A;  4QTI U;  1JE9 A;  1QKD A;  1CRF A;  2H8U A;  2MHY A;  1XT3 A;  3PLC A;  1KU6 B;  2L5S A;  2ERA A;  2CRS A;  1HAJ A;  4KSN A;  2H64 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...